current user: public

If you have questions about the server, please let us know.

Query: gi|30260197|ref|NP_842574.1| DNA polymerase III subunit beta (BA_0002) [Bacillus anthracis str. Ames], from B.anthracis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# E-value Template Links and tools%idFirst MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTYLast
1 0.000e+00UniRef50_A0A174XCJ8 Beta sliding clamp n=499 Tax=root TaxID=1 RepID=A0A174XCJ8_9FIRM  ali  35  1MRIICKKSNLVKGVSIVSKAVPSKTTMPILECILIDATTDVIKLTANDMELGIETTID--------GIIDSRGIIALNAKIFSEIVRKLPDNDVVIETESDNQAIITCEKAKFNIAAQSGDDFSYLPAIEREDFITISEFTLKEVVRQTIFSIADNDTNKMMTGELFEIDNDVLRVVSLDGHRISIRKIELKDAY--QPRKVIVPGKTLQEISKIIGEADAEVEISFTKNHIVFEFDRTLVVSRLIEGEYFRIDQMLSSDYETRVHVNKKELLDCIDRATLLIKEGDKKPIIID-IKNESMELKIKS-QIGSMDELIFCTK-DGKDLMIGFNPKFLIDALRVIEDEEVDLYFMNAKAPCFIKD-ENQSYIYLILPV... 363
2 0.000e+00UniRef50_A0A1G3BFQ2 Beta sliding clamp n=3 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3BFQ2_9BACT  ali  28  1MKFSCQRSVLTEGLQLVSHVTAGTTTKPILQAVKIEVSENKAILEATDLEVGVRYLLE-------PVEVQEKGIVVLQEGRLAELLREWPEERVCMELKG-AMCHISGSGGAFKLAGYDPKEFPTIPTGGEKGAIEIEAGELVEMIRKVVFACASERVRHTMTGVLFQVEAGILRMVATDGRRLASAREK-KGVSGRGPMEGIVPRKGIEQLARIAERQEGKIRLKMEETHLLAGSDRATLCAQLIEGQYPNYKEAIPANNDKRAEVDVEILAGAIRRASILTTEER-RLVRL-GLRKGRISVEVETPEVGEAKVDIDA-NYEGENLEIGFNPDFLLDALKAIGKGAVHLEFKEATSSAVIKS--GQDFIYVVMPIR.. 363
3 0.000e+00UniRef50_B5YGU0 Beta sliding clamp n=7 Tax=Thermodesulfovibrio TaxID=28261 RepID=B5YGU0_THEYD  ali  31  1MHLKLKKQKIQESLSKIQNIVEKKSIMPVLNHFLMDVTENAVFILATDLETAVKQPLEAE--------VLEIGKACIPARKFYEIVKEL-DEDIEIMLLEQ-WIKIQSGRSNFRLASLDPSEFPVWPQIGDATQINLSRDFLLTAIEKTIYASGEADARYVLNGLLFQIKEAEFNVVGTDGHRLAHFKATVEDISSEGEKKVILSKKSLNELRKFLSDT-ETVSIHIGKTHVMCEIDGINFLTRMIEGNYPDYETVIPRHNDKIAIVDKNSLIASLKRVSVLSRE-RQNAVKTEW-DKDLLIISSSDPEIGEARDELTVD-YQGEPFIIGFNARYLIEALERITSDKAKITMSEPDKAVYITDGEAASFVYVVMPLR.. 367
4 0.000e+00UniRef50_A0A2D7U185 Beta sliding clamp n=10 Tax=Bacteria TaxID=2 RepID=A0A2D7U185_9PROT  ali  25  1MNFKILKSKXSEPLSLLASVAESRQSIPILSNIYIKAENDLITLIATDLEIELSFKIKCDS-------IIEPGETTVSARKIFDLTRSLSDEPLEFNLKEN-QLIVTALKFNGEFAILPIQDFPVIEIEKFDLETTLNGQVLADLIDQTSFAMASQDVRYYLNGILVEIEGSNVNLVATDGHRLAWATQSLESDLDEN--KLILPRKSALELQKXLNLHPGVVNLSFSSNQILISSDEFRFVSKLIEGNYPDYQKVFPSGEEQTLKVEKSLIQTALSRASVLSNE-KYRGVKF-ILTKDNLKICANNPSKETAEEEISVD-YSGDDLEIGFNISXIQDSLSVIHNSEVDFVFYGPENSCXIKNNKNDNLVHVIMPMR.. 365
5 0.000e+00UniRef50_A0A1Q3MXH8 Beta sliding clamp n=1 Tax=Bacteroidetes bacterium 47-18 TaxID=1895926 RepID=A0A1Q3MXH8_9BACT  ali  26  1MHFIVSSSVLLKNLQLVGGIISSNVILPILEDFLFDLDNQTLTLTGSDLETMIKVKLEVQVDGDAGQN---KGRICVPSKILLEYLKNLPEQPVKFNINQDQTLEISSNTGKYKIGGQKADEYPKEPVADDTGSVTIPSKVLQDAIASTIYATSTDTLRPAMTGVYFELGQDQTTFVATDAQRL--VKLTRNDVKSGFERGFIVPRKPLQQLKNIIPSDDTALEILFNNSHLFVKNEKLSLSCRLIDAKFPPYKSVIPQENPFFLIINRADLISCLRRVSIFASKGSSQVV--FSIVGNTVNISAQDADFSEGKEELTCQ-YQGEDMKIAFNGKLLIEMLSNLVSEEVKLELSTPSRAGIYRPVNNEDLLQLLMPL... 373
6 0.000e+00UniRef50_B2KAM5 Beta sliding clamp n=2 Tax=Elusimicrobium TaxID=423604 RepID=B2KAM5_ELUMP  ali  31  1MKINITKETFLEGLSVVQAGVSSRATLPILHNFLMETENGKIKLVRTDMEMASIHYIKAE--------ILEEGSVTIPLKEVSDILKNLPNDEINLTVGEDNKVHIKSGKSKFWVIGTPKSEYPLIPEIDKSNLINLKIKEIQEMVEKTIFSSSTQETRYVLNGLLWVKTGNKFEVVATDGRRLALAVDTIESDTKD--FKIIIPTKILNELLRFFSSEDDTLVLSVASNQVSFNIKETTYISRLIEGNFPNYEQVIPNKKVMGFLSDTKEILASTKRASLCANE-LGGTVKYS-LNNNVLKITSNSQKM-DFSDEMKVE-YTAEPFEISFNPQYVLDVLKNISTEKVEFSFINAAQPVLIEEINNTKFKYVIMPVRS. 369
7 0.000e+00UniRef50_A0A1F6RIF6 Beta sliding clamp n=1 Tax=Candidatus Melainabacteria bacterium RIFCSPHIGHO2_02_FULL_34_12 TaxID=1801607 RepID=A0A1F6RIF6_9BACT :  ali  30  1MDVEVKTEYLKKVVSCTSKATANKAIQPILNNLLLSCTNGSLVVSATDLDLAIECKLPAE--------VSKPGKVTLPAKKFDEIVSKIPGENINLSIDKNQLTKIISDRSKFQINGTSPDEFPEIKKSELENVYTISQEELLQAISLTSFATSKFETTSVLSGVNFEISGDEFEIGATDGSRLARYIGNLLNSKKKSKHAIVIPWRAVTELERLIKDGNNEVSFYFMPGQVIFQNNDFSLSTRLIDGNFPAYDKLIPKEQPLKVEFLRSEFLSSLERVAILANE-RTNVIKLSLSKGKTMQLSANSPDYGNATDEVDV-TYSGDDLDIAFNYRYMSEALRNLRIDKLVIQLEGSLSPIVLKPNENYNYTYLVMPV... 378
8 0.000e+00UniRef50_UPI000A0235A9 DNA polymerase III subunit beta n=2 Tax=Paenibacillus TaxID=44249 RepID=UPI000A0235A9  ali  39  5..IEVPQPILAEALQHVIKAVSANCPIPIMSGILLRANRDGLTLVSGNSSMMVQYEIPA----TENVNVQRTGSIVIPAKYFSEIIRKFPAGVVTLEMKEPLIITIQSGNAVYRLCGMDAEHFPQMPEINDGIQAHISSTALRNMIRHVVFAVSPSEKRPVLTGVSCQIDDGNLRFLATDSVRLASRLTRVSLAQDVIPPAIIIPGKNVHELSKMLNEEQEMVEITIGKSQIGFRTKNLLFQSALIDGSYPSVDRSIPQTHSTELIVDSVELLHAMERVSLLAGDD--NMIQLSINEHNDIELISNTAEIGDVLEGVHAEEMSGERLSICFNGNYMKDILRSVDSAKLRLACSGKWKPIVVQPVDDTESTYMITPLRSH 377
9 0.000e+00UniRef50_A0A1G0H7Q0 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_41_20 TaxID=1798283 RepID=A0A1G0H7Q0_9GAMM  ali  24  1MDIMVKRSTLLKPLQAISGIVEKKQTIPILANVFLNAQEKSLSLTATDLEVELIGSV-------SPETVMAQGRTTVSGKKLFDICRVLPEEALLHLTIDGNYLIIRAGESCFSLATLPVKDFPRIEEASFISEFSIRAQALKDLLGRVYFAMGLQDIRHYLNGALLHINQKSITCVATDGHRLALSSLP-NDKADTPQIKVILPRKSVLELMRLVNDNDRELFLSIGDGRLRMVAPDFVFTTKLINTQYPDYNKLIPRGTE-VATGGREVIRQALMRAAILSND-KLRGVRMR-LGPNKLQVMANNMEQEQAEETVSLD-YAGNEMEVGFNVTYLIDAFSSISSENVRCTFSDPDGGVLIESLDDIASMYVVMPMR.. 368
10 0.000e+00UniRef50_A0A1W9TFJ8 Beta sliding clamp n=1 Tax=Planctomycetales bacterium 4572_13 TaxID=1971638 RepID=A0A1W9TFJ8_9BACT  ali  24  15MKVKFNRSALQEALNLVTSIIPSRTPKPILQCLRIATEQDAVRISATDLEAGITCLI-------SQVDIGEAGDIIVPADKLSSIVRESFDEVIVLEATE-SAVHLIGSDSRFTIYSHDPQQYPAIPGFGGEADLEVRLSALQEGIEYTIFSAARESTRYALNGILWEVSGKKLSLVATDGRRLAKATVALEKTAKLPENRIIVPAKTMSLLDKIPAHDDGMVQVRFVNNQIVLACETVVISSNLVEGNFPKYDDIIPKDHDKKITLPRDTVLSAVRRAALLANED-SKGIKLA-LDKGTLVFTSRTPETGDAKIDMAIE-YEAEPIEIGFNPQFLVDVLRVLKADDFELHLGQSDRPGLIKS--GSNFLYIVMPV... 377
11 0.000e+00UniRef50_A0A109CC62 Beta sliding clamp n=3 Tax=Nitrospirae TaxID=40117 RepID=A0A109CC62_9BACT  ali  25  1MIVKVSKDELYKRLGDIQNIAEKKTTIPILSNFLLEVSREKSTVYATDLEM-------AIGEPIEIIEIEKSGVICLPARKIFEIAKEV-AGDIHIEEDDMNWIKMKSGKSSYRIAALNPDEYPHWPTLGDNTGFQIKTEKLADMLDRTIYCAGENDPRYALNGVLFHVKDKKIILVGTDGHRLAVIYSDMEMDTEE-EIKAILPRRAVMELRRLITGLQDDIRFEIAKNHIRFFLGEKVFLTKLIEGTYPNYEQVIPVNNNKSVVMDREEFTKTLRRVSVIGRE-KSRVVRVD-LEKDQINVFATDPELGEAQDGLKVE-YDGEPITLGFNSRYVLEAVASMKSQNIIMELLDTLTPTLLLEEGNKDYKCVLMPMR.. 367
12 0.000e+00UniRef50_A0A2P6JYK8 DnaA n=2 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6JYK8_NEPCL  ali  25  473.RLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTTQQALTITGSDLEVELVAS-----TTLAEGACVEAGETTVPARKLVEICKSLPTAAIDLQITEDQRCILKSGNSRFVLGTLPAEDYPLLTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDQNQLRTVTTDGHRLALCEV-LASSTASAPIQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTVRFTTKLIDGKFPDYRRVIPKGGDKHVFIAHDVFKQSLQRVAILSNE-KLRGVFLN-FNQDSLQLRANNPEQDEAVEDLAIQ-YQDAPLEMSFNAQYILDVLSVLDGDDVKMSMTEANQSVLVQDPAHPDQTYVVMPMR.. 852
13 0.000e+00UniRef50_A0A2H0L1D6 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_41_10 TaxID=1974792 RepID=A0A2H0L  ali  29  1MEVTCSQTDLSFALNTVSRAINNTNTLPVLNNVLIEAKENALYFSATNLEIAIKTKIAAK--------VDTEGGITIPARLLTSYVQLLNEKKITLSVTRELSLELNSEHDYTKIKGIKVEEFPAIPVIEEESTAEISAAKLLEVLQSTYFSASIHSSRPVLAGVFLKFENSQLIVAATDSYRLAERKVELKKET--QPFTAILPVRTASELIKLLSDPKASVLVKLSKNQIEFSFGEITLVSRLIEGVFPDYEKIIPQEEKTKITVGTSDLILAIKKISLFAREVNNNM-KL-TVDQNSLTLSTDETKVGEGEITIPV-KLTGEANQIAVNAQYLLEVLSANPSKEVTIIINEKLSPLVVKPADN-DYIYLIMPLK.. 364
14 0.000e+00UniRef50_A0A1F7U8E1 Beta sliding clamp n=3 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A1F7U8E1_9BACT  ali  26  1MKFSCTQENLHQGLSVVSHIANKNINLPILSNVLIKCDTAGLKLLTTNLEIAINCVV--------RGKVEAAGEFTVPSKLFSDYVALLPKDRVDVSLEGNSLV-ISCGTYKTTLHGVPASEFPLIPTIDRKQRIAVSVSELKKAIGQVLFAVAPNESRPEISGVMMRFTSGGLRIVGTDSYRLAEKVVAADTTHSTESVSVIVPSRTVAELIRILGSGPSQLEIFIGDNQIMFAFNNTEIVSRTIEGKYPDYRQLIPDRFETEVVVEKEELLRAVRTTSLFSRTG-LNDVHLTFRPDQPIHLSSRNNQTGEHAVDLEGV-VNGKNNEVTVNFRYFQDGIANIESGGVTLQLIDGMSPCVIRPVKDGDYLYIVMPIR.. 382
15 0.000e+00UniRef50_C8PZ53 Beta sliding clamp n=65 Tax=Proteobacteria TaxID=1224 RepID=C8PZ53_9PROT  ali  26  1MQLVISRDLLLQAINLISKAADKRHNMVILGNMKLALTDSQLVMVASDLELELQATLNLPASAC-----KQPGEITVPANKFKDIVKLLPDGPVSISVGNDNQCLIVCGSSRFKLSTLPAQDFPLLGEPEQVTPIQLGREDLVDLLDKTHFAMAVQDVRYYLTGMLFEVKERQLATVSTDGHRLALARTVIACD-DSVALAAILPRKAVLELQRLLPNQDNKITLNVGREQVLLPFGEVDFTARLIDGKFPDYRRVMPSLTNKIARISQEQLANVLRRVAILSNE-KSRGVIFDFSGDNNLMVRASNAEQDEASEQLEV-KYQGEPLEISFNVAYLLDVLNVLQGE-IDFHMSQANASVLVQQVNDSKHEFVVMPMR.. 390
16 0.000e+00UniRef50_A0A192UNR7 Beta sliding clamp n=2 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A192UNR7_9FIRM  ali  32  1MKFVINQKDLVQQLNIVNKGISNNNIQPILSGIYIETTTNTLILRGTDMELGIECQLDI--------TVEEPGKIVIPSKYFVEMMKKLPAIDLYFTTGENKQLKIDYGASELKLNFYDGEEYPAIHDFIGNIIFTMKGEDLNKGIQRVQVAVSNDSNRPIFTGVLLEIKENRIHFVSSDTHRLCHTSMALDLDNIENT-EVIVPAKSLKEIASII-NPEDNVEIHLTDNRILFKIENRKIVSRLIEGKFVNYSQVIPSQFGIELKIMRRSFLETLDRAFLLTRDEKLNTVKLN-IEENKLIVSCKSSEIGDIYEEIPIYS-NGGDLELGFNAKYLIEVLRALDTEEVVVKLSTPQNPGIIEPISDEDVLYLILPVR.. 370
17 0.000e+00UniRef50_R5GY44 Beta sliding clamp n=2 Tax=environmental samples TaxID=2231195 RepID=R5GY44_9FIRM  ali  29  1MKFSCAKEVILSAVQTTSKAAAGKSSIPALEGVLMELEGNTLTVTGYDLEIGIKTSIEVNG--------IESGNIVINARMAGDIIRKMPSGDIIFECGGNNIAEISGRDTNFSIMCMSADDYPNVPQVNPETSFTMPQKLLKSMIVQTKFAVAVVDSKPALMGCKFELEDNVLSVAAVDGVRIALRQEPL----TYNNMSFIVPAKTLEELTHILSDDDKNVIVSVDRNQISFTVDGYIMISRLLDGDFIPYKTYLKNTSDVYAEVNCREMTDMLERTMLIINEKNKNPIRCE-IKDNYISMSCTTS-IGKVNDKIAV-KYNGEPIVVGFNAKYMLDAFKACDSDTVKMCVTSSVAPILILPMEGTSFTYLVLPMR.. 363
18 0.000e+00UniRef50_A0A2M7XDG4 Beta sliding clamp n=1 Tax=Candidatus Uhrbacteria bacterium CG_4_9_14_3_um_filter_41_35 TaxID=1975034 RepID=A0A2M7XDG4_9BACT  ali  24  1MKFSCTRENLYQGLAITSRVSGKNVNLPILSNVLLKADKGSLKLVSTNLELTVTCNV--------RGRIEQSGEYTVPSKLFFDFVNLLPNEKVDIDLLDDT-LSIACGNAKTKIKGIIASEFPVVPPVEGDVSYSVPVTEFQDALSQVLFSAATSESQPVLTGVLMSFHDGTLTLAALNGYRLSEKIFKISGGSGEQ-RKVIVPQRTLAELARVIGEASTTVEIQFSRNQIVLKYGAVEISGRTVEGDYPDYRSIIPENKVTEVTVNRSEFIQAIKTASLFARTGLFDVGIVLDPEQGTLELKGADSTRGENTVVMNA-TLSGNKNSLTLNFRYLLDGMNAMKSENVTMRVVDSMTACVFVPEAGPGYQYIVMPIR.. 379
19 0.000e+00UniRef50_A0A2M9NUQ4 Beta sliding clamp n=18 Tax=Bacillales TaxID=1385 RepID=A0A2M9NUQ4_9BACI  ali  40  1MEFMVNKNCLHQALSAVGHAISTKTTPSILTGIKIVANVDGLILLGSNSDIIIEKTIPVTLGGERVLEVYDKGSVVLPAKYLSDIIQKLSDD-IHVKLNANHSVTIKSAEIVTDLNGFNSTEYPDLPFIDDSAFIEVHSEGLQEIIKQTAFAVSKSESRPALAGVNMTFKENLLCCVATNSHRLASSELALETKITG---SFIVPSKSLNELTKLMNDEAGVVHIFVSKSYVGFKSSHISLFTRLIEGSFPNVLEMLPRDSKTTVIMDTNKLLKGVDRACLFARDCRNNNVHLDLLEGNKLQISSNLTERGKIKEIQTINGIKGAEVNVSLDGYFLLDALKVIKEKEVKLSFGGAMKPVLIEPVDGSSQLHFISPVRS. 375
20 0.000e+00UniRef50_A0A1Y1RY01 Beta sliding clamp n=2 Tax=Spirochaetes TaxID=203691 RepID=A0A1Y1RY01_9SPIO  ali  29  1MKFTCDKASILREVSVAQEIISSRNALSILSNVLIEVADNTLTLKATDLKVGFETQVPVE--------VAVPGSTTIYCDKFLGILRSLPDGEIEFEQQDN-RLIIRFKKIDFQLKSITSDKYPEIQDVSQDAYFQVPQNDLIEMINQTIFAISDDETRFFMNGVYFEKSDSSLVMVATDGRRLSYIMKEVDGSIPDFN-GVIIPPKILNLVRKLAS-GQGSISIAVTDKNIFMQFDNQKVSSNLIEGQFPNYRRVIPDSQEYRIVINRNELMDALRRVSLLV-EQKSRRVYL-TLNENSLVLNSEESEIGVAREEITCE-YSGPEATIALNYLYLTDPLKVIDNEEIAIEYTEANKAISIMSIPAGDYFHIVMPM... 364
21 0.000e+00UniRef50_A0A1G1C9T1 Beta sliding clamp n=1 Tax=Microgenomates group bacterium RIFCSPHIGHO2_01_FULL_45_11 TaxID=1817749 RepID=A0A1G1C9T1_9BACT  ali  26  1MKVILLPENFKKAISYGERFVATKPQIPVLGNLLFQAKEGQFFVAATNLETGIKFRIGAK--------IEGEGAVTVPARVISELVASLPTEKVFLSVEGEE-LSIKCGRFTATIQGLTGAEFPVFPKKDKGLTLEVPTTFFQEVVERVGFAASSDESRPVLTGILFNWQ-RRVRAVATDGYRLSLMEADLGEGVVKKEVEVLLPARSLSEVERVLSDGEQTIRLSLEQRQMFWTTGDLEVVVRALEGDFPDYQGIIPGEGETIVEIDRNELLQAVKLAAVFARDSA-NIVKWRFTKEG-LEISARSSQVGTNITTVGVDYHKGNSGTIAFNSRYLLECLSRFREERVRFEMTEALRPGVFTGVKSKEFKHIIMPVR.. 371
22 0.000e+00UniRef50_A0A2B9XLV0 Beta sliding clamp n=3 Tax=Bacillus cereus group TaxID=86661 RepID=A0A2B9XLV0_BACCE  ali  37  1MKFTVETKELLKGL-FVRNIVSNNASMPILKTFKLTCNDEGLEITGSDGDITMTSFVPRMIEETEVVEIKRPGSILLPS-LFNDIVKKLPGEKTTIEVADNNIVSIKSKKSRFTLNGINAEEYPRSQFKEDVEPLVFKEAELSSIFNQTLFAASDNSSRPILSGINMVLESDKLLIQATDSYRFARKDSSFSKPV--LPFNIVIPKKTMKELLKVMDTGDKEVEIHINDNQILFKTEKVLMYSRLLDGKFPNVSQLIPTLNNTNLQIDKTQFNQAIERATVL--DDAGKTIVKLTFSSSSLVIDSNQIGIGKVTEEIEIQSFEGDELSISFNGKYLKEAFKNFKGDIVTLQLNGPMKPVVLLDNVDKNYLQLILPVRTY 373
23 0.000e+00UniRef50_A0A2E6Q2Z3 Beta sliding clamp n=5 Tax=Phycisphaerae TaxID=666505 RepID=A0A2E6Q2Z3_9BACT  ali  28  19MKIVCDRTALADAVSLVSGVVAARSPSPVLQCLRLSAGNGQLRLSATDLEIGVAQSID-------EVDVQQEGEVLVPADKLSQIVKASDDPTLTLEADGD-RLRIRGLGSNWSLHGFPVSEAPEVEDFDESITYEVPAVILRKQIQRTLFAAANEQSRYAINGVLFERSGQTLRCVATDGRRLALSSCSCEK-TTDQDGNTIVPSKALQLLGKLLDAAQGEVRVSIREGRAHFGIGHATITTTLVEGSFPPWSDVVPKDNDIHVTMDTSSLAGAVRRAALLTSQE-SRGVKL-TFSAGHLVITSRAPDTGEAEIRVDC-NYEGDELGIGFNPGYLTDALKIIDSPEITLSLKGPQKPGVLKA--DGEFVYVVMPV... 387
24 0.000e+00UniRef50_J9YWF2 Beta sliding clamp n=18 Tax=Alphaproteobacteria TaxID=28211 RepID=J9YWF2_9PROT  ali  27  1MKFNINQQDLQQALNYCQGVIEKRSTLPILSNILLDANNSNLTITATDLDLIFIHQI-------KNVEILEPGSTTTTSSIMYDIIRKFTSGKINLSLKDESKLQVESEKSLFNLNCINASEFPLTDENFNQNEFSIKSKQLLKLLNKCKFSVSNDETRHYLSGIYLEVEDKYLTAAATDSHRMSISKVRLENKIEFEP--IILPKKTIFQLCSLLDNYDGEVKVSNAKSKIKFELDNSILISKLIDGKFPNYIQVIPKNNQKKLELDLKLFLDSVDRVASVSLDKK-DGVKFN-LSKDILNLSVNNTNSGDGKESLNV-SFDHE-LEISFNSRYLIDVASQLDGEKIEVYFNDTGSPALIKDPGDFDSIYVVMPMK.. 369
25 0.000e+00UniRef50_A0A2M6WLF6 Beta sliding clamp n=7 Tax=Candidatus Falkowbacteria TaxID=1752728 RepID=A0A2M6WLF6_9BACT  ali  27  1MKFSCTQENLKIGLLNIVHVAGKNINLPILSNVLIDVSDSVIKLIATDLEIGVTAAI--------RGKVEAVGKTTVNAKLITDYVNLLPNKRVDIELEDDG-LKIECDNFKTKIKGEDPGDYPIIPLINKTNCFSFSFDGFKKTIAGVLFAAATDETRVELSGVYFEFGETELTLAATDSYRLVERKIKYKNKENNGQKKLIIPSKTLMEAVRMSEKSDKEIKVYVSENQVLFAYDEVELVSRIIEGQYPDYKQIIPEENKTVVKLDRRELAQAVKASSLFSKTNVNDVELKYANGSKKVVVSSLNAQSGQSTAEVFAEG-SGKDNGVVLNYKYLLDGLNNFESERVILEIADANTPVLLKIENQADYLYIIMPIK.. 382
26 0.000e+00UniRef50_A0A1G1ZNW5 Beta sliding clamp n=2 Tax=Candidatus Harrisonbacteria TaxID=1817905 RepID=A0A1G1ZNW5_9BACT  ali  28  1MKLILLKTNLKEGLDAVSHATGENTHLPILKNILLKASSNRIELAGTNLELAISKYISGKT--------IEEGGIAIPSGTLSSLISNLPDERINLETNSNTLV-IKSDNYEARLQGMSPEEFPLIPQIKDKEYLKISGGILKEALVQVVNATQYSEWRQELNGVLFDFEESRLVFVATDSFRLSKKIIAGSQFESNWPAKVIVPIKTIQELIRIIKDT-EIISIYFDESQIMFISEETEVISRLIEGKFPDYEAIIPKTFETEAIIEKGNLMHALKLAGIFS--GKVNDVHLKIEEGHKMEIYSSNTQLGDNKYLLAVKSNKGMP-EIIFNWRYFVDGLKAISEKDIYMGINGEDKPVIIRSVNDQSLVYLLMPIR.. 367
27 0.000e+00UniRef50_A0A0P6X343 Beta sliding clamp n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A0P6X343_9CHLR  ali  27  4.KVTVQKNTFAESLAIVGRAIASHTHLPVLGNILISKEESQLRLSATDLTIGVSVWMDAKMDGDVGL--------TLPAKTLTDVVNSFTEPEVTFSVNGKPEAALKCGTYKGVVKGMEAEEFPKMPEFDTSGGIPIDAATLKEMIRAVAFAASVDESRPVLTGVLLQMEGKTISLAATDGFRLALHKTEVALSLE--KKQLIIPASVLKEVLRILSATKSTVTLYLAGSQVVLRLDDVQIVSQLIDGKFPDYQVIIPKGYKTRTIVDAGELLKACKQAGIIAREG-SNVVRFHTDQSGKVKLLAASAETGESEIELDA-TVEGQELEIAFNVKFLQDALEAISTKRVVIETNAHNTPAMIRPEEQDAYRYVLMPM... 385
28 0.000e+00UniRef50_A0A0Q9YPY0 Beta sliding clamp n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q9YPY0_9COXI  ali  24  1MRFLIHREALLKPLQRVAGTVDKRPQKPILSNILITVKSQLLSLVGTDLEVELISRIPLAENADA-------GEVTVGAKKLIDICKALPENQIEFNYQ-NNKLSLKADRSRYSLACLPADDFPQIEQSSADIEISLSQSILRQLLSSCGFALSQDTARYYLNGICLSFEPDGLRVTATDGHRLATLKASCALNMSEA-REVIIPKKAVLEMQRLFAEGEEEVGIVIGKNHLRTITTGYSFVTKLIDGKFPSYKAILPSAPGETVVLNRELFKNALTRVSALLSE-KQRGVRLH-FSHNLLKLITINSDKDEGVEEMEA-SFSGDDIEIGFNVSYLLDYLTAMHTETITMTVIDPNSSALFSCAEGEGFLYVVMPMR.. 373
29 0.000e+00UniRef50_A0Q3U8 Beta sliding clamp n=33 Tax=Francisellaceae TaxID=34064 RepID=A0Q3U8_FRATN  ali  26  1MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVSCNTTI--------KLALNADKIYNIVRSLNENSIDFRVNEN-KVTIVSNNSTFNLISLNADNYPLIDSINEQASFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINANLLRAVSTDGHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILAND-KYKGVRLN-ISQNQLLLSANNPDNEKAEDKIEVQ-YNDQPMEICFNYKYLLDIINVLSEETMSIYLDNPNMSALVKDEKDNS-LFIIMPMK.. 366
30 0.000e+00UniRef50_A0A2E8WB56 DNA polymerase III subunit beta n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E8WB56_9BACT  ali  30  44.KAVIEREELVRGIQAVLDIVPSKSALPVLSNILVDATPDGITLSATDLDISIICGVN--------GEVEEPGSTTVPARKFSEIIRELPDESIRLEASEG-RVSIQSGQGTYALMSVPAEDFPELPSDIEGPEMNLDGDLLSQMVAKTVFAVSRDETRPVLNGVLWQVREGRTTMVATDGHRLVKFSKSLPGPEGNQVVEAIVPPRPLNHLVKLLSSGSVLEQVKFGQNHLMFTLSDTCLYTRLIEGPYVDYEQVIPSGNAKKLHVSNSVLAPAVRRVSILAS-SQTHQVKMEV-DQDKVLLSANSQEIGGEAEEEIEAKYGDDAMAVGYNSGYLGDVLRRIDSDDVVFELDSPVTAGIIRPVDGEDYLCLLMPLR.. 435
31 0.000e+00UniRef50_A0A0C1QIJ6 Beta sliding clamp n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0C1QIJ6_9RICK  ali  24  1MKIVIKKSNLQKALNHVQSIVEKRNAIAMLANVKIEAKDSRLAFTTTDMDISITDLVEAE--------VDQPYSTTIPVLTLYEIVKKIPEDDITFEASADNQILVKFASSKFTLPCLPAEEFPNFELGDTTHNFKISSGALKLLLTKTRHAISNEETRYYLNGIYLHSIESELRAVSTDGHRLARAEVALPEGAKNIP-GIIIPKKTVNELIKLVEDFDDDINVGLSVNKAIFEIGNSKLITKLIDGKFPDYTRVIPTNNDKQLEISCKDLIKSIELVISVSSD-KTRAVKLD-IEPSKVVLSASSEMNGNASTQMLAANYNLEPISIGFNSKYVLDSLNTMEGDTVRFLLSNSSGAVIALDSADDKSLYILMPM... 373
32 0.000e+00UniRef50_A0A1F2ZM09 Beta sliding clamp n=1 Tax=Alphaproteobacteria bacterium RIFCSPLOWO2_01_FULL_40_26 TaxID=1797226 RepID=A0A1F2ZM09_9PROT  ali  29  1MQFEVAKQILLKAIANVNGAVEKKNTIPVLQNIKIEAKNDKVILSATDMDILVTSSFEADMKNG--------GATTVPAQMFFDIVRKIPDGAIMIKQEKSSLLQIKAGKSKYNLPCIDASEFPNLSEGELGEEIEIETEKLTTMFDKTRFAISNDETRYYLGGLYLQAIKKELRTVATDGHRLALSLTPI---ILKTAFGVIIPKKSVAEIRRII-DGSQIVKIAVSRVKIKIISDQTTIVSKLIDGEFPDYDKVLPKNNNHIAVINRREFFDCVDRVSTVATD-KHKSLKL-IIENGKMNLQVETNDGSFAYEEMDL-NYTGERIETGFNSRYLLDIIGQIDNDELLMRFKDSSSPALIE-AKDMNSVFVIMPVR.. 365
33 0.000e+00UniRef50_A0A2D9TBE1 Beta sliding clamp n=3 Tax=Myxococcales TaxID=29 RepID=A0A2D9TBE1_9DELT  ali  24  1MELKIEKRDFLRGLTRTHAVADRKSSMPILSNVLLSTESKKLRLAATDLYLGVTAIAPA--------VVQKGGTVALAARTLFDIVKALPEGEMTITVGSDLQTTIELGRIRYKIPGLPGEDFPPIPNPGEADMTALDAELLAELIGLTSYSMSSDDTRPHLAGTMFQGDGKAVRMVTTDGHRLSKAEQVLDESSPMLDFSMLVPHKGVGELKRVVDDADEVVEVSTAGGNAFFKSGELLLSVKLADEQFPPYEKVIPQQQSKRAVCGRSKLIDSLRRISLVAND-KSGGVQLH-LEPGMLRIQSQSPDVGEGTEEIEID-YADEPISVGFNARYLLDALGALPHDEVALELSGSLDPGVIKPGGGVDFVGVIMPMR.. 377
34 0.000e+00UniRef50_A0A1J0LJB5 Beta sliding clamp n=83 Tax=Bacteria TaxID=2 RepID=A0A1J0LJB5_9FLAO  ali  24  1MKFIVSSSELLKQLQLLSGVINSNNTLPILDNFLFDLQDSELTITASDLETTVSSKITVNS--------ESNGKICVPAKLLTDTIKTFPEQPLTIRTKEENLFEIVSEQGNYSFGLERGDEFPMAPELESPSTVKLQGNVLAEAIGKTLFATGNDELRPVMTGVFFQLGTDKCIFVATDAHKLVKYTR--DDIKADETAEFIMPKKPLNLIKNILGNKDTEITIEYNEVNAKFIFEGTTLVCRLIDGKYPNYEAVIPKENPNTLTINRSAFLSSIKRVSIFSNKTTY-QIKLK-LAGNQLQLSAEDIDFSNADERLTCD-YNGGDLMIGFNSKFLSEMLSNLNSEDITLEMSEPNRAGIIKPEEGEEVLMLVMPV... 369
35 0.000e+00UniRef50_A0A2A8EZJ2 DNA polymerase III subunit beta n=1 Tax=Bacillus wiedmannii TaxID=1890302 RepID=A0A2A8EZJ2_9BACI  ali  39  1MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKIIADQSGITLIASNSNIFIERFIPSSNEDDQITTILKVGTIVVPAKYFIEIIKKMPS-NVTIKSKDEQIIAIQSEEITLNLNGLPTYEFPNVPLIDDHAKVQVETEQLIEVFKQTAFAVAKNESRPVLTGVHLELDYTKLICVATDSHRLAIRETKI---STDVKASCIVPSATISEMLKLMNSNSEFVYIYLSESHIIFTFGTTTLYSRLIEGKYPNISSLIPNEFQTVINVDRKRILQGVDRSNLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDTIQGEKLNISFDGRFMMDALKAIKEETVTLSFSGSMRPILIE................. 359
36 0.000e+00UniRef50_D0KVU1 Beta sliding clamp n=8 Tax=Halothiobacillus TaxID=109262 RepID=D0KVU1_HALNC  ali  23  1MQFAVDRDRFSSAINQVIGGVEKRQTMQILSNLLLEVADGRLTLVATDLEIQLRTSVDVQMQA--------PGATTVNARKLADIVKSASDAKIALTQTDG-WLEIDIGTGVFRLASIEAGSFPQMTDAATQSTVSITQKNLYALIDKTQFSMAQQDVRYFLNGLLLEVKPGQMTAVATDGHRLAYAHLS-DERLTENNRQVIVPRKMVSEMLKALDDSDDEVSLAFRDNQIELLIGENYLISKLIDGKYPDYSRVMPQSNSKILIVSKTELKQVLQRASILSNERFSGA--YFYLSPGRLMIESSNAEHESSKETMSV-GYDASDLKISFNISYLLNILAVIESEEVCMELEAPESSVLIKPPGDIDSKYVLMPMK.. 369
37 0.000e+00UniRef50_A0A0G1VWP6 Beta sliding clamp n=9 Tax=root TaxID=1 RepID=A0A0G1VWP6_9BACT  ali  25  1MNVSILQENLLKALSRTGRVVSPKAQLPIMQNVLLAAGESRLRIVATNLETTEVVSVGAK--------VEKDGGICVSSRLLTDLVISLPQETVHLTAKEG-ALHIRAAGVNATIPGVPASEFPPVSAADGKKGVSLEKATLLDALVGVLFAAATDEGRPILTGIKVAKKGGAVVFAATDGYRLSVKHLTLSLA---GDLDLVVPARALGEVFKVSQEEKGSVDMQTGEGQLIFTIGDTEIHTRAIAGEYPNFEKIIPATHTTRALVDKTSLLHAVKSAAVFARDSA-NILRFH-IENQLLVVSANTPQVGENHVEVEA-KVDGEGGDIAFNSRFLLEFLSGFTGDELLFEMTGSLNPGVFKPVKDDSYTHIIMPVR.. 365
38 0.000e+00UniRef50_A0A1G2ZFK8 Beta sliding clamp n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZFK8_9BACT  ali  27  1MKIRCNRQRLSEAFQLAQIVVPQKSTIPTLTNVKLTAKNSIVELTGTDLEVGLKYTISA-------VDVKDEGSIIVSANRLAGILRENIDDEITIESDGN-VANVVCSSSKYKVVCADPTDFPELPNFEKSKSISIATEDLGEMIKKTLFAVSTDLVRYALTGILFEIKGKEIRMVSSDGKRLALIKRKISGKAGDDDIKALIPPKTMTLLDRVLTEEDDMVGLNVEESQIKLKTKSAMIFSRLVEGAFPDYEAVIPTDRNKKVELNTTQLLTTIRRATIMTNE-KSRAVQLR-FNKDKLIVFTRTQDIGEANSDMQID-YKGEDLEIAFNPDYITDYLKVVSDEKIELHLKDKTTAGVFKA--GKDYTYVIMPL... 371
39 0.000e+00UniRef50_A0A2M9S426 Beta sliding clamp n=17 Tax=Proteobacteria TaxID=1224 RepID=A0A2M9S426_9RHIZ  ali  27  1MRVSIDRSQLAHALATVNRAIESRNSIPILANVLLAVEDGQLRLTGTDLDVEITTSLPVLDC--------QPGSVTVPGKMLADIAKR-ATGDITLELDGGGRLTVASGRSRYKLDVLPAEDFPSFSAGKFDTTLELD---LAALVAPCVHCISTEETRYYLNGVYLHVVDGRLVAVATDGHRL----MRNTGPEGTIEYGVILPRKLVGLLPK------GAVTVELSQNKVRVTSGSTVITSKLIDGTFPDYVRVIPSGNSNVLTVDRQALMKAVERVAAVA-DDKSRAVKFAV--GDVLRLILAD----KASDEVSIE-FEGEPLEIGFNARYVNDMLGALDEPNVRFALGDAGSPAVIKGEGE--WTAVLMPMRVY 350
40 0.000e+00UniRef50_A0A2N3G5J5 Beta sliding clamp n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G5J5_9ACTN  ali  28  12MIITCEKNKLNSAVQAALRGISGKVTMPILSGLLFTAENGRVAISSTDLEISVRAELDAE--------ISESGSTVVSGRLVGDILKNLPGGDAQIETDEKF-LTIKSSGGEYRIREMMPEDFPRIPKWEGESFLKAPGGEFMVAVQQASKASSSDEKRPVLTGMLVEKKTGELKLVATDSYRLASKEIDVVGSVSEWE-NCIVPVKTMNEVARLIGGIDAEIEIKMQEKQILFRLGELVVASRLIEGQFPNYSLLIPKGEKTRVTAPKEELAAALKRALIF-----GHKIRVGIYSD-HLRVMTETPDKGDSKEDVPVETI-GEEMEIGFNGAYLLEGIIGAESENVDIRFDDPQKPALVKTENSEKYNYVLMPVR.. 374
41 0.000e+00UniRef50_I0AFF9 Beta sliding clamp n=31 Tax=Bacteria TaxID=2 RepID=I0AFF9_IGNAJ  ali  28  1MEFKINSKSFDKILSKVIPAVPTRTPMAVLENFLFEIKDGLLTVQATDLEISLKSSQNVAADSNA--------KMVVQAKLLHDVVRSLPDIQLSISTDSNSRLKLKTDKGVYHISYFSPEDFPEIPVVARDKEIIIASDDLKRAFDKTSFAMSKEDMRPAMTGTLLEFAKDGLRFVATDGHRL--VKYVNKSILTDYTEQYIIPERAISVLSKLLSD--GDVKIYLSKTHASFITGDIEFITRLIGEKYPAYNSVIPLENENLLTVDRSELLSTVKRMLIFSS-GTSKQVKFS-ISADNLEISAENIDTGSAVENVQCE-YSGEAMDIGFNTAYMNDILSHLDSEKVIFKLHSPTKACIIEPSENEEVMMLLMPVR.. 366
42 0.000e+00UniRef50_A0A0T5ZYK0 Beta sliding clamp n=6 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0T5ZYK0_9BACT  ali  27  1MDVTVLQENLLPRLTAVARVASAKSALPILENVLLTAEKAVLHLAATDLETGIKTKVGAK--------VSTEGAITVPARLLVSLITNLPPGKVTLKAEKD-ILTISAESFSSKINGMPAAEFPNL-ASPGKALFKIPAKDFKEAVTQVSFAAAQDESRPILTGILLKLGGGTLVLAGVDGFRLGEKKISIAGEG----LTAVVPARSLGEVSRLV---EGEVEIGLEEGQLFFNAPDFLVLSQVLEGEFPEYEQIIPGNFETKISFSKEEMVKAVQLTSVFSDSGTTIIVFNFDPQKKILEVSSQEAQQGEARLEIPISG-EGKKGMIAFNSHYVSDALSALLDEDVTLAMNSSLDPVLLTSPKDKNYRHVIMPVR.. 360
43 0.000e+00UniRef50_A0A160IL55 Beta sliding clamp n=9 Tax=Bacillales TaxID=1385 RepID=A0A160IL55_9BACI  ali  38  1MKFTIDQKLFSKALSDVGRAVSQKSLVPILSGIKVIAEDEGITLIGTNSDIIIKRFTP-RDETSRNIRIDQTGSAVVSERYFTELIRKLPEE-VTIEVDDKQVVKVRSGDIFTHLNGFRADEYPQLPEINGTNSISMDAKELKEVIKQTVFATAKNETRPVLTGVHFRFSNNQLTAVATNSQRLASR---INDVYVKQETSFIVPSSSLNELVKQTIDYSGIVKIHSSDGYILFETDQVSLYSRLISGHYPNTSKLIPNEQNTMLSLNKERLEKGIERACLFAGEWKNNNITLS-IKDHKLCISSGSSEMGQIQELQEIMDLTGDDLKISIDGHFLKEALHTIMDEEINIKFNGSMRPIVIESTQKSSYLHLISPVRSF 375
44 0.000e+00UniRef50_A0A1N6F444 Beta sliding clamp n=11 Tax=Nitrosomonas TaxID=914 RepID=A0A1N6F444_9PROT  ali  26  4..IKTSRDTLLKPLQMVTGIVERRHTLPILSNVLIQQDNEKISFLATDLEVQIET------ATQNKITIEQTFSITVSAKKFQDILRALSSDEIILAIQEN-RLQVRSGKSSFNLQTLPGDGFPKIDETRPEAAITLQQKDLKNLLHHVSFAIAQQDIRYYLNGLLLLIENNDLKGVATDGHRLAYYIINLEESRTKKE--VILPRKAVLELGKQLNDNDEPVIIEIFQNKIRFSFSNITLISKVIDGKFPDYNRVIPTQNTKQFDLDRLIFLQALQRVSILSNNEKFRGMRL-IVSDSTLCIICKNNEQ-EEAREEIEIQYDNEMIDISFNITYLLDLLNNISAETIRCHFGDASSSVLITIPNNENFKYIVMPMR.. 370
45 0.000e+00UniRef50_A0A2E8NK79 Beta sliding clamp n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8NK79_9GAMM  ali  25  1MKIVVDRDLLIDSLQLISNVVERRQTLPVLSNMRLIVKDGQLEMVGTDLEIELQASLTVNA--------ESDGEITVPAKKISDIWRSLPSEPIVMEQVGD-RLKIKSGGSSYSLSTIAVSEFPESLGDIEGESIEINSEKFRRSVEEVAFAMAQQDVRYFLNGMLIEIGQGKIKLVATDGXRLALTEMDVSXXGGGVSQKAIIPRKGVLELLKIL-DGSEKFSLQISDKLITVRSGNYQXTSKLVEGQFPDYNKVVPQGGGTEXTIEXQSLREALQRASILSNE-KYRGIXL-LVDKGSLKIQANNPEQEEAEEVLEI-SYDGGXLEIGFNVSYILDVLGAISGSEAKLTLSDGNSSALIEGLDDSNSLYVVMPMR.. 367
46 0.000e+00UniRef50_A0A2H0T6U6 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium CG10_big_fil_rev_8_21_14_0_10_36_14 TaxID=2014326 RepID=A0A2H0T6U6_9BACT  ali  28  1MKFVCTQENLQQGLLVASHINTKNINLPILNNVLLRVSNNTLKLISTNLEIAVTTKIRGKS--------EADGEYTVPAKLLADYVSLLPKENATLSLEDGF-LRVSCGNKTTKIKGIDSTDFPVIPQIEKKTVFYIDGQKLRRALSQVSFAVLPTETRPEISGVFFNSQPGIATLVATDSFRLAEKKITLSEKSSKDNIQIIIPLKTTWELSNILSGDNDLLEVCVDDGQVFFGYNGTELTSRLIEGAFPDYQQIIPKEFNTIAKLSVPDLLSGAKSASLFSRSG-LNDIKLNILTKKSVEVYSTDNQTGEQKTIVSGV-VNGKENKIVLNHRYLVDGLSNLGSLEATLETIDENSPCLIRPNGDNNYIYVVMPIK.. 372
47 0.000e+00UniRef50_A0A1G9Q6B8 Beta sliding clamp n=2 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A0A1G9Q6B8_9FIRM  ali  29  1MKFKIQQKVFHNALIKSKRAISTSNTMPILSGVLLEAEEGNLVLTATDLEIGIVLKLGAD--------VEKMGKIVIPGDELSSIIRELPEGTLEFSVDSEYSAEIITESSEFMLRGFKPEEFPELPEVDITTSFSLEADKFKDMVDKVKFSCSKKASQPGLTGALLTVDTDSITMVATNTFRMAYYKREMELPDVEEKSRAIIPQNTLSEASRLIDDEDDEIYVEMGSNHCRFTCGDVIITSRLIEGKFPNYKQVMPDDYSAEVNVSKRGLRQAVKRVSTIARLD-SNVIELD-FDEDLLTIESSASEKGHGKEEVRI-NLTGQPQSIKIDASYMLDGLKVLDEESVRLELIGKINPITMKNPGSDEYIYLIMPIR.. 369
48 0.000e+00UniRef50_A0A2H0TIN5 Beta sliding clamp n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0TIN5_9BACT  ali  25  1MKITILKEKLKEGINIVERIAQKSLTLPILNNVLLKGEKTFISLITTNLEIGLQWW--------SLAKIEKEGEIIIPARLFSSFINFLPEGPLEIETDGSF-LNIKSGEYRSRIKGFSPEEFPLLPQVGQEEKVELDSQVFCQALSQVFDIASPSLARPEISGIFFHFQKEQIKIVATDSFRLGEKKI-FSQLPLTKEYSFILPQLTAREIVNVFSEKEGDLRIYFSPNQVLFESPQIHLISRLIEGDFPDYQAIVPKKYETQIVLSKNEFLNQIKSASLFS--GKISEVKLNISSKGKVEIFSQNPDLGEYQSALSG-KIKGKALSVSFNHRFLIDGLLKIKSPEVIFELTSEEEPAVLKPVGDEGYLYVVMPIKT. 373
49 0.000e+00UniRef50_A0A2M7GV19 Beta sliding clamp n=5 Tax=Bacteria TaxID=2 RepID=A0A2M7GV19_9BACT  ali  30  1MEISVEKKDLANGLQKMVGAINLKPSLPALSFILLEAEGEKLFLTATDLELTIKTIIPC--------RVKGKGKLLVPGRRFTNIIKELPEAEIEITEDKTKKTCIAVNNIFFTLPGLKTEEFPTLPKIGKGTSLKMKEGALKIMLKRTRFSIAYDETKAFLRGLLFSFKKDSLILVGTDTRRLAYIRKSFPSPV---ERDLILPIKLIDELEQCLG-QEEEVEVAINPNQITFKTGDTLIISQIIEGQFPSYETVFPEEGLKKIKVKRLGLIDAVRRVSLLASE-RYNSLRFD-FAPKKMTVSINSPEVGEAREQIPAE-YSGETTAISFNPVYVLDVLKNLETENIIIGITDPLKPALIQPDSQEEYKYVLMPVK.. 363
50 0.000e+00UniRef50_A0A0G0XWS2 Beta sliding clamp n=17 Tax=root TaxID=1 RepID=A0A0G0XWS2_9BACT  ali  22  1MKFKIPQADFSKALSIASRSILLKANLPILSNLLISVTKKEMTILSTNLETATKATTPCKT--------EVEGKITLPGKTLSEFITQLPEGEILFEKLGEEAV-VSTKGFKARIPTIAPEEFPAIPRIDKGVEIKLKVKVFAKCVSRVAFGAAQDEGRPILTGVLCEFGKDRLSMVATDGYRLSYQEIPVSEAPKGVDIKVVVPARAISEVAKILEDENENLSIVISDNQVNFKVGNIEFTSRLIEGEFPNWQKIIPTSFTTKVKLSKVELAKLVKVASIFARDSGSIILKLENVSGGQLAVFANAAQVGSSDAQIE-TQMAGKGGEIAFNFRYLLEVLSVMDDEVVNFEMIESLNPGRITGEDEDSFFHIIMPVR.. 378
51 0.000e+00UniRef50_A0A1U7M635 Beta sliding clamp n=24 Tax=Firmicutes TaxID=1239 RepID=A0A1U7M635_TISCR  ali  38  1MKIKIKQRELSKHINIVQKSISSRTTMQILDGILLEAKKDKLKLTGTDLELSIESFVDCE--------IIEEGSIVVNSRIFGDIIKKLENDLVTITVDKTN-INIKCENSEFNISGNSGEDYPDLPLVVERDSFNIPMDIFKTVIKKTVFATTADETRPTLTGVLVEIENRFISFIALDGYRLAFKRLPIN---TDANTKMIIPGRSLNEINKILEEKEEDLNISVSPSHIIVNLGSTTIYSRLLEGPFFNYKDIIRKEHKTIVKVKXXXXXXXXXXXXXXXXXXXXXLVKLSLI-DNTLNIKS-NTEVGNVFESIDAQA-DGEDVNIAFNSRYIIEGIKAIDDEEIKLNFMGSLNPCIINGLEDEDYTYLVLPVR.. 362
52 0.000e+00UniRef50_A0A150KMQ6 Beta sliding clamp n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A150KMQ6_9BACI  ali  41  1MEFIINNDCFNKAISEVRKGISSKTPLPILTGIKIVVNKESVILIGSNSGIIIEKRIPLMIDGVKVLEIVQPGSIVIPANYLSEIVKKLPSD-VHMKANEKQLITIQSDEIITHISGLNADDYPRLPDIQQNFCIKIGSNELIELFKQTMFAASSNEMKPVLTGVHMNFLDDKLVVVATNSHRLSRRELSIESDVN---ASIIVPRSSLLEFTKLFIDS-GELKLFITNNYIVFQSKDMTLYSRLIDGVYPNTAGLIPKESKTRNRLTTNQFLKGIDRACLFASEWRNNNVNLSIVEGDKIKISSLASEIGKIEETQTIQMVEGKELSISLDGSFLKDALKVIQEEEIMIQFGGSMSPIFIQPVGNPSFLQLISPVRTY 375
53 0.000e+00UniRef50_A0A2G6C462 Beta sliding clamp n=4 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A2G6C462_9BACT  ali  25  1MKLQVTQENLHKALTNVSRVASTRGTLPILSNVLLKTVDGRLSIAATNLDIAITQFIGAK--------VSEDGLITVPARLMQDFISSLPSGVIDMRLDE-SKLHIETEQYQSVINGISAEDYPVMPDIDNGQTWSVSATALKTALQQVVLAASGDEARPVLTGVYMHVFEGSLYVVATDSYRLAEKKIT----SLKSTVSLLIPAAALQELMRVVGDSDDDVTVTHDDQQVLFRVGDVELVTRLIEGTYPDYRKLIPEKYSSLAEIKKSELQNITKVSSLFARENAGSVTINLDESAQAVSIRSVASQVGENIASAPA-KVTGDG-TITLNSRYILDALHVIGDDTVRFGFNGKLEPSVIKGAKTDDYNHIVMPLKS. 363
54 0.000e+00UniRef50_A0A2A5FIK5 Beta sliding clamp n=2 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2A5FIK5_9PROT  ali  27  1MKLIISQSLLLKQVQRCQSIVEKKNTKPILCNICFKALPNQLEVIGTDLQMAISAIQEAE--------VLEEGAITVSAQKAFEIIKELSDKPVELHLQDDFLM-IKSGRSRFRLVTMPCTDFPGMPHNETDMRFEIEQKVLSKMIQSTAFAMSHDETRKYLTGGLFETQANGFRMISTDTHRLNLIQIVMEHLSQDIHT--IVPSKTVIEMKKIAEEQGGLIEIGLSKRQVRLQCGGYTLISKVIDGTFPPYQDVIPTGHPYEVNVNCKNLDKALRRCMIVANEITHDL--CIQFTQEGLHISAHNNEQEQSEEFVEAKGSEVE-MSIGFNGRYLRDVLNVLGSEEISINYRDELSSILLSPVGQDGEKYIVMPMR.. 365
55 0.000e+00UniRef50_A0A2E3RR02 Beta sliding clamp n=4 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RR02_9BACT  ali  25  1MKVVCDRAALNEALSISSSVIASRSPTPVLLCLKLVAHDGLLSIMSTDAEVGLSVNV-------AQVEVNQPGEALVPADKLSQIVKSSEDDTIHLEVKD-HVTTVKGTDSCFKIFGYDPKEFPGIREFEDQFDFQIDSRTLKRVISLTIFATAVENNRFAINGVLVDRNSKQLRLVATDGRRLAMXKGGCD-PNSDSDTSCIIPTKALNILNKLMSDPDAMVRVSIDDHHAVFQVGEATLSSNLVEGAFPPFEDVIPKDQDKRVTFDAAELTSAVRRAALLTTQD-SKGVRLS-FGNDRLTLSSRAPELGEAEIHVDMDSYQGDPIEIGFNPNYITDALRVIDDPQIMVEMKAPNKPGVLKV--GNDFTYVVMPV... 368
56 0.000e+00UniRef50_A0A2E3WAF4 Beta sliding clamp n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E3WAF4_9GAMM  ali  24  1MKLSISREALLDPLQLVTGVIERRQTLPILSNLLLVADQDVLTITGTDQEVELTAT-------ASDVQIGEPGELTVPARKLMDICKSLTGGA-TLKLDEENRLSLVSGEFRSHLATLPVVXFPNVEAETGAAKIKVAATVLSSLLDKTSFAMAQQDVRLFFNGVLVEQDENLIRVVATNGQRLATSFAEIEDQ--GENGRFILPRKGVHELMRLVNEGDEEVMLQFSDNHLRAEVANAVLITKLIEGSYPDYTRAIPSGGDKILVGSRSDIREALNRTSILSNE-MYRNVRLQM-NAGKLDIHAXNPLQEEADETVSVE-YDGEPLEIGFNVGYLLDVLSTMQGEELKIAXIXDSSACLLTDPGDSKTLYVVSPM... 365
57 0.000e+00UniRef50_A0A1V5GI90 Beta sliding clamp n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5GI90_9BACT  ali  22  1MKFIASSSSLLKQLQHISGVINTNTVLPILEDFLFEIEKNKLTVVATDLETVMRIQLDIEAKDS--------GRVCIPAKILLDSLKNIPEQPLTFNIDKNFGIEITSDNGKYKVMGENPDNFPKEPSADDTTSFTMTASALVKAINETIFATSNDDLRPAMTGVFFELDKKYLQCVATDAHRLVRYKRT--DVKCPKSDTFIVPRKPLNLVKSAIPSNEDEVTLSYNDNHLFIKHGSTQMSCRLIDARFPDYKVVIPTDNPYRLTLNRADFQSALRRVSIFSN-KSTNQVALS-ITGSELQLAAQDVDFSEGNERMNCQ-YNGEDLVIAFNARFLIEMLGATESNEVNVELSTPTKAGLIKPVDQED........... 356
58 0.000e+00UniRef50_A9B4J2 Beta sliding clamp n=3 Tax=Herpetosiphon TaxID=64 RepID=A9B4J2_HERA2  ali  27  1MRLACLQENLKRGLALAGHAVAGRSSLPVLANILLATESGRLKLAGNNLEIGITALVGAK--------VDEDGAITIPAKLLSDLVGNLPNDTVELEVDPRTQLTVTCRGTKANIKGIDADEFPAMAVPGNEPVLALPPELLRKVVSQVEVAAAAENTNPILQGVLIRLSGTQATFAAIDGYRLAVRTIELPEPAA-YDTELVIPSRAMAELGRTLGDSETPIAMSITSNQVIFHSDTVDFVSRVIDGKFPDYERFVPSNTSTRSVISTAEFSRAVKRIALFS-QAAGNIVTLTMSEPGRLLLNANAAEIGESVEAISA-LIDGDDGKLALNVRYLQEALGAIDTDQVALETQTPNSPGVFRPIGGDEYLHLVMPMR.. 379
59 0.000e+00UniRef50_A0A0G0E1G3 Beta sliding clamp n=7 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A0G0E1G3_9BACT  ali  27  1MKATVLSDSLKQRLPTVFHAISGRSQLPVLLNFLIEAKSGFLTISATDLEIGIVTKIGAK--------IEKEGKITVPAKTFFDLISNISEEKLTLEARE-TTLELKGEHLKATFPTMPAGEFPEIVSDKGKKLASLNKNALFESIAKVSFAASVDSGRPALSGVLLKKEAGGITLVATDGYRLSLKK-KITLTNESLSENLLVPSRILKELL-FLRESGEDFDLYVSENQIILETKSTILTARLIEAEYPDYQKIIPEDYETKAIFNKEEAQNAVKACSVFAREAA-NIIKVS-LKKGKIVFSSSASSVGENEIEIE-SKVEGEENEIAFNSRYLLDFLNAVTEEIIELQMTGPLNPGVFKTEKDKDYLHIIMPIR.. 365
60 0.000e+00UniRef50_D6Z5P2 Beta sliding clamp n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=D6Z5P2_DESAT  ali  24  5..FNVSRLDFLTALAALQNITGKKGTLAVLANILLESDQEGLVMTATDLEVGIRCRIPAE--------ILSPGSVTLPARKLFELVKESEEKHLHLEEQENSWVKISAESSDCRLSGISADEFPSFPPYREDNLVAIPTALMTDLIDKTIYSVAHEENNFNLAGILLEKEGHFLRMVSSDGHRLSMMEGKVETDLSSLEMDILIPKKGIQEIRKLC-DEEETVLLGLEEKQAVLKAGGYTLVVRLMSGDFPDYKGIIQVINKKHIGIDRRKMMHSLKRVNIFT-EDRYNAVNF-IIENDKITLSSQNMDYGSAREEVPA-GYQGESMEIGFNGKYFYEALQVMDSEKVKAYINSEESPCLLQGDKDPGYLSVIMPMK.. 375
61 0.000e+00UniRef50_A0A1C5KUB2 Beta sliding clamp n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1C5KUB2_9CLOT  ali  30  1MKFVCKKSDLLKGVNIVLKAVPSKTTMSILECILIDASAGQIKMTANDMELGIETVIE--------GDIQEKGIIAIDAKIFSEIVRKLPDNDVTIETDANFQMLISCEKARFHIAGKSGDDFSYLPYIEKAEPVVVSQFSLREVIKQTIFSISDNESNKMMTGELFEINGNHLKVVSLDGHRVSIRNLELKEEYE--PRKVIVPGKTLIEVSKILSGEDALVNLFFTKNHIVFEFDETTVVSRLIEGEYFRIEQMLSSDYETKVKVNKKELLNCIDRATLLIRESDKKPI-IVQISDGEMRLK-LTSGVGSMNEEIVIEK-EGKDILIGFNPKFLIDALRVIDDEMVTLYLVNPKAPCFIRDEKG-TYIYLILPV... 363
62 0.000e+00UniRef50_A0A1C6A700 Beta sliding clamp n=40 Tax=Firmicutes TaxID=1239 RepID=A0A1C6A700_9FIRM  ali  32  1MKFSCEKALLSSAVTVASRAVAAKSSIPAMEGILIEA-GAQLKLTGYNLETGIQATVPAE--------IKEGGSLVLSARLLGEACRKMPDDVVVFSSQG-YSVNIKCGMYEINILGTDAEEFPELPSVDQQNSLVLSQPVLRSMIAQTLFAVSDNESRPIHTGSLFDVEGSRLTVVSVDGYRLALRREDVEEKTGAEAFSFVVPGSALNEVEKICS-GEEKVTIIQGARHILFQTGDILLVCRRLEGEFLPYKNAIPRNNTIQVEVEAKALLSSIDRVSLIISEKLKSPLR-CLFGDGVVDITTKTA-LGDTADRCPISG-NGGGLEIGFNNKYLMDALKAAPADKLRMEFTSGVAPCVILPAEGEEFIYMVLPVR.. 364
63 0.000e+00UniRef50_B5YFF3 Beta sliding clamp n=3 Tax=Dictyoglomus TaxID=13 RepID=B5YFF3_DICT6  ali  32  1MKFITQQEDLYKSLQFVKSAVATKTTIPILTYVYMKAENDTLYLQGNNLEVGLALSMPV--------IVEEPGEVCLPASLFIDVIGKLPEVTLEVYVNERNRAIIHAGYSDIEIQGESPEEFPKVEVGNTEYHASLDRILFAKAIKQTIFAAAEDEIKQVLTGVLFEGKDGKLNMVAVDGHRLALKTLEIDKDFP----SIIVPAKSLKEWQKIITKAEDRVNIAALDNQVVFNCGEIYFISRLLQGQFPAYDKIIPTEFTASFKANRKDFLDILERMEVFAEIDQTNTVKIS-LSSEEVVISTLPSERGFAKEVLPAENIDG-NLEIGFNVEYLMDPLDNADWDEIVMKFTSDLGPALITSPEDENYTYILMPVR.. 366
64 0.000e+00UniRef50_A0A2D7XBV1 Beta sliding clamp n=1 Tax=Pusillimonas sp. TaxID=1979962 RepID=A0A2D7XBV1_9BURK  ali  30  1MKFTVSRSALNRAIKNIAGVVEKKNTMPILAHAKLEV-GDKLKITGSSMDIEATATVECE--------VAQAGEITVPVYTLADIVNKLPNGDVKVSL-EDSKLKVSSGRSRFTLPTLPVGDFPSM-NMESDVYFDIPAATFGYMLQKSEFCASDDETRYYLNGVCLDFKDDATYSVATDGHKMA----KIAGVKTVDHAQIIIPSKTVMQVLKLLDGC-EIVTVSLSDNLIGFNFGDAAVLSRLIDGKFPDYGRVIPEGNDKKMSVNVADMLGAIERVGSIA-DSKTRAVK-CTIADGTMTIEAKSSEFGEASEVIDVDA--DFDLIIGFNGRYMSDILKSLECEAVDMSFSTESGPIRI---EDEDQLYIVMPLR.. 354
65 0.000e+00UniRef50_A0A212L823 Beta sliding clamp n=1 Tax=uncultured Pleomorphomonas sp. TaxID=442121 RepID=A0A212L823_9RHIZ  ali  25  8.RISLSRDAMVSALGLLTRTIERRNTLAILANVLVDVKGGLCRLTASDLDIWATTSIALSDALAPDA------ATTLPAQMLSDIVRKLPSGEMDLSW-GDKEAQIASGRARYRLNTLPPTDYPSLSEPDWLATFSVGAKALRTLFEKVSFAMSNEEVRYYLNGAFLHTGDPHLVAVATDGHRLSKVTMPAPDGSGKMP-GVIVPRKAVGEIVRLLDGRDGDIEVSVSDAKLSVTAGPTRLLTKLIEGSFPDYARVIPQGGSRAAVIDADALSAAADRVSTVSGE-RGKAVRLS-FAGTSLKLEVKNPDAGDAEEEVQAE-FEGEPLEIGFNARYLAEALRAVAADTIRIQLGDPGSPAVMTSAASADHLVVVMPMR.. 378
66 0.000e+00UniRef50_A0A2H6HFF8 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6HFF8_9BACT  ali  27  1MRIRAERDDLADVLARAARAVGNRSPLPILQGLLCEVSGDELRVTGTDTEITIRTTLKVE--------VLEEGKTVIPAKLAADAVKRLPSGAVAITAAD-SEVEITGNGPRFRLREMNVEDFPTLPVGEGGEGFSIDSKVFIKALSQVGVAASTDEARPTLTGVLFEKTDDGLRLVATDSYRLAVCDLP----GVDGPATALVPYRALRELGRSI--ADDIMQVVITDRDATFTSERGSLTVRIIEATFPNYRQLLPDSYPSRLVVDRVSLVDAVSRASLVAEDHI--PIRFHLRSGGA-ELSVTRQEVGEETEQIAGD-YSGEEMTIAFNTRYLTDGVQAITTDKVVLDTSDPLKPGLMHGEGEENFRYLLMPVR.. 358
67 0.000e+00UniRef50_A0A0S8IZM2 Beta sliding clamp n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A0S8IZM2_9BACT  ali  26  1MKLKCGRATLYEAVQFAGALASTKMAKPILQNVKMVGEKKQLDVLATDLEVGIRFRLE-------NVEIARPGALAVSANRLLGILRESPDEQMDIEVQE-HKCTLRGADSTFEMLGDDPADFPEVPEMMESAQMEVERSDFIEMVDKTVFAAASESTRYALNGVCFIFAANHVEMVATDGRRLAYIRRKAKGVSAD-TGSIIVPPKTLQHVRRILTEEDKSVGMKVDENRVLFQTSRALVSSVLVEGHFPPYKEVIPKDSDKKATVKREAFLGAIRRAALLTTEEA-RSVRMD-FTKDLVVLTSEAPEAGKAEVKLGLD-YEGEKISIAFNPTFLTDVLRVISSDEVVLEMKDASRPAVVH--DGADYTYVVMPI... 362
68 0.000e+00UniRef50_A0A088T2C0 Beta sliding clamp n=5 Tax=Tenericutes TaxID=544448 RepID=A0A088T2C0_9BACT  ali  44  1MNFQINKDTLLNNLIVAQKALSNKTPNPALQGIKLDVLEDHLIITTSNSDIAIKLTV-----KDPSLSIQSTGSVLIPGKYFIEIIRKLDGLKVSLSMAADNMLRIEADRSDITLNMMDLEDYPELQFSEKVKSIKINVRVLKTIIRQTAFATSSIENRPILTGVNFKIEGKKLRAIATDSYRLSQKEIELEESYE--PLNIIIPGKSLEELIKVLENNNDTVELHFDHSKILFKYNNLLFQSRLLEGNYPETSKLIPTEFPTVIRFNKENLSTAIERASLLSRDGNNAIVKLALRRDNIIEITSNSPEIGKVLEEVPVDEIVGQPFKIAFSSKYILDALKIFNSSEVAINFTGEIRPFIIKGEYDENMLQLILPVRT. 373
69 0.000e+00UniRef50_R7G4R9 Beta sliding clamp n=2 Tax=Bacteria TaxID=2 RepID=R7G4R9_9PROT  ali  35  1MKMIVNGNDLSNAVMKVSKAISVKTTNPILEGIKLSVRGDNLTLTATDMEIGIEKTIPCETFM--------EGDIVVPGKMFAELVKKLENEEVEFFLEEANRIKIVYGDSVVYLSSLSADEYPSLKKNLREKWINLSKKCYKDAVNKTVFACSTDESRPILKGCLFEVKGGDLKCVALDGFRMAVAKVPL--ISASGDFKMIIPSRALGEISRMLEEEEGEITIVSEDNSLMVEENNTVFVSRLLEGEFINYSQIIPTEFITEVTVNRNALISGLERATVVAKDSR-NLIKLE-IREKFVNIKANS-EKGNVNENVQIKCV-GKDLDINFNSKYIVDALKASPDEYVNFKFVGEIAPAIITPFAGDDYVFLVLPIR.. 364
70 0.000e+00UniRef50_A0A1Z9LE85 Chromosomal replication initiator protein DnaA n=1 Tax=Gammaproteobacteria bacterium TMED186 TaxID=1986743 RepID=A0A1Z9LE85_9GAMM  ali  28  450MDFYIQKQDIVKALSLTLGVVEKRQTLPILSNVLIEVDESSMQLTATDLESQISTS-------SNIANYTSGGKTTAPAKKLSELCRLLPDDEIHISLDGD-KLIVEAGTGKYNLKTLPSDGFPVFEDESDGQAIKIDSQKLKNLINKTSFAMGNQDWRHYLNGLFITIEESDILAVASDAHRLAIASSDLDAKADNNTSG-IIPRKSINEIAKLVGEVEGIVEINLSNNSIKTSTPTASFVSKLIEGKFPDYEQVIPSGDSSVLKVSTKQFSETLSRVSVLSSD-KYRGIRMVTSDKGVM-ISANNPDQEEGEEFFN-TAYEGENLDIAFNVNYFQEILSTIDDDECEIHFFGADKSCLITTPKNQQLKYVVMPL... 814
71 0.000e+00UniRef50_A0A1S9CNE4 Beta sliding clamp n=4 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A1S9CNE4_9FIRM  ali  31  1MHFYCKQELLINSINIVLKACSTKTSFQILECIYLKTNNSTLTLVGNNLELGIESTLNA--------NILKEGSVAIESKIFSEIIKKMPNNEIEIYSDENNIVTIRCENSEFIIKGKLGKEFPDLPQLTTSTGYNLLQSNLKEMIKQTIFSISQEESKITFNGELIELKEGIFRIIATDGFRMAYREMPLEITTTNI-QSAIVPGKTLTEISRILSNDDNLVTIYFEKNYIMFDIGNSKIISRLLDGEFVKYEQIFLNNYNTRIKIDKRKILLSLERAELISRDGKNNPVKFEITND--LIIISSDAELGSVREEVKI-NLEGDKFIIAFNPKYLIEVLKVIDDQIITIDFVSPLHPCIIHSEEKK-YKYLILPVR.. 364
72 0.000e+00UniRef50_UPI000984C4D1 DNA polymerase III subunit beta n=2 Tax=Marinicella TaxID=863253 RepID=UPI000984C4D1  ali  26  1MLFNIQRETLLAPLTQICGVVEKKGTLPVLSNVLLKLDDDQLLLTTSDLDVEMRSECVVDA--------QSPGEVTVPAQKFLDICKALPDGSILTFAYDSGQCLITSGDSRFSLSTLSAQEFPLIDDMESYQPVTMGAVDLQRMLKQTVFCMAVQDVRYFLNGLLFEVLNNKLRCVSADGHRLALSECDYVNEI-GLNKQVLIPRKGVLELQKMIRDLDQEITINIGRNHVKIDIDNLTMTSKLIDGKFPDYESVIPLDMENNFIADREELRQALQRVAILSNEQ-YKGVKFK-ITANKLEIIGHNPDQEQAEDIINVRT-DIENIETAFNVNYILDATQAINEKDIQFSFKEALSSCLIKHPDRADCRLVVMPLR.. 365
73 0.000e+00UniRef50_A0A136NVK1 Beta sliding clamp n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A136NVK1_9CHLR  ali  27  1MRLSVLQSNLARGLSIVSRAVESRPSMPVLSNVLLKTEESRLKLAAVNMSLGITVWIGA--------NVEVDGSVTLPAKVFVDLVNNLSNDRVDLSLDTTTQVHLRCGGNKGNIKGIDAHEFPPLNEGSGSD-LTVEGGLFKNMINQVGFSAAADDHRPALTGIFMQLNGSTITMAAADGYRLAVHTGELEQKFDKA-LNLLIPARSLQEVAKVITEDDEPVYINLERDIIVFTVGQVEISAQLLDAKFPPFESVIPKDYSTSTVMYRTDLLAACQRAEIFARDSAFSG-RLYVKDPGEVTIVGKSQERGDNEGLLDA-TVEGEPVDISFNIKYLIDVLRVLPDEEVVLQSKGAANPGVIRPVGRDNYLYVIMPM... 375
74 0.000e+00UniRef50_A0A2T2R5E4 Beta sliding clamp n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2T2R5E4_9ACTN  ali  24  1MKFRAERSEFTDAASWSLRTVGARATLPALSGVRMEISGDELILESTDLEISSRLVLPVQS--------EREGVALVPGRLLGDVVRNLPHAAVEAEMSDD-RLHLECGRAKFDLRLMPAEDFPTMAAPSSDVTATMKAEDFSRSISQVARAASTDDHRPVLTGILLESTEAHLTLVATDSYRLAVRTLPWELHTA---VHALVPRRALDEARRVADHLGSDVQLALENAQATMTFPDRRLTTRLIEGKFIDYRQLLPESWERRLRVNRRELLQVVKRVAVVANSSAT-PVTLH-ITADAVQATAGNGELGEAEETLPGE-LEGEPLEISFNPRYLTDGLEAIMDEEVMLDFRDPLKPAVIRPTDGDSFLYLLMPVR.. 368
75 0.000e+00UniRef50_K2CXM6 DNA polymerase III, beta subunit n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2CXM6_9ZZZZ  ali  25  1MKFSCTQENLKHGLLIVSRVASKNANLPILQNILLKASDGVVTLAATNLEIGVQVRV--------RGKIDEPGVFTLPAQLFTNYVSLLSTERIDCVLTG-KEVHISANGQTTVVKGEEATDFPILPDIEQTNSYRIAKGDFELALQQTSIAAAVDESRPEIAGVCLKTKGGTMTLAATDSYRLAERTTTL--LNGDGEQTVIIPQRSAQELLRLLQSTAEEVTFYVNDNQFACRFADVEFVSRLVEGKFPDYEQIIPRSGQTTAHLSKEEFMKAVKGAALFSKTGVNDINLTFSDTSQTVQIQAANVQLGQNTTTQPA-KVEGGEVTITFNYRYVLDGVQNMAGAEVKCLLNSTMSPALFQSASDDQFAYVIMPIK.. 366
76 0.000e+00UniRef50_A0A162V5V8 Beta sliding clamp n=8 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A162V5V8_9GAMM  ali  24  1MELIVQREQLLQPLQALIGVTEKGQTLPVLANVKLQVKEEEIILTTTNLEIELSCALPYHSTAT--------GGTTIPAKKLLDILKALPHGDIHM-ILEPTKVEIKAGRSKFSLACLPLEEFPVLDHIDFNNTLTLPKDRFRSLLQNVAYAMATADVRYFLNGMLLDVQDSLITAVATDGHRLACSRYPFED-ATHLTNQFIVPRKAVEELLKLIENEAAPLHLQLSDNHLRVELGSMMFTTKLIEGKFPDYKRVIPPIGEKIIMADRSEMIDSLMRTSILSQD-KFRGIRMN-ISHCLIKLVAHNPEQ-EVAEEEVEVNYQGADFMIAFNAAYITDIFKNIEGDMVQMSFTENNSSCLIKNPEDDNVDHVVMPMR.. 365
77 0.000e+00UniRef50_A0A2E5WM45 Beta sliding clamp n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5WM45_9BACT  ali  26  1MKVICKQVELAEALNVVSRAIGSNSTLPILNNILLEAKGNALWLSATNLEVAIKTKI--------ICNVEFEGSITVPAKLFFSYVNLLSKEDLVLEELDDLSLSVSGSNSETKIKGLKAEDYPTMPEVSNEVSFDVNSKVFSSALKKVVFSCSNKADRPFLAGVYMFTEGNKFYLVATDSYRLSECSIDLDKNVDG--ISCIVPSKTMGELEKIMENPKQNVEVILGQSQIAFRCGETLVLSRLIDGQFPDYKKIIPAEHKTSVSLGLSDLQQALKRVSLFAKEVE-DAVSLEFDSENKVFISTQETLIGTDKNEISIA-ISGESTKISVNSQYLMDVLNVIGDSVVSLQVTDRILPIKVLDKKEPNFQYIIMPLK.. 367
78 0.000e+00UniRef50_A0A0G0C615 Beta sliding clamp n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A0G0C615_9BACT  ali  29  1MKFKCQQKIFFASLQNVNRAIQLNNTLPILNNVMIKAENGKVTLSGTNLEIAIQSSFEAK--------IENEGGFTVPVKILSSYIGLLKDADLSVQLEASGVLVLSQGISETKIKGIAVDEFPIIPKIEKDTEVDIKANDLKLLISQIVFAASNNQARPILTGVLFEKEGDEIKLAATDSYRLSERKLKLKNSDKENIKSVI-PAKTLLELSKIIS-GEEKAKIYFAKNQVVFEWENVKLISKLIEGAFPDYSPIIPKGFNVKVDIDKADLLIALRKLSIFAVE-KNGSINMSTTNDNTLHLFTEKTLSGESKEDLPA-NIDGQNTKVFINANYLIDVLNNIETAKVQIEMGEKLTPVAIKPLNKEGYINIIMPLR.. 365
79 0.000e+00UniRef50_A0A1I2DIX7 Beta sliding clamp n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1I2DIX7_9BACI  ali  40  1MEFTINKEYLSQAVSDVSKAVSARTTLPILSGIKMAADYNRLTLTGSNAEIVIERVLHSDVQGESMMAVHKTGSIVVSAKYLNDLIKKLP-GDLLVKVGENHSVSIQSEDIVVSLKGFHAGEFPRLTMSQPEASHQLPGTVLADMIKRTMFAVSKNGARPVLTGVHFVFDQNFFCSTATDSLRLATYKRNI---GANLTGSFIVPQPALHEFLKLMGSYTGEVTLKLTESYIEFSTDVFSFYSRLIAGKYPNTASLIPNEFKTVITLQASDFLKGIDRAALFAGEWKNNNVNLTLLEGKKLGISSRSMESGTIHEIQNINSLEGEELSISLDGKFLTEALRGIKDEEIKISFSGSMKPVLIESVFDSPYQHLISPVRAY 376
80 0.000e+00UniRef50_R5D8Q9 Beta sliding clamp n=4 Tax=root TaxID=1 RepID=R5D8Q9_9FIRM  ali  35  1MKLTCEKYLLQSAVAVSTRAAASKSPIPTLEGILLEAGED-LRVTGYDLKKGIYTNIEAE--------VSEPGSVVLDAKLFGEMVRKMPDGIVSIVTDSQNMTTVKCGKSEFSFMGMDSGEYPELPSVDGLKTYTINQGVLKSMINQSIFAVSDNDARPVYTGSMFEVENGILTLVSVDGYRLALRREAIEGPAEHNE--FIVPGAALSDLERIAPDSEETVRISVGGNHVSFTVGKTVIVSRRLEGDFLNYKKALPEVFKLQIKVNRSEILRATDRVVLIVDEKTKNPVRM-TFNEGFIDFRCTTP-IGKAEDVCFCEG-NGEGMEIGFNGKYLMDALKAAPADELIVCLNTSSSPCVILPADGSDFKFMILPIR.. 365
81 0.000e+00UniRef50_M1L832 Beta sliding clamp n=6 Tax=Betaproteobacteria TaxID=28216 RepID=M1L832_9PROT  ali  23  1MRFYVVRESLLKTLSNIVGIVERRNTMPILSNIMIRKKGNKVAFVTTDIEVQMTTYADCGSGDSEV-------STTVSARKFLDILKALPDSSINVELHDN-KLYIESSKSRFNLQTISSEEFPMMSCPDNDISINLPQRDTKNLFGMVYFSMAQQDIRYYLNGMFLVFKDNCIVAVSTDGHRLSYNSTTANEF--EGCKEVIVPRKTILELQRLLQDSDDIIRIDVSSSQIKFCFRDIEFISKLVEGKFPDFRKVIPNNYPISFSIKREYFQGSLQRVAILTND-KFKGVRFH-FEDDNLKISSSNTDHEEAQEELEII-YRGDAFDVGFNVNYLLDVISNLKSENLIWSITDSNASVLITVPDTPNFKYVVMPMR.. 369
82 0.000e+00UniRef50_A0A0G1KJ71 Beta sliding clamp n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1KJ71_9BACT  ali  30  1MKFTCTQENLHKGLAAVQGISGNTTALPILKNILIEAKDGAINLKATDLEVGITSIV--------RGKVDKEGSITVEAKLLSSFVSLLPRDKVEVQSDGKN-VTVLGGAHKTKINGLSSDDFPVIPGIQKDKECVISLPIFKKALSQILPAVSFDDTRPELHGVYVSINDKTITLVGTDSYRLAEKKAPLVDPAL-FTAQFILPLKTAKEFLRSLEATEEKVILYHSENQALIVYGSNEIVSRLVDGNYPNYQQIIPTSHTIKCIINREEFINAVRISGLFASVGSNN-VTLTIVSGKGMKIASRTI-IGEEQTEL-YPHIEGEELTIAFDYRYLLDGLTAIDAPEIALLASSPSAPVLLKPLEGEEFIYIVMPIR.. 368
83 0.000e+00UniRef50_A2BNC7 Beta sliding clamp n=17 Tax=Bacteria TaxID=2 RepID=A2BNC7_PROMS  ali  31  1MEIICNQNELNNAIQLVSKAVASRPTHPILANILLTADENKISVTGFDLNLGIQTSFD--------GTVKNSGAITIPSKLLSEIVNKLPNEPVSLEVDENSNILIKSDRGSFNLKGIPSDEYPNLPFVESGTSLNIEPSSFLKALKSTIFASSNDDSKQLLTGVNFTFKPNYLESASTDGHRLAVALIGKEEQIENKELSVTIPTRSLREIEKLLRSSENSIKLFYDKGQVVFISSNQIITTRTLEGTYPNYSQLIPDSFSKIINFNTKKLIDSLERIAVLA-DQQSSVVKIKLDDTDLASISADAQDIGNANESIPV-SYSGENFDIAFNVRYLLEGLKVIASENVLLKCNIATTPAVFVPEDNNSFTYLVMPV... 381
84 0.000e+00UniRef50_V1CNY6 Beta sliding clamp n=1 Tax=Eubacterium brachy ATCC 33089 TaxID=1321814 RepID=V1CNY6_9FIRM  ali  33  1MKFYCNQQELNRALNIVSKAITVRTTIPVLKGILIIAEDNHLILRASDLDMSIETKIDA--------VVEENGNVVANSKLFVEIIRKLPNGNIYMEKVGENNVNIKTDSSEFQIVGQSGENFPVMNIVEENNKLSIEKEILKNMIRRTNFSASIDESKGVLVGELIEINQNDIRMISVDGFRISVYKEDMKNENLN---DIIIHAKTLSEVLKLLSESDEDVELIIGSKEALILLDKTKVSIRLMEGEFIKYKDILPKDCNTRMKVDRKFLMQSIERASLMAKEGKNNLIK-CTIDGNLLTINSRSDE-GSVKEELIVKK-EGDNIEIGFNSKYILDVLKVLDDEEISIEFKNSLAPCSIKPVKGDNYEYLILPVR.. 366
85 0.000e+00UniRef50_A0A1V5VFG5 Beta sliding clamp n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VFG5_9BACT  ali  25  1MKFFCSRDKLIKNLQIAQRAVDAKSQAAVLRNVLMDASGGKLNLVGYDHRMGIRTSIDCQ--------IDTEGSITVPCALLIDILGVMQEEQVYFTL-EDSSMKVECGRSKYNLSCISADDFPPFPKIEGKDTFEMEAGVLETGIRQTIFATNPDDHRAFMGGVLLNLEKNEIKFVSTDGHRLAMRKFDVPGGAL-PTQKVIIPTRTLNELLRILPDGEEKVKVTVDVKSISFTLDGVFVTSRLVEAEYPKFEKVIPTRAEGQCRINRTRMIGSVRGASIMARSKENRDLIEINVTDDSIKFTSSTQDVGSASEELEVVK-KGKDIRVAFNSKYILDFLGAVEEDEVVFDYTEELDPGLFH-TDMPGYTYVLMPIK.. 366
86 0.000e+00UniRef50_A0A1V6EJA1 Beta sliding clamp n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V6EJA1_9FIRM  ali  35  1MNFTCTRKKLQDAVNSVSKAISNNPIMPVLGNISIKAKDSQIIFRGYDLEIGIEHIEDA--------FIKEEGEILVNARLFSDIVRSLGEEEVEIFT-EDSKLVIISGNAVFNIRWLDPAAFPKLPYVEKDNKVTIKTEYLKNMIRNTLFSVSTNEQRLILTGALFESEENSFKMVTLDSFRMSMRKEYI--LGNKEEFNFVIPGKTLNELLKLITNDDEDIKIYYEKTQVLFEFGNCKFISKLLQGDYFNYKAIIPKDFATKIEISVNEFRNIIERNMLVSDDGRKAPLILEISEN---ILTANTQEVGNVTEKCHIKK-EGKDIRIGFNARYLLDAIKSIDEDKVRISFMGETSACIITPLNSDEFLYLILPVR.. 364
87 0.000e+00UniRef50_A0A090D0V5 Beta sliding clamp n=1 Tax=Criblamydia sequanensis CRIB-18 TaxID=1437425 RepID=A0A090D0V5_9BACT  ali  28  1MKFIIATQELSYLLSKILNVVSPKATIPILANILIEAQGNEICLSATDLTVGVRCKTEAK--------VLKEGATTLPAKRFSQLIKELKSVNVEISTNENDVTEILSDSSRFKLFGMNKSEFPQLPDLGNAKKISIQEKDLKEMLYRTSFAVSREDNRYVLTGVCLNVENGRATFVGTDGKRLSRTFLSLPADLS-FKGSYIIPLKAVEEIQKCLKD-EGEASLYLMEDKIAVHSEDTMIVSKLLSGEYPDVDRVIPENPETVVTLDREELMTLLRQVSLFTAD-TSHSVRFS-FTKGELKLTANTMDIGEGLVKMPV-NYHGAKLEIAFNPNYFMDILRHNKSHLVTMGITDSFNPGVIKEKKEESAVFVLMPMR.. 373
88 0.000e+00UniRef50_A0A2E8WNN0 Beta sliding clamp n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2E8WNN0_9GAMM  ali  26  1MKFDVEKSALIEPLQRVVNVLERRQTLPILSHVLIECSESGIVLVGTDQEIELSARIPIDN-----VVVSGVGAITVPGRKLLDIVRHLPEGVVISCEAEADRFILRSQRFESQLTTLPASEFPWIDAVIADDPIKSSGKALKTLLSKTMFAMAQQDVRYFFNGMLFEFEAGLLRCVATNGQRLAISETSLEGSTAGARP--ILPRKGVIELARLLDSDAEEVRLQFTDQHVQAEFGLDRFVSKLIDAEYPDYTKAIPASSDQSFSCSRNDLKDALVRTAVLSNEVYKN-VRLS-LSAGQLEIFTNNPQQEQAIEQISVD-YTKEPLEIGFNIHFLIEALSVMSGDSVRVELSSPSSPCKLEDPDDSSARFIISPM... 367
89 0.000e+00UniRef50_A0A1P8QJX4 Beta sliding clamp n=1 Tax=Methylobacterium extorquens TaxID=408 RepID=A0A1P8QJX4_METEX  ali  28  1MQLTVQREALMRPLAVAHRIVERRNTIPILSHLRLGADTGSLTIRSTDLDIEAASTCEAD--------IQEPGVTTVPAHTLRDIVSKLPQGA-ELRLREDGQLTLTSGRARFKLPTLPVEDYPDLQAGEMPHRFIIPVLDMARMVREISFAISTEETRYYLNGIYLHAPDGGLVGVATDGHRLARARLPRPHGAEGMP-GVILPRKLVAEIGKLADGDGGEFAVALSPTKIRITRDGTSLTSKLIDGTFPDYERVIPKDNPHTLAADGKALTTVLDRVTTISS-GSSRAVK-VALEDERIVLTQQNPDTGEATEEADA-KFDGAAMQIGFNGKYLFDILTLLDSEHIEARFGDPGAPTLWRRRGDELLTVVLMPMR.. 373
90 0.000e+00UniRef50_R4YZ70 Beta sliding clamp n=3 Tax=Actinobacteria TaxID=201174 RepID=R4YZ70_9ACTN  ali  29  1MKFRCERDVLADAVGSAGRATSGRGALPVLAGLRLRLDGDHLEITGSDLDLTVTAEIEVAGGD--------DGVAVIPARLMADIVRALEPGAVNVEVTED-QATITGGRSEFSVNVIPPEEYPQVSEPTAD-SVTLSAEALADGLRQVVPAASNDDNRLILTGVQLAAEGDGLRLVATDSYRLAVRDLGGQSVLEEGQ-SVLVPSRALTEVIRSLGDAEE-VTLVLGAQDATFRIGGVRVTTRLISGDFPNYRGLIPETQANTLTVDRHALIEAVRRVKLMAREST--PIRLEM-SHNSLELVAVTQDVGHASERMDV-TFEGEGLTIAFNPDYLLDGLDAARGEEVRVETIGDNKPAVLRGSDADDFLYLLMPVR.. 362
91 0.000e+00UniRef50_R7I829 Beta sliding clamp n=4 Tax=Clostridiales TaxID=186802 RepID=R7I829_9FIRM  ali  34  1MQFTTNVQLLLDGLNTVTRALSARPTKQILEGVHLSAVGEHVKLTCSDGNLSIEMSILAD--------VKEEGTAVLPGRLFTELSRKLPGGEVTIRVGENHAASIRCLSSKSNLAGMNPTDYPEMARVAEGTTVRIPQDKLKEMISRVVFAIATEDNRQILTGCLLEVEPTEARLVALDGFRLAIQKMPFELPGGKENVRVVIPGRVLNEMSKVLGDTDEYCTLVFDQSRMTASFGTTTLSTVLLTGEYIDYRKILPASFRTTALADRVGVQNAIDRASLMAREGKNNLIRMS-FSGDTLAISS-NAELGDVLEELETE-LTGDPIEIAFNAKYITDVIRNITDEKLCMRFNSNVSPCVIAPQEGEDYLYLILPVRVF 370
92 0.000e+00UniRef50_A0A1V6HUJ1 Beta sliding clamp n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1V6HUJ1_9BACT  ali  27  1MEIRLKRSEFLTELAPMQGIVERRTTIPVLSHLLLTVRGDRLYLAATDLDVSLTSWV--------GGEVAREGAIAVQAKKFLEIVRAAATEEVQLVQEEERSLAISFGTARFRIHGLPATDFPTLATVAPRTEVEIPLPRFRRFVSKVLFAVSSEEARFQLSGALVHLKDGKVEMVATDGHRLALIEGAVSGAKGED--SVLVPRKALQELLRF--EGEEQLVFRRGEHHLAFVSGRRELVCRILEGTFPDYERVIAKQNDKKVVVDRRGLAEMVQRIALITGD-RARGVRLA-FAPGEITVSAANPDLGEASETLACE-YEGEALRIGLNPDYLGQFLAALETEKVLFELKDENSQCLGSPIGGEDYLCVIMPMR.. 364
93 0.000e+00UniRef50_F7PT47 Beta sliding clamp n=1 Tax=Haloplasma contractile SSD-17B TaxID=1033810 RepID=F7PT47_9BACT  ali  41  1MKFKIKSNYFAKGINIVSKALSTKTPMPILKSIKISTSNQGITLMASDSNITIKYFLPTEDHDTTKIFVEEEGEAAVPGRLMLDMLKKVTDENIEIALYENKFIKVNFGHSDYTLNCLDVREYPDISLISAENPIPINIADLNELIKQTSISISLSENRPILTGINFKLENQMLTCIATDSYRLSQKMIQLDNNTSE-PLNIVIPGKSLIELEKILSGMSGNVELHSTPNIVSFKINNLTFQSRLLDGNYPETSRLIPKEFGLTTEFNRSELIHVIDRVSLLSREGATNIIKFDIYDEKTI-VSLDSPEVGRVVEELHSTSQEGSPIRIGFNSKYLLDALKVLESEVIKIQFTGEVRPFILK-TDDDSVIQLILPVR.. 374
94 0.000e+00UniRef50_A0A2V2EPX7 DNA polymerase III subunit beta n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2EPX7_9FIRM  ali  28  12MKIICEGIELSDAVLKVAKACSTKTTNPILECVKITAENDSITLIATDGEIAIQRKIKAD--------VLEEGAICVPGKFFSDFIKKLENEQITLAT-EDGRVIITYADSESSMQLLNADDFPAIDANIGEKKVELLTKDLKELIAKTTFCCAQDDSRPVLKGVLVQTQEGRICFTALDGYRMAVCRKNILGMTGD--IKIICPGRTLNEIGRMLGADEDRIEIFVQKNMLMVSIDDTVLTSRLYEGEFVNVSNIVPKEFTSEIVVEKEALDESVERAAVLARTDKNSIVTFD-IREGSMGVSSNTM-IGRVNESVKI-MLEGKDVQIALNCKYVSECLNAATDETVRIGFNGAVAPCVLTPAEGDSYLYLILPVRT. 375
95 0.000e+00UniRef50_A0A077DAM5 Beta sliding clamp n=1 Tax=Basilea psittacipulmonis DSM 24701 TaxID=1072685 RepID=A0A077DAM5_9BURK  ali  25  4..LKTSKESILKPLQTVAGIIENRSAKPILVNVLIEKKGGQLSFLATDESVQIKTHAQIGLGDSEM-------ATTVAARKLLDILRALPDGDVSLE-EEGGMIVVKSGRSRYTLQTLPSMDYPVVKQPENTLSFAMPQRILCKLLNQVHYAMAEKDIRYYLNGVLLEFKGNVLTAVATDGHRMA-KSVAVVEGISGADHSIIIPRKAIHELQRLLDESDELVTVGLTDSQISLSFGDVEIVSKLVEGKFPDYSRVIDTTYEISIHINREELLGALRRSTVLADKKDQKGVKLH-FENNMLRLQAHNSEQEESMEEVAI-HYEGVPIDTAFKSSYLQDVLAMAKSEEVVWTCQSSGSSSVITIPQDDTFRYVVMPMR.. 372
96 0.000e+00UniRef50_A0A1I6E2A1 Beta sliding clamp n=2 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1I6E2A1_9FIRM  ali  32  1MHFSVHREDLNSVVQVVQKAVSLRNPMPILSCLHMESTSGTLTVTATDLEFGIRCTIPVNTVI--------EGSAALPAKYMANFINRLPEVELNVQCDISTNTTVSYGDSEVVLHGYPAEEFPPFPALPEKQALKINQRIFKKMLKQVLFAVATEEHRPVFTGVNIRIDGGTISMVATDTRRLAVCEEKLET-APENFINIIVPGKTLNELYKLIDAVDDTFDLYLTDNKIFFAFENICLMSRLIAGQYPDYRIVIPNEYVCEVRAPVSALLDAAERASLLVNNRRN--VFNINFQPGNLLIYFYT-ETGRIREEITAD-FSGDQLDVGFNVRFFIDLLRSLDTSEVIIKLSGSENPALFKPIDDDNYFAILVP.... 364
97 0.000e+00UniRef50_A0A2M6W349 Beta sliding clamp n=12 Tax=root TaxID=1 RepID=A0A2M6W349_9BACT  ali  25  1MKIICTRENLANALSLIGGVAGKNINLPILNNVLIKADSQKVDLVATNLELAITTQLRAK--------IEEPGSFTVPAKTLFDFINLLSTETVELSVKENE-LEVASGKSATKIKGTPADEFPVVPSVSEGKGYVVDSHIFKRSIEQVSQSSSKNDIRPELAGVFLNFDKKSLVMAATDSYRLAEKTLNIEQG--DQDTKTILPLRAAQEISRVLGQKEKNVRIVINDNQIVMRNDDVELVSRLVDGKYPDYQQIIPQNFNTEVEFDISQLVKEVKAASLFTTTGV-NAVDFVIDEKDTTLISSASAQAGEHQSELSVQ-VKGERNSILLNHRYVLEGLSNIDGQNCVLKIINGDSPCLLTSSEDKSFLYIIMPIR.. 373
98 0.000e+00UniRef50_E3DLI3 Beta sliding clamp n=12 Tax=Halanaerobiaceae TaxID=972 RepID=E3DLI3_HALPG  ali  33  1MKFSINQKELYKALNIVRRAVAKNQTLPILTGIFLSLDNNILTLKSTDLELGIKYDLKVEGQVN--------GSIVLPATQFLNIIRELPNQKIEIDLNKDKWLEIKCLNSLFKINGFDPDEFPNLPKVEDSANFSLPAKKFKEMIKKVRISTSKDETQPALTGAFFEVETEKVKMVSTNTYRLSYIEAPLKTSVAE-KIAVILPGSTLQELNNLL-EADESVEIEVDNNYARFTFAGIEVISRLIEGKFPNYELVIPDESNSKFSADLSQLHGAVKRASLIAKLDA-NIITLLA-EDGLMEINSAEGSSGYAHEELKIE-IEGPKQKINIDAGYFIDVLKVLDAEEINIEMIGPLNPLVVKSEAGDKFIYLIMPVRS. 368
99 0.000e+00UniRef50_A0A0G0DDP8 Beta sliding clamp n=3 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G0DDP8_9BACT  ali  26  1MKATILQENLNKSLSFVTKLVSSRTQLPILSNVLLETESGYLKVSTTNLETSMSFWVGA--------SVEETGAITVPAKLLSEIVASFSHEKIILST-DGFNLKLICGDSESTLSGIDAKEFPPLPQTGQQKSIILDKHVLDNGLPFVLISASQDESRPLLTGIKFAAKEEHLEMVATDGYRLSVKELP---QIKGMEEGLVISAKAMADVFRLIEEKAENIALYISKNQAVFKLEKAMVATRIIEGEYPVYAKIIPSTFTTKSIFNKEEMIRAVKLASVYAREAA-NILKFKV-TKETITISASSAQIGENKTTISAKT-QGEGGEIAFNARFLSDLLNVFPEEDVVFEMNGNLSPGVFHPQKDETYLHIIMPVR.. 365
100 0.000e+00UniRef50_C0GI72 Beta sliding clamp n=2 Tax=Dethiobacter TaxID=427925 RepID=C0GI72_9FIRM  ali  32  1MRLTVPKALLAEHLQITAKAAPPKSTMPVLEGILFQSDGQTMTLTATNLELGIRTSFPVPD--------QEKGEVVLPAKA-VEIIRKLPGDTVSLTVNEENFLTIKSGQSEFQLYGLSTEEYPAFADLSADSACEIKAGEFRRALRQTLFAASQDEGKPAFTGIMFTLKDNTLTLSSSDTFRLATTSCRVQNQ--GADGVFLVPAKNLQEVIRILTNDEDSVQLAVADNQLLITCKNIKLSSRLLDENFPNIDRVIPREFSGRATVDVADFLHAVERASLLS-EGVNHVVRLSIGEEG-LVIRA-SSKFGKTQEHVPVE-LSGEGLEISLNSRFILDMLKVHEGDQCILELTNANKPCILRDSLYQEYLYLVLPIK.. 366
101 0.000e+00UniRef50_A0A2N2E918 Beta sliding clamp n=1 Tax=Candidatus Falkowbacteria bacterium HGW-Falkowbacteria-1 TaxID=2013768 RepID=A0A2N2E918_9BACT  ali  27  1MKFISLKENLKQGLSIVGHLTSKNINLPILNNILIKAKKEGLELISTNLEISISHFL--------RSKVESEGELLVDSRVINEYVSLLPDDKVEIEGV-NEELKIKCKNYKTKINTQSGKDFPIIPKIEGDSCFFVKTVDFKKAINSVLFSVSNNENRAEISGVFFSFSGGKLVMVATDSYRLAEKTISFKGDSMTATKNVIVPAKTLQEVVRVLSNFKEEIKMCLTESQVLFVIGSSSIVSRLIVGSYPDYKQIIPEKENTRVMVEKGALVKALKTAGIFSKTGINDV--GVSIKKNKLIIFSSSSQVGENFIEIDVET-RGEEVEIFVNYKYLLEGLNNILEQKVVLAFVDNASPCKIYSEEEKSFLYIVMPIR.. 373
102 0.000e+00UniRef50_A0A2G6JC24 Beta sliding clamp n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6JC24_9PROT  ali  22  4MELKLDRNAFLSALYKTQGVVDRKSTTNVLSHVLLETLGGRARLLGTDYDVTIEAELPAE--------VIVEGTACINGKSLFDVVKNADDNEVLLQQLDNHWVEVHAGRSQFKLAGIGASDFPELATPDDVVWLDVPAATFSDLVDKTSFSMSDDETRMNLNGVHLNIEPGKLTMVSTDGHRLSKVDLEAANGYEGQTLSAIIHKKGVQEVRRLLDGDAQVIDVGFGKGVILFRAAGTTFTVRQIEDSYPDYGRVIPASSPVRVPIPRDRLIRAIRRNAVLTS-SKTYIIKFE-LSAGKVAVTTSNPDYGEGRDEVDV-PYDGDGMVIGFNYNYLLDVLGAIRGDHAVFEFNDEFSPTVITSPTEPGAIFVVMPMR.. 377
103 0.000e+00UniRef50_A0A2N2NJ51 Beta sliding clamp n=13 Tax=Bacteria TaxID=2 RepID=A0A2N2NJ51_9CHLR  ali  26  4.KVTVQKNTFAESLAIVGRAVGSHTHLPILSNVLLRKDEGQLRLSATDLTLGVTVWMDAHMDGDPGL--------TLPAKTLTDVVNSLADPEVVFSVNGKPEAALKCGTYKGVVKGVEASEFPSIPEFDVSSGIPLDANAFKKMIQNVAFAASVDDSRPVLTGVLMNMDGKSASMVATDGFRLAIYKVELP--VTLGKKQLIIPASVLKEVVRILGATKNKTTLFLTGSQVVLRCENVQIVSQLIDGKFPDYQAILPKGYKTRAVVNTNDLLKACKQASIIAREG-SNVVRFHLDQTGKVKLLAESDETGTSEIEIGA-TVEGQELEIAFNVKFLQDGLETISTKNVVIEANAHNTPAAIRPTEEEDYLYVLMPM... 381
104 0.000e+00UniRef50_D6GSV8 Beta sliding clamp n=1 Tax=Filifactor alocis (strain ATCC 35896 / D40 B5) TaxID=546269 RepID=D6GSV8_FILAD  ali  29  2MKFTVNQREFSDALAIASKAIISKTPLDILKGFYLEAYENELTITGNNLEIGIRTSIDA--------AVETEGKSVIDAKILSDIIRKLPNEEVTVSIKDGNVL-LQCQKLKFTIKEMLDNGFPTVDELEEAVYQNIHPAILEEMIKKTHFAVTTDETKPVFMGELVELEDNQMNVIALDGFRLAYKKCELKSSVG--SRSMIIPGKTMVEIMRLCQTMEEDVKIGIEDRHASFLFGRTLVNTQLIQGEFSKYEEIIPKEFSTKIKVNRQKFIDALDRATLVS---KNYLVKLR-IQNDELLITAHDNEVGNLEEILDVE-LEGKNLEIAFNIRFFLDSLKVMEDEYIYMNFNTNVSPCIIKPEFETDYTYLVLPVR.. 362
105 0.000e+00UniRef50_A0A0P1LZS1 Beta sliding clamp n=2 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0P1LZS1_9BACT  ali  27  1MRFSISSDRLKEALSKVSAVVPSKTTLPILQDILFELKGNALYLTATDLEISVRMTIE-------PVDGEEDGAGAIPEDKLTSVVKALPEGLLKFESLDSNRVLITTNKGEYKMSIEPADSFPAIPESIGETAVVISGGVLKEIIENTVFATSKEELRPATMGVLFQFKGDEFIAVATDGYRLVKRRGVVNLKGGADFSGVIVPAKTLQIIAKSIED-EETCEIMINEKHIQFSTERITIISRLIDEKYPNYESVIPYENNKELVVERDLFLSTVKRVSIFAN-STTNQIKFKLDPSGFVEVSAEDVDFGSAKERLDCA-YNSEPMEIAFNAKFITDILGHIDSEKVLFKFGSPTRAAIVQPYEDSEMLMLVMPMR.. 378
106 0.000e+00UniRef50_A0A2E3LZG2 Beta sliding clamp n=2 Tax=Parachlamydiales TaxID=1963360 RepID=A0A2E3LZG2_9BACT  ali  28  1MKFVISKAELVKLIGTIQNVVAQKAPIPILSNFLLEAANGEIILTATDLTVGIRCFAPAK--------IEQEGATTLPAKRVFQLVRELTAANIEVSTGSNEITEIRAGSSVFRLHGMSRSEFPALPDLEGSTKFKISQEKLREVLFRTSFAVSREDNRYVLTGVLMQVANGGATFVGTDGKRLSKSALSVALDSS-FTADYVIPLKAVDEIFKGLTE-EGEATVYLMSDKIAVESDDTIVITKLLSGDYPDFNRVIPEDSDVRVDLHREELASLLRQIALFTVDN-NHSVRF-TFQDSELFLTANNMEVGDGKVSMPV-NYHGPKLDIAFNPTFFLDILRHSKCETVAIGITDSYNPGVVTDNSAEDSLFVIMPMR.. 364
107 0.000e+00UniRef50_A0A2N6B9P7 Beta sliding clamp n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6B9P7_9DELT  ali  25  4MRIEINQEKFSEIVARAQSTLERKSTRPILENILLQASDDEIILSATDLRVSLTQKTKCK--------VIESGSISVPGRKLNEIIREIPRGDVSVESKDNNWITISSGNSTFHIPGTASEEFPSFPTPPN-NFIEVDPSSFDNMFTKTIFASSNDETRMYLCGVYLEFKDEDLKVVATDGHRLSLIDTLLKNGLSLFSDGIIVPKKGVVEIKSIISTAGDSLEIACADGRIYVRSEDILLSVTLIDASFPNYSQVIPKQTGGGVLIACEPFKDALRRVSILS-DQETRSV-LVEIEGSVMKLYSDNPGMGDAEETLSVD-YSGEPVKVAFNANYLMDILKVMDDEEMRMEVKDSLSPTLFIGTDDSSFLSVVMPMR.. 374
108 0.000e+00UniRef50_A0A1G2BLN3 Beta sliding clamp n=3 Tax=Candidatus Komeilibacteria TaxID=1817908 RepID=A0A1G2BLN3_9BACT  ali  27  1MKFTCTQENLSKGLTIAARFSDRNINLPILNNVLLRAKKEGVIFTATNLELAITTVV--------RGKIETPGEFTVASRLLAEFVNSLKKEIITVSLEEKT-LTITGENHQTTLRGIDATDFPVIPTIDSKTAFTIPGDVLRHALSQVLFAAGTDESRPEITGVFLRVENSTCTLASTDSYRLAQKKIAVKQ-APKEDREVIIPAKTLAEVVRIAEEEPKEVSIAINENQIKFTVGDTEITSRIIAGEYPDYKQIIPASFKNEVAFAANDMVRAIKTTSLFCKQGI-NDIRLSLFTD--IAVTAENSTLGKNTSNVPSLSKQ-QEFDIVFNYKFFLDGLQHLMGEQAVLKTNDPASPALLSSPSEKDFLYIIMPIR.. 367
109 0.000e+00UniRef50_A0A101E9X8 Beta sliding clamp n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E9X8_9FIRM  ali  30  1MHIICQQRDLQNAVNSVYRAVASQSTIPILTGILLQASKEKIYLEGTDMELRIKY--------GLSTQVKEEGKAVIPARYFVDLVKRLPDEEIELGLNDGKRLFMKYGDSIVKLNLFEVEEFPEDEKEPVEYNLAVDPLLFSESIKQVSIAVAKDESRPIFTGIHLELEEKFLTMATTDSHRLTLKKVSVNIQKLNKDLSVVVPSRALNEAARLMGEAQEEIKIGFTETKACFKCGDVVVQSQLIDGQFPSFRDVIPESYKTLVEVEIGSLYDSLSRASLVSGEYKGKGIVRINIKDNSMSIFSFSNDVGEVMEFLPLLKKEGEDLEIAFDARYLLEVLRVLNSETARIEFTGPLSPAVIKPSEGDSYLYLVLPVR.. 374
110 0.000e+00UniRef50_A0A2E5HPS6 Beta sliding clamp n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E5HPS6_9DELT  ali  25  1MKVRIARDTLTNELFKVQGVTNQKSTLLILNNALLEARDGQLTIHATDLDVSISTSCECE--------VLEEGSVTLQAKRLFDMVKNLRDPELTLETEANHHTRLKAGNVNCRFPGTPASEFPEVPDHSKVQFYSMGTARLLDMIEKTLFSVSTDEGRPNLNGALLKSDGGTLTMVSTDGHRLSRIEMSPAEDAEPAERGIIIPRKGLTEVKRTLNIEISELLFGLHGNNIVFKHGPATISIRLIDGKFPDVDKVLPKETDKKARVRKEDFIHSLKFVSIVAPPRTGN-IRI-TFEEGQCEIFTQDTEQGEAREIVSID-YDGVTVKAGYNYRYLLDVLNVIDGDEITMEIIDTLSPTLIRPRPNCEMLFVVMPMR.. 376
111 0.000e+00UniRef50_A0A0G1WX46 Beta sliding clamp n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1WX46_9BACT  ali  27  3....CTKKNLIAGLQTTSRVIGGVTSLPILNNLLLKTDQGRLRISGTNLEMAVNTWV--------AGKVEEEGEITIPAKLLSEYVYNLAADKVNL-VSEKLTLKVEGEKTETHIKGLPAEEFPLIPDTGEKIFVRLDGGGLKKGLSEVSFAAAYSEAQPEISGILFRFSGKTLELAATDRYRLAETRVGLEAEVIE-EKALIIPARAVGEIGRILG--EGVVEVYLREGQVCFKNSDREIITRLIEGQYPDYKQIIPAKFTTRAEFDRHALGQAIKAVSLFATD--SNNIEFELLPGKDLIIAAASAQVGDSKIQVPGEIV-GEKNKIIFNYRYLLDCLNTLSDERVVLQATNETTPVAMTPKGRDNFLYIVMPIK.. 360
112 0.000e+00UniRef50_A0A256G0H1 Beta sliding clamp n=11 Tax=Rhizobiales TaxID=356 RepID=A0A256G0H1_9RHIZ  ali  28  1MRVTLDRAQLAHALSTVTKAVEARTTIPILGNVLLSADKGQLSITGTNLDLEISTSLPVLDS--------QDGTVTVAGKLLADISKRATSD-ISLEADGNHLV-VKSGKSRFKLDTLPAADFPSFNHGSFDTTIEFD---LASLVQEVQFAVSTEETRYYLNGVFLEAKDGHIVATATDGHRLASTRIEQESSFAP----VILPNKLLSLL------PTGVVSVSLSSNKVMVERGSTVIVSKLVDGTYPDYERVIPKPSERVATLSAKALREAVGRTSVIASE-RGRAVRFS-FASDALTLNVANPDRGDATEEMEV-NFSSEPLTIGFNGQYVTELMAAFSADEVTMSMADSGSPALITSAGRPGYRCVIMPMR.. 351
113 0.000e+00UniRef50_A0A2N0V0D5 Beta sliding clamp n=12 Tax=Clostridiales TaxID=186802 RepID=A0A2N0V0D5_9FIRM  ali  32  1MKISCSRTDLGLAISNVSRAVSTKASIPALEGVLIKAYGSTLNISGYNLEIGITTDIEA--------TIKEEGEIVVSAKLFLDIVRQLPEEVVFIETDERMVTYIACGNANYQIVGMSSVEYPDLPSFEQTDGIFLNAKVLREMIRQTVYAVSENTAMPIYTGSLFEIENGIFKIIAIDGYRMAIRSENIDSDSKNA---FVVPGKTQHEVLKLLIDDEETTEIIIGQRHIAFKIKNYKVISRLIEGTFIDYKSAIPKDTKTEVVINTRTIINAVERMSPINNDRMQSPVR-CTFSDDEIKLSCISS-IGRADDVISVPIV-GESVEIGFNNKYLLDALKNADTDEIKLILNGPLMGMIVKPVKSDSYLSVVVPMR.. 363
114 0.000e+00UniRef50_K6H2P5 Beta sliding clamp n=9 Tax=Bacteria TaxID=2 RepID=K6H2P5_9GAMM  ali  24  1MEITVKKEDIVSALNTTLGVVEKRQTLPILANVLFEVDESSFKLTATDLESEVSIS-------GPLVGVESAGKTTTSAKKLNELCRLIPDGEIISLSLAGEKLNIKTTNGKYSLSTLPSADFPIFDIDSGDTPLVVPAKDLRELIRSTSFAMGNQDWRHYLNGLYLTINDGEITAVTTDAHRLAVANTSI---QSDHSFSGIIPRKSINEMAKFLSDHDGDSELKINEASLELVVGNLVFKSKLIDGKFPDYQQVIPSGESSVLEINVKDFSETLSRVSVLSSE-KYKGIRLITSSDG-VRISANNPEQEEAEEFFP-TPYNGDDLDIAFNVTYLQEIMSHMQTDTCHINFFGSDKSCLLTPPGSDTPKYVVMPL... 363
115 0.000e+00UniRef50_A0A0S7XZZ9 Beta sliding clamp n=1 Tax=Coxiella sp. DG_40 TaxID=1703354 RepID=A0A0S7XZZ9_9COXI  ali  24  1MNFTIQREILLKPLQQITGVVEKRQTMPILANTLLIIDNGQLSMTCTDLEIELVVNIALESSSQNFN------KITIPARKLLDICRVLPENSVDFHQDGNNCVIVRSNRNRFVLATIPADDFPNIDTQNKVLEFTITQKKLNYLIKSIYFAMAQQDVRYYLNGLLLEVKNGTLAAIAADGHRMAINSLSH-QIINDSTLHVIVPRKGIMELMRLLEDSNEEIAVTVSNNHIRIIKPGLTFTSKLIDSKYPDYEKTIPKNGGKKVIVNRNIFKQALTCVAILS-DGMFCGVTLQ-IQSGSMHIFTRGQKYEEAEEEIPI-NYQGDSITIGFNINYLLDVLASVESEKIVMTFKDTSSSILLEQYEDKNLLHIIMPLR.. 374
116 0.000e+00UniRef50_A0A0F9MQD3 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9MQD3_9ZZZZ  ali  30  1MKINCKREDFLESIQVVQNALTS-TALPVLSYVLLEAGPEKITLTTTNLETTIRSSFPAQ--------VEGEGEICLPGDKLFYILRELPSAPVALEI-EKSKATIRCKKAMFQLLGFSAEDFPEVPQIMVEKFFSLSQEELRQMIQRTVFAASRDETHQNLNGAYLEVEEKDAKLVATDGRRLSFVHLSL-ASSSLSSGEAIIPLRALQQLARILS-GDEEVKIGVSERQIFFEMDHILLISQLVDAKFPDYRKVIPTEFSIAILADRDDLLRSVRRVSLLT-DEKSRLLKFK-LKENTLLISAEAAELGYAYEEIDVRRERGEEIEIGFSSTYLLDILKNIEKGEVRIELTDSEGPGVIRPSENKDHICVLMPVR.. 363
117 0.000e+00UniRef50_UPI000995935E DNA polymerase III subunit beta n=1 Tax=Bacillus halmapalus TaxID=79882 RepID=UPI000995935E  ali  40  1MEFIINHTAFKNAVLEVGKIVSEKATLPILSGIKIIAEKDNLTIIGSNSDLVIEKIIPTFSNGSKVVEVLQPGSIVISAKYLSEIVKKLPNE-IHFTVNENNRVTIQSDEISSRLNGFSASEYPNLPLMDDTQYIPMARKVLIEMLKQTVFAVSKNETRPVLTGVYFHFSKGELTCAATNSIRLALSKRVINARVN---CSCIVPSNVINELSKLMNNTSETIDLFISDHYIMFKSTMSKLYSRILVGTYPHILRLIPQEFQTTITMERKQLLNGIDRATLFSSVTNNNKIYLELKEGSKIKIRSHGTELGEIEETQYLKGIEGEELSIAVDGGYLIEALKALKEDEISLSFSGPMRPILLKPIGSDNQLHLISPVRT. 375
118 0.000e+00UniRef50_U7UNS8 Beta sliding clamp n=24 Tax=Firmicutes TaxID=1239 RepID=U7UNS8_9FIRM  ali  36  1MKFNISKKELSKHISIAQKAISSRSAMQILEGLLLVAENNTLTIIGTDTDLTIITSASA--------IVEEEGKIVVNSRLFGDIIRKLDDSDIKIRI-EKHNMNIICNKSEFNITCQSPDEYPMVTNFEEKNSFKISSEELKEAIRKTSFAVSQEDTRKMFTGVYMDCTKG-INFVALDGFRMSLVKLNKETKESKS----IIPATSLNELSKILEDS--QVDVKVGENKILFEFDNTKLYSNLFGGEYFSYKDLIRDNHTTKVKVDRGLFQISLERASLLAKEERANLIKLE-IKKNSLVISS-NTEIGNVTEEIPCQT-EGDELTIAFNSKYLLDGIKIIEDKDVVLNFTDSVNPCII---NTDSYTYLVLPVR.. 355
119 0.000e+00UniRef50_A0A2H0RLJ7 Beta sliding clamp n=5 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A2H0RLJ7_9BACT  ali  27  1MIFSCTKDNLQKGLNVVSHISNKQVNLPVLQNVHLKAEGGSIVLSTTNLEIAMRISI--------RGKIDKPGEFTVPAKLFYDFVSLLPNDRVDVERVDQ-LLEVRCGDTATTMNGIDAAEFPLIPQVETTAVIKMPAQLVREALSQVAFAVSHSEARPELSGVLLKFNEKTLTMAATDSYRLSERKVILTEPA--QDRQLIIPAETVNEVNRMLSEADDVLELRLSDSQAVFVYGPAELITRTIDGNYPDYTQIIPTVFTTEVIVGRNELIKAIKTASLFSRQGVFDVILQISPDTKKLTVTANEVTRGTNTVSCDAD-ITGKENKMTVNFRYLLDGLNTMSSEGVTLKLIDAMNPCLVMPLEPGSQTYIVMPIR.. 374
120 0.000e+00UniRef50_H8Z1G9 Beta sliding clamp n=1 Tax=Thiorhodovibrio sp. 970 TaxID=631362 RepID=H8Z1G9_9GAMM  ali  26  1MKIEVQREDLVPALTSVAAVVERRQTLPILSNLLIKTTEDGFLLTATDLELQISSNI--------ASKVVEPGAITLPAKKFADVCKALPENRISLEVSD-TRGYVRCGRSRFSLSTLPAEDYPGLEGEASEQAFEVETAVLARMIERTSFAMAHQDVRYYLNGLLLEICPGRLVTVATDGHRLAKAESAVSALQSEDKRQLILPEKTVAELKRLLAGKGETTRLEIGDRTVVIRVGNNVVTTKLIDGRYPDYSRVIPTQLQHSALLEREAVKDSLARTAVLSYE-KQKGVRM-TFEEGTLKLEVSNPEH-EEAEEEIAIDYQGGSTTIGFNVGYWLDVLNVLDGKSVEVRFLDSEVSAILSDPESPNELYVVMPMR.. 368
121 0.000e+00UniRef50_B8FM62 Beta sliding clamp n=3 Tax=Desulfatibacillum TaxID=218207 RepID=B8FM62_DESAA  ali  24  1MQFSISKEIFLDGITKVQGIAGRKTTFPITANVLISAQGSTITLVATDLEIGFKGHYPA--------TVEEEGTITIPGKKLFEIVREFPHGAIDVRDLENGWVQIFKDKVQYKIVGMDPNDFPKLPEVEGMELFELDSLVFADMIEKTNLSMSSEEKRPHLIGVYLEKEKNGLRMVSTDGNRLARVDYIPDEPAFDGAKGVILPKKVMTEILRV-SEGGGKISLGVQKNYFVIQKEAETIIGRLVEGEYPDYNLVIPNDLETFFEIEKQPFVSILKRMSILCSE-RYRAVRFKV-DPQRLEVSVNNPELGDSNEEMPIA-FNGGAFEAAFNPRFFVDALNPMKSDMIKVNILDSSKPCILEGSEDPRYLSVIMPMR.. 375
122 0.000e+00UniRef50_A0A1V5PLP0 Beta sliding clamp n=1 Tax=bacterium ADurb.Bin363 TaxID=1866927 RepID=A0A1V5PLP0_9BACT  ali  30  1MKVICQQEKLNFGIQTVSKAISSKVIEPIYGNIKLETSNNNMRLIATSGDISIEILIGVDS-------VEKEGSITVPSRELGNLIGSFNSGKVEIESDDIKLITITSKGCHYQLNGLPSDQFPSMQKTISEDLITINQETLKNMIKETFFAIAPDEVRAVLKGSLFEIEGENLTVVSADGRRMAKKTGKL-LNSPGKNFEIVVPKKTLNELIRILSESEEEVNIFISDSQIDFHIDNIRILSSIIQGKFPNYRQVIPTHCEQSLRINKENLYKALKRASFIAQDLESNLVKFKV-HGSQIIITANTQDVGQAYEEVDLEEPA-QSLDIAFNAKYLIDALSSMATTEIIFELSNPVNPGIIKPAQREDYLYVIMPVR.. 370
123 0.000e+00UniRef50_R6P7F6 Beta sliding clamp n=1 Tax=Eubacterium sp. CAG:274 TaxID=1262888 RepID=R6P7F6_9FIRM  ali  33  1MKLECSKKSLLNAINIVSKAVSTRSTLPILNCILLTGDREGFRLLASDRELSIET-------DNIESDLYEKGSVAIDAKMFADIIKALPTEMVTLTVDEKNVCHIKSGKSEFTINGQPAEQFPEVPVVNKRENIVLKSADIKNMIKQTIFSVATDESKPILTGELFKFDENCFNAVAIDGFRVSWRKTVCEY---DGYTEMVVPSKTLNELARLLSDDEEKATIYYSSSYILFEIKGCTIVSRLLDGEFLNYENLFVENSPVKLTANTHELLSAFERATIVSEDNKKTPVIL-TIKENNLNIRT-TTDRGLVNEDVPI-TLDGEELVITFNARYIIDILKVVEEEYVTMNFNTNKSPCIVTGVTNHDYKYLVLPI... 364
124 0.000e+00UniRef50_A0A2E5F7S7 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F7S7_9CHLR  ali  29  1MKLSCAQEELSRVLGLVGRAVPRRTTLPSTQNVLMVSEGSSVRLSTTNLEIAITTWMEC--------AVEEDGACSVPAALLTELVNSIPPGEVHLSVNEPANMHIESGRFEASVNCGDVNDFPPLPTVEETVAARISADDFRTAISQVAFAAASDESRPVLTGIKTEITGQNFVLAAADGFRLAVHTGKLQTPFTE-TIDVVIPARTLEEVARVAGDSQGEIELSVTKSQVLLRLPNVVIVGQLTQGQFPDYKQLIPKDSSCNATINLESVSRAARTAAILARDS-NGIVRLVFMDNGTLQISSSADEVGENQEEIDAQVI-GEASKIAFSSRYLIDVLRNMPGTEVVIETSSPSSPGVFRPVADDSYVHVVMPM... 376
125 0.000e+00UniRef50_A0A1G0HI20 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_41_15 TaxID=1798282 RepID=A0A1G0HI20_9GAMM  ali  25  1MKIQIDRDTLLQPLQTVIGVISVKPSLPILSNVLVNIKPQKLTITGTDTEVELVGH---AITPLPDTDVL----LTLPGKKLADVLRTLPENPIELYQQKE-RITLTSGKSRFTLSTLPAEDFPSFDKNSCQYSFDIPQNKLKNLLTQTQFAMAQQDVRYYLNGILLEFNPDHIKAVATDGHRLAYACIEFNTQVAARS-QIIVPRKAATELIRLLQLTEDTVRLDIGTHFIDVTGSGFNFTSKLVEGRFPDYNRVIPKNNQTKILINREFMQNILHRVAIVSGES----VRLA-FKPNMLHAYAET-KTENAEDDLIIE-FSGEPFNIAFNTHYLLDAINNIQSEEIEMCLAGPDASALITEPGKLDVQYVVMPLR.. 362
126 0.000e+00UniRef50_A0A291QRI3 Beta sliding clamp n=8 Tax=root TaxID=1 RepID=A0A291QRI3_9BACT  ali  24  1MKFIVSSSTLLKQLQQISGVINSNTVLPILEDFLFSIEKNELTVVATDLETVMKVKLEVEA--------KENGRICIPAKILMDSLKNLPDQPLTFNIDNSYAVEITSDNGKYKVMGENPENFPKEPAAEDATSFTMTATGLITAINKCIFAVSNDDLRPAMTGVYFELAPTSLTFVATDAHRLVKYVKT--DVQCPQSDSFIVPKKPLNLLKAAIPDNDTEIRIAYSKNHFFVTHDNAQMICRLIDARFPDYKVVIPKENPYRLVVNKTDFQNALKRVGVFAN-KSTNQVALS-ITGSELQLSAQDVDFSEGNERMSCQ-YSGEDMQIAFNAKFLIEMLHAAEGDEISMELSTPTKAGIIKPSENEDLLILVMPL... 368
127 0.000e+00UniRef50_A0A1G4F519 Beta sliding clamp n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1G4F519_9RHIZ  ali  26  5..FSIERGALLPALAAVNRAVEKRNTIPILGNVLLAVENGELCVTGTNLDIEVKS-----VAKQEGLPVIAP--FTVQSGLLHDAVSKFADGSVVTFEGDETHVNIKSGRSRFRLQVLPATDFPEMSAGEFTHEFALPGNVLARVLSTVAFAISTEETRYYLNGVFMHNDGEHLAFVATDGHRLALMKLDAPAGSAGMPP-IIVPRRTVALLQH-FAKGDEDIVLKISDRKIRIMLDGTAITSKLIDGTYPEYQRVIPANNDKAYTIDREELAGAINRVSTVSSE-RGRAVKFS-FGPSELKMEVTNPDSGQAEDSIVISEGHDDEVTIGFNHKYCLDVLGAVSAKEMRFELSDPGAPCKVSPIGAEDPLFVIMPMR.. 373
128 0.000e+00UniRef50_A0A2E5VDP0 Beta sliding clamp n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2E5VDP0_9GAMM  ali  22  1MKFIAKKSEIAESLQLGAAIAERRQTIPVLANLKIIAANNSVEITATDLEIQIKATTRIK-------EIIEEGETTVSARKMSELCRSLPENENLEFNLNNGKLSVSAKNFNADFSTISTKDFPELEFSESSSTTPMLPATLLRLLSKTSFCMASQDVRYYLNGLLIEYREGKILAVATDGHRMALAEESLKDGGSLEGTRYIIPRKAVLELSKILKSEGKEIEIGFGTSSLRVKDEDLDFRTKLIDGKFPDYDKVLPPGEPNKLLISKEDLQSALSRASVLSNE-KYRGVRFQ-LSKNKLILTANNPEKESAEEALDV-NYEGPPMEIGFNIGYILDVLSIIDTENVQINLYGEESSCTIQEPENQSEVYVIMPMR.. 367
129 0.000e+00UniRef50_K8Z839 Beta sliding clamp n=1 Tax=Catellicoccus marimammalium M35/04/3 TaxID=1234409 RepID=K8Z839_9ENTE  ali  39  1MKFTMNRSFLQNKLATILTAIDSKVINPIFSGVKIVAKATSLFLTASNGNISIELEIP-SADKDAELIIQEEGGLVLPARFFNSIVNKLPQQEVVVEQMSNQQVAISSGSALFHLNSHSANDYPQLPKVSQESILEIPVHLLEELISETTFAASKQETRPILTGVHFVLKDGIFKAVATDSHRLSQRILPMD--TKDTEFDIVLPAKSLTELSKTFRNKDEFITISMTDNQALFKTERISFYTRLLEGNYPDTDRLIPKEFITSAVFDSHYLNAAIARASLLAEKATSNIVKMQ-ITAQRIVLSSQSPEIGYVEEELECRDVTGEDLTISFNPMYVQQALQAFKGEEVKIQFISPVRPFTITPLNEKPLIELITPVRT. 374
130 0.000e+00UniRef50_A0A1V5J0G9 Beta sliding clamp n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V5J0G9_9FIRM  ali  31  1MKVSCSKAALVNGVQAVYKAVSPKAPIAALSGILVETCAQGLRLVAYDLDLGIETFIPV--------TIEREGAMVMPARYLSDITRRLPHSEVVIEYREDVRADILSDRSNFTVKTMPAEEFPALPEIPAVSTWSIPEPGLKTMIRRTAPAVATEDNRAFYTGIYTIFQRDSLTMVSTDTFRLAHRSMPVSLPIENQ-VGVIIPGKTLLEVERNLGEGDREVSVAVTDRHAMFRVGSTTYITRLLEGQFPNYRQVFPQNIPVRLMCDRMQLLNAIDRVSLMCKDELS-AVRMVYTGDGFLTITANTPEVGDARDDIPVSMQGHADVTVALRARYLRDVLRVLDGDEVCLGYTSFKHPIEVTDETDPAYTYLLMPV... 373
131 0.000e+00UniRef50_A0A2N6AKS5 Beta sliding clamp n=1 Tax=Ignavibacteria bacterium TaxID=2053306 RepID=A0A2N6AKS5_9BACT  ali  26  1MKFTAVSSDLHKALSKIISVVPSKSTLPVLENILFELTGNDLRLTASDLEISMAVSMQVEG--------EADGKVAVPAKKLNETLRALTTRDMTFTADDSNRITLKTDQGEYKMAGESASNFPEAEAVQEEFSLQLDPDLLRGIIARTVYAVSTDDLRPSMMGVLFQWKGEEFFAVATDGHRLVRIKHALAEANTEGNRDVIIPAKALNIVSKSLGD--GEVNVVFGRTNVRFTFGEMSLLSRIIDERYPNYESVIPLDNDKQLTVSRLALISAVQRCSIFSN-AITNQIRFSV-SKEELRVSAEDVDFGEAREAVPGAFSADDDLEIGFNARYVNEALQHLSSEEVDFYFSAPTRAGLIQPKEQKDILMLVMPLR.. 372
132 0.000e+00UniRef50_A0A2M7XCN5 Beta sliding clamp n=4 Tax=root TaxID=1 RepID=A0A2M7XCN5_9BACT  ali  25  1MKLSCTKDNLHQGLSITSHLMTKNVNLPILQNVLVKAEGGAIRFTTTNLEIAVNCTV--------RGKVEEPGEYTIPSKLFFDYVSLLPNETIHINASD-TSVEVECGSHNTRINGLVASEFPLVPKVDGEKMYQIPVEEFKQSLSQVLFSVAANESRPELTGVFLHEGEGRLTLASTDSYRLSEKVIPVVSGVVE-EFKVVIPAKTLSEVNRILSVFKDEVTMTLTNSQVVFSYGPVELISRTIEEEYPDYQQIIPTQFQTKVLIDRNDFIKAVKTASLFSKTGLFDVALSIKPEQNLIEVSATDATRGANTTAASAD-VSGQANSVTVNYRYLLDGLQAIRSDQVIFEMIDASNPCLLTPKDETDYRYVVMPIK.. 377
133 0.000e+00UniRef50_I0I6B4 Beta sliding clamp n=3 Tax=Chloroflexi TaxID=200795 RepID=I0I6B4_CALAS  ali  31  1..........................MPILGNILIEANDNQLRLAATNLEIGVICWIDA--------RVEDTGAITVPARLLTEFVNSLPPERIDMELVRTQTLHLRCASVEANLKGIDAANFPIIPTFEAALQIELGSAGLRKMIDQVVFAASTDESRPTLTGVEVTFKEGRLTMAATDGYRLSVRSAAVEGRLPATPVTVIVPARSLSELARISADADEPVQVFVTQNQILFQFQRVELVSQLIDARFPDYRAIIPKTYNTRTVVDTAALLKAVRVAYLFARDNA-NIVRIKIVNPGHVSLAATSAEMGDSVNELDA-MVEGEDLEISFNAKYLIDVLSQIEEPQVVIETTQPTRPGMIRPVGEDEFLHVVMPM... 372
134 0.000e+00UniRef50_A0A0S4NEY9 Beta sliding clamp n=3 Tax=Candidatus Kryptobacter tengchongensis TaxID=1643429 RepID=A0A0S4NEY9_9BACT  ali  26  1MRFLISSDRLKSALAKVSAVVPSKTTLPILQDILFELKGNILYLTATDLEISVRITID-------PVDGEEDGAVAIPEDKLTSVIKALPEGLLKFETVDSDRVLITTNKGEYKMSAEPADSFPAIPESIDKTGVTISGEILKEIIEDTVFATSKEELRPATMGVLFQFRENEFVAVATDGYRLVKITRKADLRGKADSSGVIVPAKTLQIIAKSIED-EDTCEISINEKHIQFSTENITIISRLIDEKYPNYESVIPYENNKELVVERDLFLSTVRRVAIFAN-STTNQIKFALNPEGYIEVSAEDIDFGSAKETLNC-TYNGEPMEIAFNAKFITDILGHLDSDRVLFKFGSPTRAAIVQPAEDREVLMLVMPMR.. 378
135 0.000e+00UniRef50_A0A1F7R643 Beta sliding clamp n=1 Tax=Candidatus Saccharibacteria bacterium RIFCSPLOWO2_01_FULL_49_22 TaxID=1802147 RepID=A0A1F7R643_9BACT :  ali  26  1MKLQVTQENLSRALNTVGRVASTRATLPILANVLIKTDKNRVSVSASNLDIAITHRI--------GGKVEKNGAITVPARLTQDFVSNLPDSVLKLDLNK-HKLSIVTDKYQSVVNGMPADDFPVMPAISGGTKWRLPATEFKKALSQVVVAASNDDARPVLTGVYFYSRGGEVIAVATDSYRLAENKL----GKASKSINFLVPAGAINDVLRIISDSDKEVVITHDDQQVSFEIGDVSLVARLVEGNYPDYRKLMPAKFAVTAKMKRSDFANITKVSSLFARESAGGVTIKVDKAEKAVSINAIASQLGENTAAASAE-VTGNG-EVTLNSRYLIEALGAIYGDEVEFCFNGKLEPCILRSPHEPGYTHLIMPLRS. 363
136 0.000e+00UniRef50_A0A1V4MND6 Beta sliding clamp n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MND6_9DELT  ali  25  3.KFSVKKNDFLNPLSKIQTIIDKKTSMTIINNVLIYTDENYLFVEATDLEISYKSKIPC--------LVTEQGAITINARKFYEIVKEFPSEEIFFEEYKDTWLKIGAEKAEYKIGGIAPDDFPKFRHVSEENAVDLESSIIREMIEKTIFSSSYDDRKYSLSGIYFEEKKSQIRMVSSDGHRLSLMEKYITEKGLRLEEGVIIPKKGAQEIRKIIEGHERIVW-GFDNNFCFVKCNNDHLVVRLVEGKFPDYRNIIPKSRDRYLTFNRLEVFNALKRISIFSSDTTFRGVK-ATVTPELIEIESLYKEIGEAKETISID-YSGEPFEIAFNAKYLMDALSVMDSDRVELTANNSESPCLLTGKEDIGFLGLIMPM... 372
137 0.000e+00UniRef50_A0A0P1CZN3 Beta sliding clamp n=32 Tax=root TaxID=1 RepID=A0A0P1CZN3_9NEIS  ali  27  4..LETQRDNLLKPIQAVTGIVERKHTLPILANVLLESHAGKIRVLATDLEIQIHTQ-GAESEHGDF-------RLTTNAKKLQDILKALPDANVQLDWAD-HRLTLKSGKSRFNLQTLPAEDFPTMNVGDTTTAFALPQETLKHMISQVQYSMAVQDIRFYLNGLLLQVEGNQLRLVATDGHRLAFASTTIDTDLPKQD--VILPRKTVLEWNKLLNQPKENVIIELLDRQVRLRCNDTVVVSKVIDGKFPDYNRVIPMDNNRIVVLNRLALLGALERSSILANE-KFRGVRLQ-LSAGSLRVSCTNNEQ-EEAVEELELAYQGESLETSFNISFLLDMLRALSDEDVQIAFGTATQSTLFTLPEQPNFKYVAMPMR.. 366
138 0.000e+00UniRef50_A0A2I0NA86 Beta sliding clamp n=1 Tax=Tenericutes bacterium HGW-Tenericutes-4 TaxID=2013847 RepID=A0A2I0NA86_9BACT  ali  34  2MKVFCQGLDLSDAILKVIKASSTRTTNPILEGVKIIAEDNTITLIATDGELAIEKRIVAD--------VKVEGETVIPGKFFSEYVRKLATEQIELTLNEKNQLKIKYTDSEVFIQCMNVLEFPNIQKIESKEYFEIKKTDLKDIIQKTIFSVSLEDTRPVLKGCLFEVSENKLTSVALDGYRLALAEKPIKSTT--AKVNLIIPGRSLNEMSKLLDESSETVKVYMQKNYVMLEQDSTKITTRLLDGEFINYKQIIPNNFTSTVTVNRLQLEDALERASILARVSNDNSVKFN-IKDNTLNLQARS-EIGNVDENLTIV-LNGNDLSISFDARFFKECLRVSSDEFLKLCFTTSINPCIVKPNEGNDYLFLILPLK.. 365
139 0.000e+00UniRef50_A0A2M8PXX0 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PXX0_9CHLR  ali  24  1MQVSVLQEHLAKGLDTIARAVANRPSIPILSNVLIATEDGRLKLCATNLELAITARLGAQ--------VDANGETTVPARLLTDLVKSLPSQQIDLRL-EGNKLKLHCNGSHWELPTTRASDFPNIPELPERPSAVVPADVLSKLIDQVVFSAAKEDNRPVLMGVLTRFEGPRASMIAADGYRMAMRRAELNAPVNEA-LTLLIPATSLSEVARIIRSEDGDVHIAVGRNQAIFHHKNVDIVSQLIDGKFPEVEQLIPKQAATSTRLDLPDFLAVCKRAEIFARD-ANGITRFKISTSGEVLVSAQASSGGGGSERLPAE-VTGKDIDIAFNVRYLIEVLSVLETKRFVLETNNANAPGVVRPVTDPSFVYLVMPM... 371
140 0.000e+00UniRef50_L8LU54 Beta sliding clamp n=1 Tax=Gloeocapsa sp. PCC 73106 TaxID=102232 RepID=L8LU54_9CHRO  ali  30  1MKIICSKNEFNSNLGLVSRIVPSRPTHPILANVLLIADEKKLTLTSFDLSMSISTHFPAE--------ISHEGKITLPAKLLTDIVSRLPEGEIMMDLEDNPLFTITSASGRFQIRSMGAEEYPELPVVEGEN-LNLPVSTLMQGFKSAAFAASPDETKQVLTGLHLQKTSTNLEFAATDGHRLAVGVQELDSF--ETEFSMTIPVRAFRELERLLNNADENVELYLEETQVAFEFSSFRLTSRKLEGTYPAYHKLIPEKFSRQVTVDRKLLLRGLELMAVLA-DQRSNLVKFTIDTKEKVILQVEAPDLGNAKESLPAE-ITGDHLDIGFNVKYLIDGLKAFNCTDIQIQLNEANQPVIFSPLGGNKITYLVMPV... 373
141 0.000e+00UniRef50_A0A2D6YSP2 Beta sliding clamp n=7 Tax=Planctomycetes TaxID=203682 RepID=A0A2D6YSP2_9BACT  ali  27  52MKLVCSRDALAEALXIAGSVVISRTPAPVLLCLKLEAKDGLLHISATDTEIGL-------LLGVAEVDVREEGVALIPADKLNQIVRASSDDSLSIEVSKN-IATITGRDSKFKVFGFDPGEFPGVPTFEDEHEFEIGAGTLRRLIGRTVFATAVENSRYAINGVLIERTGRHLRLVATDGRRLAVARGECVTGAEEDLTS-IVPTKALNVLNRLINDPDEPVRVLRDRNQILFQVGSGVLSSNLVEGSFPPFEDVIPKDQDKKVNFKTVELASAVRRAALLTNEE-SKGVRLA-FAEDGLTLSSRAPEMGEAEIKVGSEAYAGDPIEIGFNPSYLTEGLKHADSEMILIELKAPNKPGVIKV--GSDFTYVVMPV... 418
142 0.000e+00UniRef50_A0A2M7RC49 Beta sliding clamp n=14 Tax=root TaxID=1 RepID=A0A2M7RC49_9BACT  ali  24  1MKVILLAENLQRKISFLNHVVPSRSQLPILSNVLLEAEKGKLKISATDLELGMVTLVSA--------NVGEEGAITVPAKIFSDLSLNIKEGKISIETSGTNIL-LKAPGVEATLQTMPSEEFPKIYKEKGDIFIKIKKEVLEKEVSRIAFSAAQDGGRPSLSGVLVRQDKDGLTMVATDGYRLSLRRNLAVLSGKDQSSSVLVPAKVFKELL-AIKEDEDDVTVSISKNQIIFSQGETVLVGRLIEAEYPPFEKILPTSHSTTVSFERAKLLSAVKICSVFARDTA-NIVKFS-IGKNKMVVSANTPSVGENKADVEAKT-EGEENEIAFNARYLLDLLGNIDDEDLVFEMTGPLNPGVFKIKDNPYFLHLIMPIR.. 366
143 0.000e+00UniRef50_A0A1J5IZ32 Beta sliding clamp n=1 Tax=Zetaproteobacteria bacterium CG2_30_46_52 TaxID=1805429 RepID=A0A1J5IZ32_9PROT  ali  27  1MHLKISRAHLFHQIQRCQNIVEKRNTNPILVNILFETVSNGLKLTATDL--------QATYSSTQEAEILEPGKLTVDAKKIFEIVRELPEQMIELKTKPNF-LEIFSGGVKFEIAAKSADEFPSEPTDETDLSISLPGSELIRMIGSTSFAMSNDETRKYLTGSLFEVSPEHIRIVTTDGHRMALSEFNIANLQ--QSASCILPKKAVMELKRLAEEAEENIQLSLGQHQVRIELNQQRFTSKVIDAKYPVYQDVIPQSNPHTALVDKNLLDQALRRSMVVSND-FTHDVKL-IFTDNNLSIAAHNTEQEQAEEDM-VIAYEGTTIEVGFNAKYMRDVLAAVSSQNVRIVLKDSLSPALLLEEGHELSKHVLMPMR.. 365
144 0.000e+00UniRef50_A0A0G0NE71 Beta sliding clamp n=4 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0NE71_9BACT  ali  27  1MEVVVLQEDILKGLMSVSRFVSTRVQLPILSNILIVADKNTLRLAATNLEMGISYKLGAK--------IEEEGAITIPSKVISELMSNLPAGKVRLKADKG-QLTVTSNSSSANLSGISASEFPEVPETAEKIDFTINKEILDTINKQVVFSASRDDSRPILSGVLFSINQDGLRAVSTDGFRLSCKDIQ-KNKKIDMDQTVLMPARLIEEVAKLISNSEEEIGVSVGEKQLIFTTSTATLTGRLIEGDFPDYKRIIPKSTTITARFSKDDLVRAVKITSVIARES-SGVVRLK-IEKDKLTVFTENPSFGCQEASLDA-KVEGGEVETAFNYKYLLEFLNSATGSEIVFSTNGSTASGVFKDSTDESYLHLIMPIR.. 366
145 0.000e+00UniRef50_A0A2M6X8Q3 Beta sliding clamp n=1 Tax=bacterium (Candidatus Torokbacteria) CG09_land_8_20_14_0_10_42_11 TaxID=2014298 RepID=A0A2M6X8Q3_9BACT  ali  26  10MKIICTQENLNKGLSTVNKLAIPNANLPILNNILLETKNGSLRLASTNLETGISYFV--------RGKVVNEGRITIAAALLANYIGSLASDKVTLTLGDDG-LKIETAGDRAIIRGLPAEDFPLIDKMKKGVMFSVSEAILRNGLSSVSFAAAQDELRPEISGVFFNFKKRSLILAATDSYRLAEKKVGLAAE-GKTDLKAIIPFRAVAELLHILENREENVEIFFTDNQVLFQFREIGFTARLVEGQYPDYKQIIPQKMTTHVKAGGREFSQAAKRASLFASRE-TNDIRLKIPGKNEVLISAESAAVGANQSRLDAE-VSGEPQEITYNHRYFLEGLNNLAAESALFETSGPDEPGIFRPGGGSDFLYLIMPIR.. 380
146 0.000e+00UniRef50_A0A1F9DW83 Beta sliding clamp n=5 Tax=Bacteria TaxID=2 RepID=A0A1F9DW83_9DELT  ali  26  9.RFQIEKGVLLLGIQRAQGVTEKRSTAPIFSNVLLEGTKGQISIVATDLEIGIKGTYPA--------RVHSXXGIAVSGKKLHEIIRELPEGEVDISVEDGKFLTIKSGNSFFKVAGSNKEDFPAFPEMSEESMVTIDSSIYREMIKKTLFAVADAEARQVLNGALLEIEKEKIRMVATDGHRMALCERWVE--ISQTAKQIILPKKTLLELRKFL-EVNERIKTGVGEKQISFKGEDVYLTSRLIEGNYPNYKQVIPPKGEQTVRINRTQFSGVVRRVSVMSRE-KTRAILIEFLAGKAI-FRARDPEIGEASEDIGID-YKGPGLTIGLNYQYLLDALESMEDEEVMMEMQSSLSPCVLKQESDPNSLSIVMPMR.. 387
147 0.000e+00UniRef50_A0A0N8KPT9 Beta sliding clamp n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A0N8KPT9_9CYAN  ali  27  1MKLVCTQGELNTHLSLTIHAVPSRPTHPVLANVRLDAEQQQIRLTAFDLSLGIRTSFPAQ--------VESSGDVALPAKLLNDIVSRLPDGELTLAQDDDSQTTLTSLSGTYKVQGMSVEEFPELPAIEDGKVIQLDSESLLEGLRGTLFATSSDETKQVLTGVHLAVRADGIEFAATDGHRLAVVEAPAMNLEEGEVFEVTVPAQALRELERTIGKAATPLTLSIDEGQAVFEVEDRRLTSRTLDGAYPAYRQLIPRQFDNQANLDRRALLSALERIAVIA-DRKNNIVKFSFDSAGQVTLGVDAADVGSGSECLPAQ-ISGDSLEIAFNVKYVMESLRNLQSTEIQLQLNSATSPVILTPLGGTKMIHLVMPV... 378
148 0.000e+00UniRef50_A0A1F9HP84 Beta sliding clamp n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_46_8 TaxID=1797879 RepID=A0A1F9HP84_9DELT  ali  29  1MRFSVLKENLYNGLSVVSSITSKNLTLPILQNVKMVAGQGSVEFSTTNLEIGIRYKV--------RGKVDEPGEMTVPARVFLEIVNTLPNERVDCRSEENT-LHAECANSKTALRGVAAEEFPVIPTLSDGIEISCEAKECVDALEQILFSVASDESRPEIHGVYANAEKETLTLASTDGFRLSERQVSLVGGVGDRQIMKIIPSRTLQELERLVGGENGAVQWVIGENQLLLRYGNGEIVSRVIEGKYPDYRQVIPSAHKTTVTVATKELLQLVRGAGLFCRSGMNDVRCYFSPEQKELRVRAANTQIGEYDAAVSAQ-VAGEENDIALNYRFFLDGLAALKSDLVVLEMTEKNNPIVLKAAEGKKYLHLIMPIK.. 370
149 0.000e+00UniRef50_A0A251X7P6 Beta sliding clamp n=3 Tax=Thiotrichales TaxID=72273 RepID=A0A251X7P6_9GAMM  ali  26  1MHFSIPRKELLTPLKMAVSVVEQRQVIPILSNVLVSVENDVLSLIATDSEVEILCRVPLESRIST----EDDGDITIPAKKFLEICRSLPEQAIDVNTDGD-RVVIRAGRSRFTLATLPAEDFPSSSENPDMLTISVPQRQLRELIAQTAFCAAVNDVRYYLNGLLFDLMPNQLAVVATDGHRLALATTDFELGDSD-PLQVIIPRKAXXXXXXXXXXXXXXXXXXXXXTHVRFEIENLTITSKLIDGRFPEYQGVLPRNPDKVVVALCDPLKQALARVAILSNE-KHKGVRL-MVKPGTLSLSARNPEQEEAEEELEID-YDGEAFEIGFNVTYLTDTLNAISTEEVELCFSDPNSSCLVKPRHTEQQRYVIMPMR.. 369
150 0.000e+00UniRef50_A0A174QZN5 Beta sliding clamp n=29 Tax=Clostridiales TaxID=186802 RepID=A0A174QZN5_9FIRM  ali  33  1MKIICSKSNLLKSVNISLKAVPSKTTMPILECILMDATTNQIKFTTNDMELGIETIVD--------GHIEEKGMVALDAKIFYEIIRRLPDNDVTITTDSNFVATITCEKAKFTIPGKAGEDFAYLPVIEKDESLTLSQFTLKEMIRQTIFSIAVNENNRLMTGELFEIKDNCLKIVSLDGHRISIRKMPLKKEYSD--RKIVVPGKTLSEISKILSGEDDQVSIYFTKNHILFEFDQTMVVSRLIEGEYFRIDQMLSSDYDTKVSVNKKEFLDCIDRATLLVREGDKKPIVIE-IKDNSMELKIDSA-MGSMNEEIDIEK-DGKDILIGFNPKFLIDALKVIDDEVIHMYLMNPKAPCFIRD-DEENYTYLILPV... 363
151 0.000e+00UniRef50_D4S3T0 Beta sliding clamp n=34 Tax=Selenomonadaceae TaxID=1843491 RepID=D4S3T0_9FIRM  ali  34  1MNISLAKNDLISALQIVSKGLSTKPQTPILSGIYMTAKEGQLELQTTNYELGFILTIPAE--------IHNTGTAVLPGKYLTEFARKLPAEEVSIDTDSDGLAVIQSGAARFTLRTMEISDFPVLHHMDGTLHFTIKDRTLARLVKKSAFACLREEQRPIFTGCQLEVEGKEITFAATNVHRLAVKSEQLEEDAGQ--IRVIIPAKFLEEVTRTISEVPADIHVTCSYNQVSMSSGSIYMTARLIEGTFPDYRRVIPREENTKVTLDAASFASAVDRASLIARADQYNIVKLS-FTQGLMRISSNSPEIGEAEETIPAE-VTGDDVTIAFNASYLMDALKSLDSDTCILSLQGSNSPMTIREEADPNYIYVVTPVRTH 380
152 0.000e+00UniRef50_A0A2E9WM43 Beta sliding clamp n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E9WM43_9PLAN  ali  26  2..............QTLRGAVSAKTTLPILENVLLDCRSDRIEMSATDLEVGIRT--------IAYGDVEEPGILTIPARKLAEVTRELPEEDVTFTVSDGSQVLIECADVTYLMFGLPADDFPRIPELGEG-YITLDAAVVGQMIDSVRTAVSTESARYSLNGVYIDVSPEWLRMVATDSRRLAIANLDAPGLV-ESRRSAILPTRAAEGVLRAFVDTKE-VRLALMENQAVFSDGEITLTGRLIDGEFPAYERIIPRHNPIHVVAGREEFLTAVRRVSLFS-DPRTLSVRLD-IADHSITLSAHSEDFGEAREAIDAVVP--ERITLGFNAKYLTDALSSMDSEQVRMELKEPLDATVFRPVDGDDYAHLIMPMR.. 349
153 0.000e+00UniRef50_A0A090EAE8 Beta sliding clamp n=3 Tax=Rhizobiales TaxID=356 RepID=A0A090EAE8_MESPL  ali  25  1MKFTVEASAISGALAVASKIVERRNTIPILSNAFFDATADRLLIRCTDLDLELSLTVPAK--------VSDAGQTTVPAHLLSDMMRKIPAGEASFEID--QQMVVKAGRSNFKMHVLPAEDFPVMGGADYSHTIEMSGEQLYKLFSSVQFAISTEETRYYLNGIFFHARAGTLRAVATDGHRLAKMEMPMPAEADGMPA-VIVPRKTVAEIVRLSQTADQKVILDVSDTKIRFTAGRNVIVSKLIDGTYPEYDRVIPAVGNKIAKVDAKTLAVAADRVATISSE-RGRAVRFQV-TAGDLTLSVINPDAGDAQDSIDID-YDAEPLEIGFNSKYLLDALNALPGKTARISLTDAGSPARFTEDSDETFLVVLMPMR.. 370
154 0.000e+00UniRef50_G5F295 Beta sliding clamp n=25 Tax=Bacteria TaxID=2 RepID=G5F295_9ACTN  ali  28  1MKFSVSQSALAGALAVVSKGMASNSTLPILSGVYIKAEEGVLEFQTTNLTISIRHKIQA--------NVEEAGATVLSGKILSNIVKTLPDSAVSFE-GAGHTVLISCEKSKFRLNTLEVGDFPEFPDLSPDRSIELPSGLLSQMVDKVYKVTSKDSSRPILSGILLSVEENTIRLVATDSYRLAVCDSNTETSSVDEAFVAIVPGNTFHDVL-TLPSMTEEVMVGITDSQVVFSFGNTTYVSRKIDGTFPNYRQLLPPSCTTSVRIDVPQFAAALKRVSVIA--LANPSVRFDIDADGKLKLSASSPDQGESTELLPVE-VEGEGMAIALNYHYVFDCVNAATGDSITLELQSAMQPGIFKSYSKINYLYLLMPVR.. 366
155 0.000e+00UniRef50_UPI000C07BAD7 DNA polymerase III subunit beta n=1 Tax=Neglecta sp. Marseille-P3890 TaxID=2014781 RepID=UPI000C07BAD7  ali  33  1MKFTVNKKEITDAVLNIQRAVSTKTSIPVLEGILIKTGELSVEMSAYDLELGIKTVIAATG--------IQEGTTVLSAKLFSEIVRKSPAEIITVEVDEKHMATIVSGHSNFSIIGFLPEEFPELPKLEDSTIFNLPSKMLKSMIRQTSFAIAESDAKPIHQGGLFNIQDGRLDMVAVDGYRLAKRSELIDF---KDELSFVIPGKTLREVNSLLKDEDDLIEIAAGKRHVLFKIGNYTVTSSLLEGDFLNYKATIPTETGIEVIVNTRKVIESVERVSLLITDRLKSPLR-CTFEDDSIKLLCTTA-MGRASDQIEA-SIQGENIEIGFNSRYLLDALKNTECDEIKIQLNTALSPMKIVPKEGDSFLFLVLPVK.. 363
156 0.000e+00UniRef50_A0A101V7Y5 Beta sliding clamp n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A101V7Y5_9FIRM  ali  31  1MKFSIDTGNLLQAAQIVSRAVASKTTIPALTGIYLETNKNTLLLKATDLEIGIEHTVEA--------NIEEIGSMVVPAKYLIDILRKLPNTEITLTTTEDNNLTINYNQSQLSLNTFPTEQFSFLPNISNTHTITINNELFSNMIKKVSISFSHDITRPVLNGALFEVGDHKLTLVSSDTYRLSLIETGLDKDLEEDLKPIIIPAKALMELGRLI-DKEESIKIIIDNNQAQFENDSIKIRVRLIDGKFPAYQNVIPNEYSTKIIADTKELLLSIERATVISSDENFNTIKLEV-NDNIIHIRSYSPNIGQLNDTLIADK-EGEDINISFNGNYLIDILKIIDTDKVIIELNGNLSPGIIKPESNMNYLSLILPVRS. 373
157 0.000e+00UniRef50_A0A1V4MCG8 Beta sliding clamp n=1 Tax=delta proteobacterium MLS_D TaxID=1775673 RepID=A0A1V4MCG8_9DELT  ali  24  1MDFSVDRNVFQEAVQRTLGIVERKTTIPILSNILIRADSTSIRIVATDREIGLVADYEAQ--------VSEKGDITVNARKLYEMIREMEGEQIHFTTSGNNQAFLAAEKAEYRIPGIPADDFPDVRREDTIPCFTIPARLLKGIIKKVFYAASTDETRPSLNGIFFKKEGTICEMVATDGHRLSLVAQALPEEKDDSVEGVIIPRKGLGEVRKMVDDGEGVVEMGVADHVMVVRKDTSMLRLGLIDAVYPDYRRVVPKDRGASVLIEKHRFLQSLRRMGVMSTELFSGVI--ISLDKGIMKLNSTNPDVGEANEEVPVDYNDG-SISAGFNVRYLIEAVDSMEGETISFEMRSDGGPGVMRVKGTDDHLCIIMPIK.. 368
158 0.000e+00UniRef50_A0A2E0L7U5 Beta sliding clamp n=2 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L7U5_9CHLR  ali  31  1MRVSVRQENLAKGLSIVGRAVENRPTLPVLSNVLLNAEDARLKLAAMDMSMSITCWIGAK--------VDEPGAITLPKNTLADLVNNLSPERVDLTLDKTHQVNVRCGTTVSNIKGIDSSEFPLLPEDGGGDVI-VSGRTLKDMINQTVFATAKEDNRPILTGIYTELNGNTLTMAAADGYRLAVRTSEIEANFPE-SFSMVIPGRALAEVARIISEEDDEIGITLDRDMVLFHLKNVLVSSQLLEGRFPDFGGVIPKNYITQTVVYTSDLLRACKRAAIFARDSAGSAQILIKPEPGEVVIAGRSNERGDNTGMVDA-SVEGEGLDVSLNVEYLIDVLNVIPDERVILQSNGATSPSVLRPENRDDFIHVIMPM... 375
159 0.000e+00UniRef50_R7KLZ0 Beta sliding clamp n=1 Tax=Sutterella sp. CAG:521 TaxID=1262977 RepID=R7KLZ0_9BURK  ali  25  4..IKSPREAFATPVQAVSGIVGKRQTLPILSNILISKVGTRVDFTATDLDIEIKTFADIGAEGPDI-------SVTVDAAKLQSLISALNHGEVTLSSQSDPTVELKQGKSTFKLNTLPADEFPNRPEAQFTQSFAIPANQIRHLLQLVHFSMAQQDIRYFLNGMLLSVEGDVIRVVTTDGHRLAYCEGKLESALT-QNIQCIVPRRTVMEMLRLIPDSDESITIAISEAEIRITWGNITLSSKLVEGKFPDYNRVIPVNNTNIFVIKRDVLLGALKRTAILAN-AKLRGVKWE-LKNNTLTIQSTNSDQEEAKDVLDIE-YNGIDIEIGFNLLYLQDVLNNLRSEEVQFALHSNTGAMLVTMPDNSSFKYVVMPMRT. 372
160 0.000e+00UniRef50_V5RTH3 Beta sliding clamp n=20 Tax=root TaxID=1 RepID=V5RTH3_9BACT  ali  27  1MKFSCLQENLNKGLQIITRAVPAKGSLPILSNVLISTDNGRIKLAATNLETAITTYVNA--------SIDKEGSITVPAKVLKELVANLHPSTIEIKM-DNDILHLKSDNTKSKLNGTDAKDYPELPSIKDETSLELDPTVFAQAVSMVTFASSMDESRPIFTGVFITYEKGKMVLAATDGFRLSEKSISV-GKSDAKKFTALIPAKTLAEVSKVFASSTSPLKMILSENEALFSSEDTTIATRIIDGQYPDYKKIIPTIAPVKAVFNAGEFLEAVRLTTVFVKEGTNNTIKLRVDPEGLIKISSLNNETGTHESEIPAET-EGEMLEIAFSSKYLLDFLNNVKGEKINMEASSNSTACIFKTDVTEDFLHIIMPI... 368
161 0.000e+00UniRef50_A0A0S8IDB2 Beta sliding clamp n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8IDB2_9BACT  ali  27  1MKFSIPCSELKTGLQKVISVIPTKTTLPILGHILFEARNGQLTLTTTDLEVTLKTQVQA--------TIESEGSVTIPGRLIFDVVRELPDIPLNIVKDENNRIVLTFSKNKYSFFGEDANNYPKLPAIDVKYEITFDKKKLKRYVEKTVFATSTDELRPALMGVLFQVGENDYKAVSTDGHRL-VKIIDKSFKAQSPIEDVIVPVKALNLLLKNI-EGDEDIKISFAANYIVFDLESASISATLIEGKYPDYDKVIPINEHKKLIIDREKFISSLRTISVLAN-KITQQIKIN-LEPDKIIITSEDMDLGEGIEIIEAE-YTGEQMEIGFNSNYLLDILTHLDSENVIFTFNTSVSATLITQEENEDILMLVMPIK.. 367
162 0.000e+00UniRef50_A0A1M4Y5W6 Beta sliding clamp n=1 Tax=Kaistia soli DSM 19436 TaxID=1122133 RepID=A0A1M4Y5W6_9RHIZ  ali  25  1MQISLPRSALFAALGQVKAVVEKRNTIPILSNVLLRAEKDSFTVVATDLDIEIKVRIE-------GVTPEKAGATTVEAHLLFDIVRKFSDKAISLATADGQKLRVAAERSEFHLQMLPESDYPSITVAPMPDGWLLPAATLARIIAKTEFAISSEETRYYLCGIYWHVRGGMLCAVATDGHRLAKVEITAPPGTEGMP-GVIVPTKTVSRLREMAKGFEGDITFEVSDTKIRATAGGTVLTSKLIDATYPDYARVMPRGNDRLLTADRPSLAAALDRVSTLSSD-KGRAVVLE-LEAGTARLAVNNADHGTAEETLDV-TYEAEPLRIGFNSRYLADVLDCIACDQVQIRLGDAGNPALITNPLDPSVELVIMPMR.. 372
163 0.000e+00UniRef50_A0A2E7UPF5 Beta sliding clamp n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UPF5_9DELT  ali  25  31MELYIERDQLIRGLARVQGVVERRTTNPVLSHVLLSARGDSLQMTATDSALTLVADYPA--------TVENAGELSVDAQRLFQIARTLTDSTVHLSLSKANRLHIRCGKAEFNVVGSSPDDYPPVPTRDERARLVVVGGDLRRLIEETLSSISADDNRYGLNGGHLEQGDSRLRLVTTDGSRLSWSEAPFEGNFGLGER-MLVPRKALGEVRKLVDLDESEWTVSFGQRSAAFSTEGLTLMLRLIDGEFPDYRQVLPSAAKRRVRVQRGPFTAALKRVSIMASD-RNHSVRFA-FDEDRLVMTAHNVDAGDVREELPAD-LEGTPLFTGFNVRYFQDILAATRGDEMVLELGEPLDPCLVRIPDRDDCMFVVMPMR.. 400
164 0.000e+00UniRef50_A0A2E4US24 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E4US24_9GAMM  ali  25  1MNFVTTKEALLKPLQQVAGVIERRQTLPVLANVLVVANDQGVQLTGTDLEVEMTASL--------SMDVHAPGSVTVPARKLLEIWRQLPDGQVSVAVEGD-QVVVRAGRFRSALSTLPVTDYPKPELTVPEISVEVGPKALRKLLDQTAFAMAQQDVRFFLNGMLLEFGSGYLRSVATDGHRLALANVSASVTVGTLK-QIIVPRKGVSELIRLLGEVEQEVRVEVGSSHLRLELAELSFSTKLIDGRFPDYDRVIPRGGDHVALGERIEFAQVLGRISIFSNE-KYRAARLR-FSPGVVMLSANNAEHESAEESCDVE-FDGESTEAGFNSGYLQDVMGALSGRRVRFHLNGS---AVIEDPDVEDALYVIMPMK.. 365
165 0.000e+00UniRef50_UPI0003B4B8B6 DNA polymerase III subunit beta n=1 Tax=Bavariicoccus seileri TaxID=549685 RepID=UPI0003B4B8B6  ali  41  1MKFSINRLAFISILNTVQRAIAQRTTIPILTGLKIDVTREGLWLTGSDADLSIEAHLEV-SDPSVQLLVEKTGAIVLPARFFIDFIKKLSGKMVSLSLEDDNKVSIVSDQARVELFGIDAQNYPHLPQINTEESIELSGALFKQLVNQTIVSVSTQESRPILTGVHFTITKQSVKAVATDAHRLSQRIVKLDESVSDTESNVIVPSKSLVELIRTIED-DEDIRLMISENQILFQTTHFNLYSRLLEGNYPDTDRLIPESSNSVITINSNQLLQATDRASLMAHHEDDNAVKL-TIMDGNVELSSYASEMGNVTEKLECEAVTGENITITFNPDYLKAALKTFDGSDIVLNFIASTRPFYMTPKSEDQFIHLITPIRT. 395
166 0.000e+00UniRef50_A0A163WSN3 Beta sliding clamp n=3 Tax=FCB group TaxID=1783270 RepID=A0A163WSN3_9BACT  ali  27  3.KLLVSQAELLKGLNAVAAAVPPRTNLPALTNILVEAGHDQLKLAATDLDTTI--------TTSVAATVTTPGAVAIPGRKLHEIVRELPEADVHISGTGN-RISINCGESSFIIAGSARDSYPELPSKVDASSTTIPLPVLSSAIRRTSFAVAREDYRPALNGELWKLGPEGLEMVATDGHRLA--RIHLEDVTAPSFFEAIVAPKALGLLARMAE--EGDVSVSFQGTQMSFEFGTTTIFSRTIEGPYPPYEKVIPHDNDKTLTISREDLNSALRRMRIIAN-PATHQVKLS-LESGNILVQAENADAGEAKEKLEGE-YSGEAVQVGFNADFLMEILKNMTGDRIVMKLKNSSSAVVLTPEQGVSHLSLLMPVR.. 365
167 0.000e+00UniRef50_A0A2M9S2I0 Beta sliding clamp n=7 Tax=Rhizobiales TaxID=356 RepID=A0A2M9S2I0_9RHIZ  ali  26  16..FAIERGALLPALAAVNRAVEKRNTIPILGNVLLKVEDGHLCVTGTNLDIEVQAVAKQEGLPTIAP-------FTVQSGLLHDAVKKFADGSVEFE-GDQTHVNIKSGRSRFRLQVLPASDFPEMAVDDFTHEFSIAGSTLARVLATVGFAISTEETRYYLNGVFMHRDGEHLAFVATDGHRLALMKLDAPAGSDGVP-GIIIPRRTVALLQH-FAEGDEDIVLKLSERKMRIVLDGTAITSKLIDGTYPDYQRVIPTSNDKSYTVDRTGLADAINRVSTVSSE-RGRAVKFS-FGQSELKMEVNNPDSGQAEDSIVISEGHDDEVTIGFNHKYCLDVLGAVSAKEMRFELSDPGAPCKVSPAEDDDVLFVIMPMR.. 384
168 0.000e+00UniRef50_A0A1V5U2R8 Beta sliding clamp n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1V5U2R8_9FIRM  ali  33  1MRFFVDTNELNAGISTVVKALPARTTVSILEGIYMKAAGNTLLLRCSDLSIQIETVVAA--------TVEEEGTIVLPGKLFAEMVRKLTGEMTSFDVKKNT-ASIESGRFKTTLQGESGAEFHTMSSVSRDLTVTVKPDALKRMVRGCIFAAAQDDSKPILTGALMEVDGNGVTLVALDGYRLALRRESAIEAKGEAS-NMIIPARSLLEIARVLPDEGGDVSIVFSRTHIMTDVGDTNITARLMEGEFIKYKQILPDSHATRVRVNRKDLLEGIDRVALMARASKSNLIKL-TIADSLVNITANS-EIGRSVEDVEA-SIMGSDIEIAFNARYFTDVLRVLDEEEIFLDMTNNISPCVVRPVQGDGFYYLILPVRIF 366
169 0.000e+00UniRef50_H1XV75 Beta sliding clamp n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XV75_9BACT  ali  27  1MEFTIERSEFLAALQRVINVVPTKTTKEILYNVLLIAEDNQLKIIATDLDIT--------QISWARASVSEEGAVAVLGKLLLDILREMPEIEIKFHVEENFRVQMETSMGHYKLLGEPRTEFPSVPMVDKENSISLPNDKMKKMIERTIFACSTEPARPALTGVLCQIFEEEYRMVATDGHRL-VRFINKNFQNPGFTKQYIVPTKALNFVARNLPE-EGQHQLFISNDHILFELPNTKIYSRLITDPYPDYERVIPDYFQKEMIINREDLIHSVKRVSLFANPMTY-QIRLQ-INPDNVTIMAQDIDFGEASETIPC-RFDYEPLLIAYNANYLLDLLRHMDAEQIRVMVEDADGPGLLFPEEDEDILMLIMPVR.. 368
170 0.000e+00UniRef50_A8DJY7 Beta sliding clamp n=3 Tax=Chloracidobacterium thermophilum TaxID=458033 RepID=A8DJY7_9BACT  ali  27  1MEFSVAKADLLKELSLLNNVVEKKTTIPILSNILLSAASNLLTLAGTDLDATLRTSCPA--------TIRHSGTALLPARRLLDIVRNLPDADIHFKSDGSGNMNITCERSRFRLFSPAPEGYPSLPETP-ALPLSVPAGIMRTMIPRVLFATSQEESRYQLNGVQMVVEGGLLRMVATDGHRLALIERPLPTEKGKHRISFLIPKKTMAEIARLAADTTTEIAFGQDDRHVFFQIGSRLFASRLLAGQFPNYEGVMPRNNNNIIIFETERLVAAFKRVGVVA-DETTHAVKLHA-TEGRVEIMSQSPESGEAVETLSVD-YPGPSITITFNVTYLMDFLTVAHSTQTRFEFKDEITQIQMRPVDGDDYRYVVMPMR.. 390
171 0.000e+00UniRef50_A0A1V5XI70 Beta sliding clamp n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1V5XI70_9FIRM  ali  31  1MNFVCDRVAVTDAVGIVQKAVASRSTLPVLEGILIKASEGRVVLTGNDLEIGIECVIAAD--------VSAPGKVVVNSNLFGTAVRKMTGDTITVKMLPNNAVSIKCGNSEIKLNGINAEEFPEIPKFETEFDIVLSQREFKSLIRHTIFAVGTNEAKLILTGCLLEASGNNVNMVAVDGFRLALKKVVTEESSVSGDVSLVIPAKTLRELNNIIVDRDDKIIIKCSQKNVRFEFDNVVFTSRLLEGDFIEYKKIIPTEFKTKITADLKSLIEAVDRASIIITNEINKSPLIMKISGGEIRILCETG-AGAVDEVVPVE-MTGADIEIGFNNKYLLEALKAAEGDRVNLDFIGPINPCLITPYEGDDFKFIVLPVR.. 370
172 0.000e+00UniRef50_A0A1B3WT51 Beta sliding clamp n=1 Tax=Anaerolineaceae bacterium oral taxon 439 TaxID=1889813 RepID=A0A1B3WT51_9CHLR  ali  26  1MKLSVSQSLLSQALGIVSRSVDTKRLLPILTNILLTTEDGNLRLSATNLELGINYRIPAE--------IASEGSITVPAKTLIDLVNTLPNDVVHLELSDASTLIVRCVQVVTDIKGLDAEDFPPMPVFDPQDAVVFNLPELKKMIQQVAFAAATDETRPMLQGIYLTVNGNELTLVATDGYRIAKRTQSLEN-APDAPISAIIPARALIEVNRIPGDSSDQIYVNLGKNQVIFHQEHVDVASQLISGTYIDYKAIIPRNFKTDTVVSTAALQKACAQAMIIARDSKFFTIRPDAGDDGLIQINAVSEETGTYDNQIPA-TVNGETLNIAFNVRFLRDVLDVVSSPQVMIRTNTNVSPSLITPLDDNDYEYVLMPM... 373
173 0.000e+00UniRef50_UPI00036587B3 DNA polymerase III subunit beta n=2 Tax=Verrucomicrobia TaxID=74201 RepID=UPI00036587B3  ali  28  1MRCEIVRSSFLDALGLAQSVAGGRTTLPILNNVLLEADSGKLSLFASDLQTTLQLHIDAE--------VKEAGRTTLPARRLFAIAKEVTTKEIALTSNEKEESMVMAGSSSFRLFGLPAADYPTPPLLSDSPSFCISQADLVRLLRRTSYAMSSDETRYVLNGVLFCWKEENLTVVATDGKRLALMRSPVSGRTEE-EIQGIVPARAVTELLRILGEEERKVTAWVEPSRLLLQSGEILFSSKLVDGKYPNYRAAIPEGAPEKIYVSREAFLSGLRRVSIVAGEKMVAPIRLR-FENNELELSCSSAEIGEAKEAIPI-RYGGKEIRAGFKAAFLIDPLRESPADEVVLQMGEASGPCVFQ--DEEAFLYVVMPLR.. 365
174 0.000e+00UniRef50_A0A2E2TVI3 Beta sliding clamp n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TVI3_9GAMM  ali  26  1MAFQIARSDLIKPLQVVASAVERRQPLPILSHILMTVKGQMLSLTGTDLEVELVARIPLSSPAAEQQ-------LTVPAKKMLDICKALPDSEITVECDGD-KITLKAGRSKYALTGLNPQEYPQFDEGPGALEFSLPPKKMRALLSQTSFAMAQQDVRYYLNGLLFWVKDNTIRAVATDGHRLATREIETK-MMEGAEQQVIIPRKAVLELSRLLAEESEELGVVLGEHHLRVITPRYSFSAKLIEGKFPDYKQVVPKGQAFEAIVNKDKFKEMLQRVSVLFSD-KYRGISIS-FDSGTMQVKAKNQEQ-EEAEEEIEIEYTGPERRIGFNCSYLLEYLAIVKSPMLKLRFSDPNASVLLEPAEEEGGLYVVMPMR.. 367
175 0.000e+00UniRef50_A0A2M7SK60 Beta sliding clamp n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7SK60_9DELT  ali  29  1MEIIIKRDDLLKVLLKTQGIVEKRNVMSILENVLIDAKTDRMDYAATNLEVGIYGNCEVQT--------IKEGGVVLLAKKTLEIVRELPEEKVSLKLKEGGSIEIVCGKAVFNLIGMDPKEFPSLPTHEDVNLFPVDIDKIREMIKKTIFAASLDEKRHNLNGVFFEKTGKTIRMVATDGHRLSMMEKEIEMEDFKLDKGIIFPRKGLNELKRILEEDKDKVYIGIKDNNCVFKIERLSMVMRLLEGEFPDYRSLIPKDNDKRFVINKSRFINSLRRVSLIS-EERLKPVKF-YISTGKIGLRASNADYGEAYDEMELD-YRGPDLMIAFNAGYFVEALNVLDGEEVLIELKDALSPTVLKSSNSSHISII-MPMR.. 372
176 0.000e+00UniRef50_A0A1V4QPF4 Beta sliding clamp n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4QPF4_9DELT  ali  26  1MKVQIDRDILLQGVTRTQGVIDRRGTMPILGNFLLEAKDDQVNISATDLEVSFRGFYPAQ--------IQEEGKLTIPAVSFFNIIRELPPGTIDLQDTDNANLIIQVCEARYQLMGLAAEQFPPLPTGAELEMVTCKSQLLREMIEKTSFSVSSDDLQYHLSGVYVEIAENKIRMVSTDGHRLSLIDRVVPGDQFGFDDGIIIPRKGVAEIQRLLADGEE-CSIGLDRKNLTLQLDNKFLFIRLLEKKFPDYRRIIPANFGVQFILPRREFFEALKRLSQLSTD-RFKGVILK-FNPDILEIQYVNPEVGEGRERLPATEAPGEPLEIGFNARYLLEPLGVMSSERVVMDINQKDKPCRLQGENEPDYLCIVMPM... 379
177 0.000e+00UniRef50_A0A1W9SCB0 Beta sliding clamp n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SCB0_9RICK  ali  28  1MQFTITHKDLLKSLSHVVPIAERKSTIPILTNIKIEA-GNNLVFTTTNTDIETIETVPAQ--------IIEEGKTTVPAHILYDIARTLTEDEVSFATKDGKMV-ISAGKAKFSLPMLPADDFPMMSGTSLPFKFKISPDDLISLIDKTKFAVSNEETRYYLNGIYLHVVENLLRSSATDGGRLAIYDVPAPEGSKGMP-SVIVPKQVIAELRKFLDSSDKDITVEVSETKTRFLFENATMTSKLIDGKYPNYLAVIPKGNDKKLIVNTAKFKNCVARMSSVSID-KFQAVKM-IIEKDSLTLTANSPEAGTGTEEM-VASYDGETIEILFNYKKLLDMTNQVETEELEFSLANSTAPAIMKEKGNDHFLYVIMPLR.. 367
178 0.000e+00UniRef50_UPI0008343944 DNA polymerase III subunit beta n=1 Tax=Christensenella timonensis TaxID=1816678 RepID=UPI0008343944  ali  35  1MQFTCTKTNLLTAIGTVNRAASKKT---ILECILFSCSEDGITLKATDIALSIKTEMEAQ--------VEKTGDAAIPARLLYEIINRFPDSDVSFSSINENSVEISCLNSKVVLQQMNPDEFPVFPVLEQNEQIKIPQNILKSMINQTIFAAAINEDKPILTGLFFDIGKDSLTIVALDGYRMAVRK---QQAISDIEKNCVIPARTLREVSRIIDDTEENIKISISGNMALFEANHTQIFTRLLEGEYINYRNLLPKDCATSVKVETGMLKDSIERASILAREGSNNVVKFEIREKN-LDITSNS-EMGNIDEKIPVIT-EGNDLKIAFNAKYVLDVLKCVEEPEILMQYNTGVSPCIVKQENSDIYEYLILPV... 361
179 0.000e+00UniRef50_A0A1V5J9R8 Beta sliding clamp n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5J9R8_9DELT  ali  26  1MQININRSILLDGIQKTLGIVEKKTTLPILNNILLKTGKNKLKIIATDREISLISDYEAD--------IKESGEITIAAKKLYEMIREIQGEIVNI-VCSNNITKISCQRAMYKIPGLPAEDFPDVTDERNIQFYNVKGSVMKDLISKTSFAMAMDEMRKNLNGVLLESTENILKMVATDGHRLALTKSVFKEPLLDTGKGIIIPRKGLMEIKKLV-DEEENVKIGLSKNMFVVKTENTVLKVSLVDADYPDYKRVIPTEKGVSIVLDKESFLHALKRMNVVSSE-RYGGVILS-FSEGKLTLNSTNLDVGEATEEIDV-SYSGEEVDVGFNVNYLIDAISVIDREKILMEVGLGIKPSVIKQTEGDDYLCIVMPLK.. 368
180 0.000e+00UniRef50_A0A2G6F818 Beta sliding clamp n=1 Tax=bacterium DOLZORAL124_38_8 TaxID=2044884 RepID=A0A2G6F818_9BACT  ali  28  1MKFSIQQSDILEGLKIVSRAVSTSNTLPVLGNVLIRAAGRKVHFSATNLELSIMTSVEA--------NVQNEGALTVPAKILTSYVSLLPEAELELAVTDGSTLQVKSNTSKTKIKGIAAEEFPEIKSVDVGIKMSIDTDKFRDGIHKVAFAAQENSSRPILSGVFLATNKKELRMAATDTYRLSEKVIELEQEVE--PASCVIPVRAVLEADR-LSGKEESVSLTIAENQIMITVGVTSLMSRLIDGQFPDYKRIIPAKAQTTAKIDRNALEMAVRRVSIFAKQNNQHM-KLQLLSDGQLEIFTDSTEIGEEKTTIPV-SITGATNQIALNSDYVLDVLSALSSEEIQLELDSKMTPAVIKTTKESGFVHLIMPLK.. 366
181 0.000e+00UniRef50_A0A2H0YC82 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium CG08_land_8_20_14_0_20_38_56 TaxID=2014322 RepID=A0A2H0YC82_9BACT  ali  25  1MKFICFQENLKQGLNVIEKIVGKNPSLPVLNNVLIITQKDSIKLCSTDLEIGISCWI--------AGKVEKEGTLCVPVKILSSYINSLPNKKIEINSREN-KLNLKCENYKASIVGFNSEDFPIIPQIKEKEFISLNSFKLCQGFSKVIGAVASSDIKPEISGVFVKLKKDFIKLVSTDSFRLAEKTIFFEKPLS-FEKSVIIPAKTVMEVIRIFGETEQEIDLYLSSNQILFSLPKIHLISRLIEGEYPGYEEIIPKDFLTKVLLERQEFLQHIKIAGLFTT--RTNDIKIKVPAEKSMEFLSSNSDTGENKSEISAQ-IEGEKIEIIFNCKYLMDGLMNIDDEQVILELNGDEKPGVLKPYKKGEYVYIIMPIK.. 371
182 0.000e+00UniRef50_A0A1V5Z3K9 Beta sliding clamp n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5Z3K9_9BACT  ali  27  1MRVQMDQSELLGMLQTVIDAVPSKSTLPILSMMLMAVEEGTCSLSGTDLEVFLTTTRAVQDA--------EDGRITFPGRLMFDFVRELPAGPVTI-TEADGRVTLRSANGECSLLGMPANEFPTVPKIEGGVTISVDGDLLRRMIEKTAFAVHPDQTRPVLSSICWRVNPNGMVMVATDGHRLAKISEVVEGIHGD-PLQVIVAPRVLQQVERLIRDDNKLESITIGERQIHFAYSGANLVTRLVEGKYVDVESVIPKDNNRRLIVSRDEFQPAVRRMQILSSQQ-NHQVRLA-LHKDELELSTVNRDTGEARERIPAQ-YDDEEMEIGYNANYLKEVLSKIDSEQVEFHFREPVSAAIIKPPEGEDYFCLLMPLR.. 369
183 0.000e+00UniRef50_D5C436 Beta sliding clamp n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=D5C436_NITHN  ali  27  1MQFSIEREEIVRHLATVCGVVERRHTLPILFNVLLSVEEDRLSLTATDLEVEIRTTLEVLHP--------KGGKTTVSARKFLDICRALP-ARAELEVQEKGQFHVHSGHSRFTLSTLPAEDFPSTDSLEEVVELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLELGEETVYAVATDGHRLAVASLEKGPRREGVQIQSIIPRKAVLELVRLLEESNEPVRLKFGTNQMGAEFQGLSFSTKLIDGQFPDYKRVIPVGCEKRFVADREQFKQALGRVNILTND-KYRGVRLH-LSNLKLQATVTNLEQ-ESAEEELEVEYQGESFEIAFNNSYLIDVLNIINTEQVKLEFTNANSSCLITPIGEVGSKYVVMPMR.. 366
184 0.000e+00UniRef50_A0A1G2DYA5 Beta sliding clamp n=25 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2DYA5_9BACT  ali  25  1MKLIIPQEKLKQGLNIVERISLKSLTLPILNNILISTEKNFLNLSATDLEIGINWWI--------LGKIEEQGQITIPSRLFFNFISLLPNKNVILEVKNNN-LSIECENYKTQIKGLGAEEFPIIPKITQGESVSIDSPSFCYNLNQVADVAIPSTTRPEISGVYFLFQKNLITIAATDSFRLGEKKIFLKTESPSKEYSLILPQKTVKEIVNIFAEKQGQLRLYFSPNQVMFQYPQVEVISRLIEGEYPNYKEIIPKKYTTQLVLKREEFLNQIKTASLFS--GKINEVRIKVVKEKRINISSQSPDIGQYQSFIDG-KIKGDPIDISFNHRFLLDGLLSVKSSEIIFELNSDSGPGVLRPMGDESYLYVVMPIKS. 375
185 0.000e+00UniRef50_A0A0G1X9Y1 Beta sliding clamp n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1X9Y1_9BACT  ali  30  1MKLEILQENLTKKLGSVTRIIPSKPQLPILSHVLLSAKNNHLTLTSSNLETTIIISLGAK--------IESEGEFTVPARTLSELVASLPPGKITLQVK-QSLLEITISQFHGQINGSPAAEFPPNPTDDLHSVWKVNAAGLFQALGQTMFSSATDESRAVLTGVLFKFDSDFVTLAATDGFRLSVVKVSKSSDLPEGQSQVIIPTRTLVEITKLLNDENDQITINFKSNQVLFSLSDTKIYSQLIAGNFPNFEKIIPAESSVRIKIPSEELLKGIRLAAIFARDSA-NIVKLK-IAGSKLKIMANAAQVGENESEIDIEKGSGEDFQIAFNFRYLLDFLTSLGSKDVTIDFTTPLAPGVFHLPSDKNFLHLIMPVR.. 372
186 0.000e+00UniRef50_A0A2M7V9E5 Beta sliding clamp n=1 Tax=Candidatus Magasanikbacteria bacterium CG_4_10_14_0_2_um_filter_37_12 TaxID=1974637 RepID=A0A2M7V9E5_9  ali  27  1MKFTCTKENLAYSLGLVGGVAQKHANLPILLNILFQARESKVELVATNLEIAVKTSFRAK--------IDKEGSFTIPAKTLLDYVNLLSDEQITIELKDENEVLIFCGSSSTKIKGSSAEDYPVIPEIEEIHGYSIAVESFKKALSQTSVATAKNEIRPELSGVYFDFFSDRLTMAATDSYRLAEKKISI--VQGEDKISCIVPARAVHEIGRLLGETESTVRLWISENQIAVRYDKFEMSGRLVSGIYPDYVQIIPENFKTTTVIPVDDLVKRIKAASLFTAVGV-NAVSFDLNVDHTVGISSTNTQTGEHSSEIDVE-ISGEENSILLNHRYVLDGLQQIDTEAVEFCVNSGDVPCLFRPKGKEGYLYVVMPIR.. 375
187 0.000e+00UniRef50_A0A2N5FPQ3 Beta sliding clamp n=1 Tax=Bacillus sp. UMB0728 TaxID=2066052 RepID=A0A2N5FPQ3_9BACI  ali  45  1MKISIQKEVLERAVSDVYKAISPRVSLPILSGIKITATKQSISLIGSDSNISIEKIVPLEKNGEELASVMKEGSVVINGKFLNEVVKKLPQKDIEITVDSKNVTSLKSGKSQFNLNGFPAEEYPKLPSIEGETDVSLTAEEIQLLVKQTAFAVSTSEVRPVLTGVNLSFK-DVLKIVATDSHRLSSKEMNI---SLKEERQVTIPAKALVELSRIIESNKNNVDVLITDNQVLFKASNLNFYTRLLDGKYPDTSRLIPTESKTQLKLKVRELEQALKRCAVI--EPKNFVVTVE-IKDKQVHITSTVSEIGKVEETLEDFEVTGEDLKISFNYKLVLDALSAFGTEHIQVKFLGEQRPFIFVSEEEQSLIQLVLPVRT. 371
188 0.000e+00UniRef50_A0A0G1K2V1 Beta sliding clamp n=2 Tax=unclassified Microgenomates group TaxID=1794839 RepID=A0A0G1K2V1_9BACT  ali  28  1MKFSVLQENLSKGLTSVSRAIASKAQLPVLGYVLLRAEKGVLNLTTTNLELGMVVPIGVK--------IQTEGAICIPAKVFSELVNELPAGEVFLEVEEQ-RLLIKQGAFKADLAGMAAGEFPTLPTFDRQKLMEFPAEDFLASLKKVIFAAATDDGRPTLTGVCFNFSGEGSQMAATDGFRLSVVKLASDHNETEKIEEAIIPARALAEVVRLASEEEIGDRICVKERQVKFVIGKAELLTRLIDGEYPDYEKILPKDKVATFIGDRETFQRVVRMAAIFARENA-NVVKF-TLEKGAMTISATSQALGANESKIEG-RVEGEDLVVAFNYRYLLDFLTNTTGEEIKIDFSGALSPGLFTDPSVKDFVHVIMPVR.. 375
189 0.000e+00UniRef50_A0A1F4XLA2 Beta sliding clamp n=1 Tax=Candidatus Abawacabacteria bacterium RBG_16_42_10 TaxID=1817814 RepID=A0A1F4XLA2_9BACT  ali  30  1MKFVCSQENLTQALDIVTRAIPTRSTLPVLGNVLIKAEEKKVILSTTNLELAIVTSFDCNP--------EEIGSITIPAKLFSSYCNLLKVEQVTVEQLPLNTLQVKSGQDETVFKGIDAQEFPLIPQVEEKIEFTLPFESILDGLEKTVFASASDETRPVLAGVLFWQKDGILKLVATDSYRLAEKTIKLATKIPE-EIKIIVPSRTVLELQRILSKKQEEVKVIVGQNQVKFIIDNVTVISRLIEGNFPPYEKIIPESFSSDITIEREEFIRAVKRVSLFSQAGTHNL-HLEM-DGGDLTVSGETQEVGKDTSILKG-KMNGEGKKITFSAQFLLAALEHIPEENITLNVNSDTSPGLLKGKE-EGYINIIMP.... 362
190 0.000e+00UniRef50_A0A179D6Q8 Beta sliding clamp n=1 Tax=Thermosulfurimonas dismutans TaxID=999894 RepID=A0A179D6Q8_9BACT  ali  25  1MKAIVDKERLLKVLSRIQAVADKKSSMAILSTVLVEGREEKLTFSATDLEIGYRGTL--------VSDIEGEGAFCLPARKFYEIVKSFPKENVVIETADGEGVVVRDEDLAYRLAVFPAEDFPSLPEISGEAMIDIPGETLEEMIEKTIFAASTEEARYALSGIFVTREDDKLRMVATDGHRLSLIDREVPGVESDLSEGVIVPRKAAQEMKRIAAD-EMVVRIGVRENHFLLASSEGMLMARFIEGQFPDYRAVIPQESGRVVVFDRAKLSEALKRVTLLSTE-KYKVVRFE-FSPGEVVLIGTGGELGEARERLTVA-YEGEPFTINFNARYLLEVFNVMASEEVELDIGSERTPCRITGSKDEGFMALVMPM... 368
191 0.000e+00UniRef50_A0A1C6FK48 Beta sliding clamp n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1C6FK48_9FIRM  ali  36  1MKFECNQQLLTKALNIVSKAVTSRTTIPILKGILLEVEDGKLKMSASDLDITIEETVDIESGIS--------GSIVVQSKLFGDIIRKLPNATVSVELVDTNVV-IKCMNSEFSIIGLSADEFPSIKNIEENQEITFDKTILKEMISKTSFAASVDESKGVITGILIELLNDAINMVAIDGYRMAITR---EAMVNLEEKNVIISAKIMNEISKILSEEEENVNLILNDKKAIFIIGNVKVVLRLLDGEFIKYKDVLPKDNKIKVKVNRNDLMESIERASLLSKEGKNNLIKFA-IKDTIVTITSKSEE-GNVREEVIINK-EGEDLDIGFNAKYVLDVLKSIDDEEIYMFFNTSITPCLVEPVNGDSFEYLILPVR.. 366
192 0.000e+00UniRef50_R5E3X8 Beta sliding clamp n=4 Tax=Proteobacteria TaxID=1224 RepID=R5E3X8_9BURK  ali  25  30.....KKENIFKPIQAVSGVVQRKQPLPVLSNILFVQKGKQVTLVANDLDLQILTVAEIGEENSEM-------STTISARKLTDILATLPDNPLSFSKKGDHVV-LSSGKSKFELQTISAEEFPVITEVDLEHAFTMSCLRFKYLLNMVSFACAVNNVRYFLNGVYICAENNKVRGVATDGHRLALCDVEAEK-TADKKLDAILPRKTVKELVRLIPDSQDPIEVYISERQIKFKFVGIEILSKLVEGRYPDYQRVIPEHNEKEFRVGRQELLSSLQRVATLTAD-KLMGVRWN-LTPGHLNVAANNADMEEAEDEISVE-YSGSPIEIGFNVAYLIEVLNVLKNDSVRISLGEQKNPALIRMPDNDNFKFVVMPMK.. 390
193 0.000e+00UniRef50_A0A1I3MVS1 Beta sliding clamp n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1I3MVS1_9FIRM  ali  31  1MKIKCEKNMLCEAAAVVSRAVSSHSSIPTLEGILLRCSAAGMELFGYDLDTGISTRIDAQ--------ISEPGEIVLPAKVFLDIAKRLDDEFITISTGEKCLTEIKGGKTEFTILGMPADDFPEFPTIGDVTDFELPQATLKSMIDQTIFAVSQSDAKPVHTGSLFELEEGSLSVVSVDGYRLAVRR---ERVAFGGELRFVVPGRALGEVSRVLDEEDDPAGMQISKKHIIFHIGDYQIFSRLLEGEFLDYHAAIPSGESLTVRINTRALIDAVERVSLLISDRIKSPLRVKFYEGG-VDLSCSTA-LGRANDTISAA-IEGKALEMGFNNRYLLDALRAAGCDEVLLQINSPLSPMKVVPTAGDSFVFLVLPVR.. 364
194 0.000e+00UniRef50_A0A2D6NWF4 Beta sliding clamp n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6NWF4_9BACT  ali  28  1MKASCTQENLIKAISAVDKIVASNANLPILGNILFYIDQRRLKVSATNLEIGINFWIGAK--------IEKIGAITIPARILINFVSQLPKRRVDIEVFKNT-LNIKCENHKASINGLPAKDFPIIPKIEEKEQITIRSDVLKQALSQVVSSVALDETRPEIAGVLISLSNDKIKFVGTDSYRLAEKTIKFK---SEQELSFILPSRTVHEVIRILDQTEKQVKITLGENQIMFQSGWMNLVSRLTQGQYPDYEQIIPNKFKSEIIVSRSDFESVIKTTSLFA--GQTSDVKLKISKTGQVEVSAESSDVGKNTSFVDCA-IKGVGVSLVLNSKYLLDGLKNINSEKISLKLNNSGSPVMIGPYSEIDYLYLIMPIK.. 370
195 0.000e+00UniRef50_A0A2H0W5A9 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0W5A9_9BACT  ali  28  1MKISCTQENLNQGLMVVSHIAYKNSNLPILSNILIKVEDKLLTLATTNLEIGVTIQI--------RSKVEKEGEYSVDAKLFSDYVSYLPKERVDLELEDDS-LKIICEKQKTKIKGQSSIEFPLIPKIEKTNPYIVSAKDFKQAISEVVFAVANSEARPEISGVFMGLDSNNIILTATDSYRLAEKKIKLTDNKNTNERKIIVPVKTLNEVSRILGEAIENIEIYLSDNQIMFSYNGIDLVSRLIEGQYPDYTQIIPSEYKTLASLNTKDLIKVVKTSSLFTKNGI-NDVKLDLNKEKEITITSSSSQTGENISKLE-SNITGDDNNMILNFKYLLDGLQNISSNNVILEINNNNSPCVLKPEESDNYIYIIMPIK.. 375
196 0.000e+00UniRef50_A0A1H3PU56 Beta sliding clamp n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3PU56_9CLOT  ali  33  1MRFTIDQKDLMKSLSTVQKGVSSKTTLPVLKGVFVEASENYLKLVTTDLEIGIEHFVSAE--------VEEDGIFVADAKLLSSYIRKLPSRPVTFTVDEQNQLTISCDHISFTLHLLEKEEFPELPIVMAENSFTIPQELFKSMVHQTVFCASQDETKPSLLGLRVELKDQNLRLIGVDGFRLAYRNSPVE---SDLEEGFTIPVKAMNELIQITGDTPSPMQIAFTDKQIVFSLDNTKMISRRIEKAFIEYENILPNEHETRMVLRKDALQSAVDRASLLGSEGKSSLMKWN-LENGELMMFSHT-QTGQMKEKVTVEQ-EGDNMEIAFNARYLMDALRVIEEEEIAIHIINHRSPALIKPVEGDHYLHLVLPVR.. 363
197 0.000e+00UniRef50_A0A1F2XKK2 Beta sliding clamp n=3 Tax=root TaxID=1 RepID=A0A1F2XKK2_9PROT  ali  26  15.HFVTEKASLLKALAHCQGVVERRNTTPILAHVHIEAQGKKIKITATDLEIACIESFAAQ--------VHLSGRTTVSAQLLFDVVRKLPDGEIELKTNEDSMLNLRSGRSKYNFACLPAVDFPFMTTENLSCTFKLHATELAQLIDKTRFSMSMEETRYYLNGICFHATDGYLRAIATDGLRLAQAQVELPEEAKIMP-QVIISRKTIYEIRKLIEEAAEDITISLSENQVRFVVGSSVLISRLIEGKFPDYGKAIPLDNDKVIDINARAFAESVDRISIMSTD-KLRSIKIQV-DSTTLKISAHSSETGNALEELEVA-YKGVPLDFGFNVRYILDVTQQISSGTLEFLVGDETQAIIAKDANDNSALYVLMPMR.. 381
198 0.000e+00UniRef50_R6AWU0 Beta sliding clamp n=1 Tax=Clostridium sp. CAG:138 TaxID=1262775 RepID=R6AWU0_9CLOT  ali  31  1MRFSVNTRELNEAVSVVTKAMPSNATLPILEGIYMYAANDTLFIKCTDLSLQIETEIPA--------IIDDEGSAVLPGKLFSDLVKKFSGDTIDFESDGNT-MNIRSRRVKSSIQIQNADEYPEMMRVDDEFSADIPQNKLKSMIKQVIFSVSNDETKAILNGVCLEFDDNTLVMVALDGFRIAMRKEKINNCTG--KKSVVIPKRAMQEIAAVLSSDDSEVKLIFSSTHIKIDFGGTKVISRLLDGEYVNYKGILPKNFATRVLINCEELKNSTERALLMARESKSNRIKL-MFANNTLTITANS-EKGNINDEIEIQLV-GKDLEIAFNATYIQDVMRVLDDECVYLNMNNAVTPCVIVPVEGEAFYYMILPVRLF 366
199 0.000e+00UniRef50_A0A2G9YDJ9 Beta sliding clamp n=9 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9YDJ9_9BACT  ali  28  1MQIICLQEKLKQSLNITERIIGRNLTLPILNNILINVENNKLKISSTNLEIGINYWL--------TGKVIQGGSITVPARLISDLISNLPNKKIELKVK-NNLLELKCDKFKAVLNGLSANDFPIIPKIKEKPIIKINGAILRNSLAQVVEMVSSSESRPEISGVYMKFDKNLIKLAATDSFRLAEKNIEIKNNQSLRGQTVIIPQRTIQEIIRILSDKESEVEIVLSTGQILFNMEDVQVISRLIEGKYPDYQQIIPSDFKTEAITNREELINNVKLASLFS--GKINNVKLAVPQKSILEITAKDIDIGENNSQIETKII-GNAIEVVFNYRYLLDGLNNIFSDKVILGFNTKTNPIVLKPIGDNSYTYLVMPI... 365
200 0.000e+00UniRef50_A0A1G2B7J8 Beta sliding clamp n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A1G2B7J8_9BACT  ali  25  1MRISCLQENLNKGVSLVSHVASKKANLPILSNILLRAKDGRIELLATNLEIGMKTQV--------RGKVESEGEFTVPAQLIGSYVGLLPNERIDVVLQGSELV-LSSQSSQTKIKGEPSSEFPLIPEIARTNKRVVAAKALLDGLSSVVVAAAIDDSRPELHGVLFQFSPAQLVLAATDSYRLAEANIGL-QGISGEENRIIVPLQTVHELLRILQQDDAEVEIYISDNQVLFVAGDVELTSRLVVGTYPDYKQIIPREYTTEVHVPIAEFVKVIKVASLFAKSGVNDVALAIEPANKQVKVSSVNNQLGENVSSVPISG-TGEKNEVVFNYRFLLDGLNVISADEVSLQVMNNTTAGILRPKGSKGFLYIVMPIK.. 367
201 0.000e+00UniRef50_A8PQB9 Beta sliding clamp n=3 Tax=cellular organisms TaxID=131567 RepID=A8PQB9_9COXI  ali  27  1MQFTINREILLKPLQLVTAVIERRQTLPILSNLLIRLNDRNLSLLGTDMEVELAGRITLEKPG-------QSGTTTAPARKLMDICRSLPEEELKFQQKGD-KLYLQSGRCRFNLSTLPATDFPILDNHPEQAKFVLSPKGLRSLIESTNFAMAHQDVRYFLNGMLWELDRGSLRAVATDGHRLALNVKEANITVDNN--QIIVPRKAIYELSRLLSDEEDSLTIFLTKNQLKVAMQDYTFTSKLIDGTFPDYDRVIPKSGDKIFEIDRDLFKASLLRVSVLSND-KHKSVCLE-LRRNLLRIFANNLEQEDAEDYLDIA-YHGKDISIAFNINYLIDVLNSLPAGPVKITLTSAEASVRLESKEKDAGLYVIMPMR.. 369
202 0.000e+00UniRef50_A0A2H0Y2D4 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium CG08_land_8_20_14_0_20_41_10 TaxID=1974783 RepID=A0A2H0Y2D4_9BA  ali  30  2MKVTCSQKELENALNIVGCAIGSNNTLPVLDNVLLKAEGKKLYLAATDLEIAIECYIDV--------TVKNEGIITIPAKLFSNYISFLKEESIDLSLEAGVALSIKSKSSHTKIKGIAATEFPLIPKIEKEKTIEVPANLLIEGINKTIFACSTNIARPVLAGVSFKTEGKKLILATTDSYRLSESQIGLDKAAEEIT--CIIPAKTMVEVGKVFPKNKEMIIIQLSSNQIVFNQDGIILTSRLIEGQFPDYRPIIPKGIKTKAILNREELIRAFKRVNLFAKENNYN-VKLEIPGENLLNITTESTEIGEEKAMVQAV-VEGEEKTVALNSQYFIDVLINLDKEEVELQIESKLTPAIVISKGEKDYLHLIMPLK.. 367
203 0.000e+00UniRef50_A0A134AL66 Beta sliding clamp n=1 Tax=Peptoniphilus coxii TaxID=755172 RepID=A0A134AL66_9FIRM  ali  33  7.KIQIDKSALVSTVSMVLRAISSKTNMQILEGIYMEAKDGQLILRATDTEISMESR--------HACLVEEEGSIVLNASLFGDIVRKLPSAMVHMES-EGQKLSLNCEQTNFEIMGQNPDEYPQLPELGGSEKIVVTGESLLKAFKETQFATSNDDMRIVLTGVLLDVKQDGITFVALDGYRMAMSKIKGEQEVV---RDLILPARSVSEISKLIDENKTFV-LEIGNNHILIQFDDTKFFTKLLNGEFFQYDSLVRKTHDMELLVERKPFISALERASLMTGKERNGLVKLD-IHDDVIEILSNS-EVGKVHETVKAEK-TGKDLTIAFNARYLLEGIRVIEDDTIKMGFTDAVNPCIITPTDGEDYLYLVLPVR.. 366
204 0.000e+00UniRef50_A0A2H6K578 Beta sliding clamp n=1 Tax=bacterium BMS3Abin01 TaxID=2005709 RepID=A0A2H6K578_9BACT  ali  29  1MRISCPKDLILDKLQTSLKTVATKTTVPVLSGIRMETKGDTVELASTDMELSLRLSLNV--------VVEREGAAVLPGRLVTDIVRSMPVGDVKIDFNEKEQMEITCSSADFKINCLSADDFPRLPSMPAEGAFELEAGPMIETVNTVARAASRDETRPVLTGVLVKFSQDKIKMVATDSYRLSVRETEVKSTVTE-KKEVIVPRASLEELARLCGAGDEKVSVGVAEGQIIFGTTGILLTSRLIEGKFPNYQQLLPDEFKYEVEIDREELMEVVRRVGLMA--QKNAPLRLR-LEEGKLVVSALTPQVGEAQESLPV-PFKGEEMEIGFNPEFLRDGVESVGEEKVVLRLISPLRPGLLKGSSDA-FLYLIMPVR.. 366
205 0.000e+00UniRef50_A0A0K2SFI9 Beta sliding clamp n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SFI9_9FIRM  ali  28  1MQILLEHERFANALAFVERTVASRDTIPALTGILLEAESGGVRLTSTDLEMGATTRVDAE--------VETPGRVLLPGRLLTSIVRRLPGGDVRLTTDGSGVVSLTSGSSRFQIRTMDASDFPDIPTVEGGP-WQVDARVLREGIERTEFAASPEESRPVLNGVLLEVEALRVRAVATDSSRLAYYEMPLAPSTSSSPLRVLVPSRSLAEVMRLLAGLEEPVTLRLSEHHLSFETGSFLFFSRLIEGEFPDYRRVFRSQQVVSCTVDRQAFLDALERVSLVSRKGPA-VVRVRVAPGGRLELESHGAEAGQASEALPVEETEGSGQT-AYQARYLTDVLRVLSCSHVRFAYSEGDHPGTVRPLDEEGYTYVVMPVR.. 390
206 0.000e+00UniRef50_A0A2N5KQ29 Beta sliding clamp n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2N5KQ29_9ACTN  ali  27  1MRAVCNTEMFGKKLALVSRGVSARSTIQLLGGILLEADAGELRLSATDMEISIQTTSPAE--------VGEEGRVVVPARIFNDVVRSLPGGEISLVHDSEGVVRLSSRENEYQIRAYAAEDFPNLPSFDERSAFKMSAEVIVETVEKVSKSYSRDETRPVLTGILVSFEESRVKMVTTDSYRLSIKETELATNGFDGERQAIIPARAMQEVSRISSSGEEGVEVILSENQALFRIGDVLFGTRLIEGNFPEYRRLLPNVFEREISVDREELIGTLRRVNLFAQRQTPPVPVSLAFTEGAVEVSVRNGEVGEAREKLPSNAAGEEEFRISFNPTYLIDGVTAVDSEKVRFKLNESLKPGLIVPEDEPDFLYLIMPMR.. 377
207 0.000e+00UniRef50_A0A2M8KCM2 Beta sliding clamp n=1 Tax=Candidatus Portnoybacteria bacterium CG10_big_fil_rev_8_21_14_0_10_38_18 TaxID=1974813 RepID=A0A2M8KCM  ali  26  1MKIICLQDNFKKGLNIVQNIIGKNLTLPILNNILLNTDKKQLKLSATDLEIAISNHVLCK--------VEKEGGITIPAKTLVNFVSNLPNKKIEITAK-NNVVYLKCENFKSNIKGLDVNDFPIIPKIKSEPVLEIKSMGLKNTLEQVVNFTSFSDIRPEITGVLFDFSEKEIKFVTTDSFRLGEKTISLKNNKKDYQGSVIIPSKTVQELIRIIEDGEETIKISLENNQILFSLPGVQIISKLIEGTYPAYQQLISKQFDTSVLIDKEDLIKAVKLSSFFSS--KINDVRLRIPKKSLIEVFSQDIELGENLSELHA-NIKGKELEVIFNHKYLLDGLNSISAKNIFLGFNGEASPGAIKPEGDESFNYIIMPIK.. 372
208 0.000e+00UniRef50_A0A166MFN5 Beta sliding clamp n=2 Tax=Oleiphilus sp. HI0009 TaxID=1822219 RepID=A0A166MFN5_9GAMM  ali  24  1MEFTIAKNEIINPLQAACGAIENKSNLPVLGNVLINAKGSELSITGSNLEVEMIAVI-------HNVEIKSEGSVTVPAKKLNDICKSFSNDDIKFSLKDGKAL-VRSGKSRFTLTTLPSDQYPNVNLDKNTQNITMQANELKRIIDATSFSMGVQDVRYYLNGLLLDVNGNKIKAVSTDGHRLSISEAEL-TVAVENPVKAIIPRKAISEIAKLLTSGEE-VTLKVSENQATINVDNYTFTTKLIDGTFPNYEQVIPKGGDKSVKADRELLKSVLQRASILSHENI-KGVQL-TVNHNTLNVAANNQSHEQAEENIEVE-YSGDELTIAFNVNYLVDVMSNLKEDDVSITLSNGSSSALIE-ASNTQTTYVLMPMR.. 365
209 0.000e+00UniRef50_A0A2M6R916 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_14 TaxID=1974515 RepID=A0A2M6R916  ali  28  1MHISCMQENLAKGVSAVSRIVGVRSTLPILSNMLLSTDKGRLKIAGTDLEIALVVFIGAK--------VEKEGSITVPARLLADFVSSNQDKTINL-LVENTQITAKSDHVTAHLHGLDAEDFPLIPDVTSDESYQIKPSDLKEVINQVVFATALDETRPVLTGVLCVIHGSTLTLVATDSYRLAERTIPLMKPAPK-DVSCIIPARTLSEVGRLLELSLESVTLTIAQTQVSFSFGNCTLISRILEGTYPDYEQIIPKKATTTAQVSIGALQSALKLASSFSRD-ISHNIRIVFIPDSPTTISATSANMGD-TSNTVEGTTTGETLEIACNAKFILDILAVMPGDSVTIKCAGKVSPLMLIPSSRVDYRTLVMPLK.. 365
210 0.000e+00UniRef50_A0A077AV41 Beta sliding clamp n=3 Tax=Candidatus Paracaedibacteraceae TaxID=1777752 RepID=A0A077AV41_9PROT  ali  28  1MKFAVERGEFLKALTHGGSVVEKRTTVPILSHVLIHAEDGQLNLTTTDMDLALVETIPA--------VVEKPGAITVSAHMVLEIVRKLPEG-VQIEATENDQIALKAGKSRFNISTLPAEQFPKLTQNDLPFSFKLTAEKLRYLIDRSRFAMSTEETRYFLNGIYFHAHEKVLRSVATDAHRLACIEVDIPDGAEAIP-GIIIGRKTITEIRKLINDEETEITISLSPQRVEFKLPQAILSSRLVDGTYPDYEQAIPVGNDKPIIVDAKDFAKAVDRVATVTTD-KLPVIKISV-AKNKLTLVAASSELGDATEEMEVDFPFDQSIEIGFNANYLVDITSQIGDEAAEILLSDGSAPAIIKGINDKEALFVLMPMR.. 374
211 0.000e+00UniRef50_A0A0X8F7T5 Beta sliding clamp n=5 Tax=Aerococcus TaxID=1375 RepID=A0A0X8F7T5_9LACT  ali  40  1MKFTIKKSIFADCLANVQRAISFRTTIPILTGIKLQTNEKGLILTGSDSTLSIENLIE-EKEESNHLSISEPGSVILPSRFLGDIIRKLPEDKITVAVQDNFQTIITSGESVFTLNGTSGKNYPQLPEINSAATFNLPGHLMRQAINYTIISVSSQETRPIFTGIHFELGDNQLKAISTDSHRLSQRIIPIESLKDKEKVELNIPGRALSELSRLVND-NENISMMVTNNQVLFKMNNTSLYSRLLEGTYPDTTRLLTKDQKTSIKVNAAELGAAVERALILSHQGKNNMVKLSMDNSG-VILSGHSSEIGYVKEKINALGFEGENMSISFNPDYLREALKTFGGQDVIIRFTSPSHPFILLPSEDSDMIQLITPIRT. 381
212 0.000e+00UniRef50_A0A1E4ZX29 Beta sliding clamp n=1 Tax=Chromatiales bacterium (ex Bugula neritina AB1) TaxID=1868282 RepID=A0A1E4ZX29_9GAMM  ali  28  1MKFSISKLELFPPLQQVVGVVERKQTHEVMNNILFDAGLDFLELTGTDNEVELRTRIP--------LIVTEPGRSTIPARKLFDICRSLSDDKIDFEVNDE-KAKVVSGKSRFTLATLPVDEFPVVEPLSEPLEVSLSQIDLEKAIKRTSFAMAQQDVRYYLNGLLLELNNNELCCVSTDGHRLALHKTTADVQTPE-PISAIIPRKAINELSRLTDGSDTRINLKLTKNHLQISLGSLVMTCKLIDGTFPDYEKVIPLASDNKALIDRELLMHALTRSAILANE-TYKGVRL-TLENGILGIQTNNPKREEAEDELQVD-YTGEPLEIGFNVVYLLDVLNAIETESAELNVKDNTSSMVIHPSGDDSSTYVVMPMR.. 365
213 0.000e+00UniRef50_A0A1B1Y9S3 Beta sliding clamp n=4 Tax=Ruminiclostridium TaxID=1508657 RepID=A0A1B1Y9S3_CLOSR  ali  33  1MNFSCNKQDLLEAITTVQKAVMSKATLPILEGIYIEA-GDSLKLVGNCFDMGIEYYVNAD--------IKEKGSIVLNSKMFSDIIRGLPDSEVFIHEKENYVVVIECSNSYFEIKGLSPEGYPMLPEIEEKDKITVQQSALKDMIRKTIYAISNDEKNKILTGSLMEASDGEITMVSLDGYRLAIAKTFIKEVVS---FKAIIPGKNLGEIYKVLEQSDEKVKITLSTNQALFEFENCRIISKLIDGEYMNYRSFIPEKFETQVEVNVKEFTKGIERASVIMSEENKYPVKL-IIEGDSMLITS-STKFGISKEQIEVST-NGSNMTIGFNPRFLLDSFRVIEDEKVEIYFSSPVGPCVVKPIESDKFTFMILPVR.. 362
214 0.000e+00UniRef50_A0A2E3XLI0 Beta sliding clamp n=6 Tax=Bacteria TaxID=2 RepID=A0A2E3XLI0_9BACT  ali  28  1MKFRCDRDILVEALNTSNKAVTNRATLPVLNGLHLNLKKDTLVITGSDLDLTITVSLDVAG--------ESDGTSVVPARLLSDVIRSVESGTVDITVDE-TDLQVIAGRSEFSLRTIPADEYPLFEGVNSDP-VTVDASLLVSALEQVTPAASSDDSRPILTGVYMVAEEKGFRLVATDSYRLAVRDMPGSSLLAGQPP-ILVPSRALTELARLL-EKDSEVSLYLGEKEASFEINNIRMTTRLIEGEFPDYKRLVPEDNPNKLTANRGELRDAVKRVRLLAQEAT--PIRLDMGMTG-LQLIAKTQDIGEAHETVDA-NYDGDDLTIAFNAEYLLKGLEIAPGDDITLETMDNQKPAVLKSNEHPEFLYLLMPVR.. 361
215 0.000e+00UniRef50_A0A2H5YAC1 Beta sliding clamp n=1 Tax=bacterium HR23 TaxID=2035418 RepID=A0A2H5YAC1_9BACT  ali  27  1MKVSCLQENLAKALSTVARAVPSRPSEDILLNILLRTEEGRLRLTATNLELAITVWVGAK--------VEEEGGIAVPAQRLRDFVAQLPPERVDLSSVQRPLIQVSCAWLKAMLRGVEAETYPPLPTVKEGTTALVSQKALGRAIEQVAFAAATDESRPILTGIRTELEGERFTMAAADGFRLAVHTGTLAQPV-ETPVGVVVPAKTLKEVANLLEDSEEPVTLHIDGSGILFRLKGVEVYSHLLQGTFPNFRQLIPQSSQTRAVLDCQRLLQTVKAGSAFARTG-SNIVRLEPGTPGKVTVLAGMEEEGSASGELEA-SIEGEPARIAFNSRYLQDVLSVIGGEKVSMGVNTPSSPGVFRPIGGEEYVHVVMPM... 373
216 0.000e+00UniRef50_D5H4G9 Beta sliding clamp n=57 Tax=Bacteria TaxID=2 RepID=D5H4G9_SALRM  ali  25  46MKFTASSADLLEALNTVKGAVPSKSTMPILECILFERDGDTLRLSATDLEISIIQTVPVQFEKNGTP---ESTPIAVPAQRLIDTLRALPDLPIEFAADSDFEIRMDTDQGHYKMVGHDGSDYPELPELEEQHEINVEGGLLGRSIDKTAFAVSQDALRPAMMGVYFQVSEEETSVVATDGHRL--VKLTLPELRADTSADFIVPEKATKLAGRIVED-DEICTVRVDDSHVSFEFGESRVLARLIDETYPNYQSVIPDGNDRNLVVNREDMLNAVKRVGLYSS-SMTNQIRLD-ITADTVTISAEDVESSEAEETIHCD-YDNEPMEIGFNSEYLTEVLSNVECDEVVFELSSPNRAGIVLPADDEDILMLIMPV... 416
217 0.000e+00UniRef50_A0A2E6FAW2 Beta sliding clamp n=45 Tax=Bacteria TaxID=2 RepID=A0A2E6FAW2_9ACTN  ali  31  1MKFRCERDALVEQLGTASRAVSSRGALPVLTGIHLSARDDVLTITGSDLEITVRASVSV--------AVTEPGEAVLPSRLAVDIVRSLDSGAVEVEVSGEE-AKIVGGRSQFSVRTLPVDDFPILAEPSGDE-VTVATADLASGLKQVVRAASGDDARPILTGVLMSAEDGGLRLVATDSYRLAVRDLP-DAIVLSEGQKVLVPSRALEELSRVLGESEE-VTVRLGEREVTFDVGEVQVTTRLIEGEFPNYRQLIPSSYPNQLTIGREPLLEAVRRVKLMARD--TTPLRI-TQKSGCVELMAVTQDVGQAHEEVDAQ-YVGDELTVAFNPDYLIQGLEAAPGDEVVLETLDALKPAVLRSSEGGDFLYLLMPVR.. 366
218 0.000e+00UniRef50_A0A1F7V493 Beta sliding clamp n=3 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A1F7V493_9BACT  ali  28  1MKFNCTQENLHRGLALVSHVASRASTLPILTNILFEATGTSLVLSATNLEIGIRTKV--------RGKVEREGKVVVPARLIDECVALLPKENVVLTLEGD-ALRIQSGSHDNKIHTLPADDFPLLPTIDERIVIDVTPTRLAQVLRVTLFAVSFDDTRPELSGVLIATRGGVLTAAATDSYRLAEKTTELVRASQDIE-GVIIPLRTMQEVARALGEEEGVVKIALGEHQVSFHMEDTLIISRLIDGQYPHYQDIIPPQYESSATVERAVLEQALKAASLFSMTGINDISLTLLPGEGGIRVRAANIHVGENTTVVPA-SVRGKEVEVVVNWKYLSEGLQSFSAETVNLEVNNTQSPMVVKPQGEKGHLYLVMPIR.. 371
219 0.000e+00UniRef50_M9WT95 Beta sliding clamp n=35 Tax=Wolbachieae TaxID=952 RepID=M9WT95_9RICK  ali  28  15MRFSVGRPSLLNTLSRVSGVVERRNAIDVLACINIKAQHGSIKLKATDLDISIFASLAA--------NVSAEGEVKISAHTLHDIVKKLPTDDVHFEMNNQGKLLISCGNANFSLPNVVSNNFPVLEEGDHQYDFTLLSADLVDLLTKTKFAVSLDDTRYNLNGIYLHTDEQFLYCVATDGHRLSRIKRPKPEDISG-EFGVIIPRKTIMELLKVLGDCNE-INIKLSDRKIKFTCGEYVLISKLIDGTFPDYKAVIPTSQDKQMIVESSKLASVIDRVSVVVSD-KIKSIKFS-LQENLLTLHSNSQECSDATESIEVD-YDGALMEVGFNSRYLLDALSCIKN-KCKVSLSDGNSATIITDEDDPSALYIVMPMRT. 379
220 0.000e+00UniRef50_A0A1G1WTH1 Beta sliding clamp n=2 Tax=Candidatus Woykebacteria TaxID=1817899 RepID=A0A1G1WTH1_9BACT  ali  26  1MKADLTKENLTKALSTCMRAVSLKASLPILANICFNTEGPKMKFSATNLELGVNYWSEAKTL--------EEGSISVPARILLEYISSLDVSQISLESKDETLL-ITSDQGEATIAGISSQEFPPVPTLTEQANIFLDPNEFQKAVAQVAFAASTDASRVVLSGVLLHFSPEALLLVATDGYRLAQKKWDRE---TGTEQSVIIPAKSLYEISRIVSEEGEELKIFLNKNQAIFGLDKVHMTTRLLDGNYPNYTQIIPTSFVSRAVVEADKLGKAVRTVSVFARD--SGSVIKADFSSSTLALSAQTTQVGDTKTSLPI-SFEGEPMSVAFNQRFLQEALSAISSTQVSLEMTSPTSPIVVRGVGNESYLHLIMPVR.. 367
221 0.000e+00UniRef50_A0A0G1QTP6 Beta sliding clamp n=4 Tax=candidate division WWE3 TaxID=422282 RepID=A0A0G1QTP6_9BACT  ali  26  1MKFTCLSENLNKGLSTVSKAVPIKSALPVLTNVLLSTHDGRLQLSATNLDMAITTYVGA--------SVVQDGSITIPARILGEFVSHLSPVTLVCHLKGG-VLHVDSERAKSKFNGTAATDFPELPAMPEGAVIELAPKDFAAAVNSVVFSASIDENRPVLTGVFLSLIGDVLTFAGSDGYRLSERVLSVGSTSSD--FSVVVPAKTLSEIARVLGASEDPIKMAISDNLVLFEGGNVLISSRIIDGNFPDHKKIIPAEHTLSAEFASSDLLEAVKLANVFAKKDAGSVVKLTFDPKGKVSVASAREEVGENNTEFLA-TVKGDALELSFNSKYLLDLLNNVKAEKLRFETNGGLSACVLKPAGQQEYLHIIMPMR.. 368
222 0.000e+00UniRef50_A0A1F6CRI8 Beta sliding clamp n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6CRI8_HANXR  ali  29  1MRFTIDQSQLLQALDAVSDVVPSKTAIPVLSHLLVVGAKGHIALSATDLDISITASLSVSLS--------EPGRFTVPARKFIEIVRELPEGPLSIQA-EDHKVTLCSGKSIYILMGLPPEDYPELPAGIEGTLLQFDGNIFKNMISKTAFAVSRDETRPVLNGVLCQIRPEGITMVATDGHRLVRHSKSFDLKKGSEQTEVIIPPRALQHLVKLLSGTNTLTRCVIGENHILFDLDQTKLFSRLIEGPYVDFEQVIPQNNTHRLNVSNSAITPSVRRVSILSN-TQTHQIRLR-LGQHELELSAVSQDVGEARESIPAD-YTGQEMEVGYNSVYLLDILKRIDSEDVVFDLNTPVTAGIVRPPEGEDYLCLLMPLR.. 407
223 0.000e+00UniRef50_M4ZVR3 Beta sliding clamp n=9 Tax=Actinobacteria TaxID=201174 RepID=M4ZVR3_9ACTN  ali  28  1MKFRCERDVLADAVGSAGRAATNRTTLPVLAGVRMEVAGDTLTVTGTDLELTIRLTVEVGG--------EQDGAAVVPARLVGDIVKALPAGAVEISLDDSGEMSISAGRSQFSVRPLSLDDYPA-QTEPSGEAVTLSAETMSDALRQVVRAASTDDARAVLTGVLLASEDEGVRMVATDSYRLAVRDLP-DSTVLGSGQKVLIPGRALNELQRVMGDVEE-LTVRFGEREATFEAGTTRLSTRLIEGEFPNYRNLLPSSYPNLLTVSKASMMEAIRRVKILAQDST--PVRL-TLGGDTVQLTAITQDVGNAAEEIDA-SYDGAEMTVAFNPDYLAAGIDAIDADDVTLATMDPMKPAVLRGAGQEDYLYLLMPVR.. 366
224 0.000e+00UniRef50_A0A0G1ES34 Beta sliding clamp n=12 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1ES34_9BACT  ali  29  1MKFFCTKENINNGLALVGHVATKSTSLPILNNILLKTTPGGLQLTATNLEVAITTII--------RGKTEGEGNITVQGKLLIEAAALLPDDKVEL-LVDNGSLTITCGRSRTVIKGAPAEDFPVIPQINGGNKFIIPTQKLAEAVSRVVFTVNPDEGRPEISGVFLGNVSKKTVLVGTDSYRLAENTL-GESKNIIQPEGLIIPLRTAQEVGRISQSSDEQIEVVLGDNQVLWQIGETQIISRLVSGQYPDYLQIIPKEFSTTAKLNREALQQAVRAASLFVRSGI-NDVRLKFVSDKTVLVSSTNSQLGENTTEVGAE-IDGEETEVIFNYRYLLDGLSVIPGREIKIKVAGPNSPSLFEPKDGTDYRYLIMPIR.. 367
225 0.000e+00UniRef50_A0A2E4W4M2 Beta sliding clamp n=28 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2E4W4M2_9BACT  ali  25  1MELVVRKDDLLPELQLIQGIVERKNTIPILANVLFKAKTNDVEMRATDLEVALFSSCAAK--------VKKSGVVTLPAKTLFEVVRALPETNITIKQQGQNTVMVEAETTKSSMQTLPEEDFPTLAEPKTKQAVKLPGQPLREMIARTKFAITGEDTRYFLNGALFFKDASEMTMVGTDGHRLALVSMKGKSPKNPDVARVIFPKKTLQELSSLLTDNDKEISYQEEENHLFFNVGGRTLISRKVDAQFPAYERVIPKDSDKAVEFERDRLNQAIKRVALLSNE-RSSAVTFK-IGNDVVDITSSRQDVGEASEKIEVE-YGGDSVQICLNAKYVLDFLSIVETDNVRLEFKNETSQAVMQPVGAEGYTYVIMPMR.. 377
226 0.000e+00UniRef50_A0A2A5E765 Beta sliding clamp n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5E765_9BACT  ali  30  1MKISIARQDLQDAVNKVKSVVSSKSALPILSHILMEASDNTLKLSATDLKVSIESTVDCD--------VAESGSMTISSQRLSSIIPELPDENVVLELQDGSIVNLTCGKIHTKLYSMSPDEFPPVRNFDDIEPLVLPKKILADIFNKTSFAICTDQARYNLTGLLLEIKNGTLTAVATDGRRMSLYSQK-EGIVGGVDIKVIIPGKMIHELERLLDD-EGDVDVLITENQAGFQFDSIRLVTALIEGTFPNYEMVVPQKHDKEAIINTKQFMEAMRRTRTMTND-KFNSVRIE-LTSGQMKLLVTTPEVGEYTEELSVE-YDGDDLEIAFNPDFVYDVLRHIDTEATGLVLKDAMSPGIIKPSGDDNYTNVVMPIR.. 367
227 0.000e+00UniRef50_V5V7W3 Beta sliding clamp n=350 Tax=cellular organisms TaxID=131567 RepID=V5V7W3_ACIBA  ali  25  1MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTALSEGACL-----EAGETTVPARKLMEICKSLPTAAIDLQITEDQRCILKSGNSRFVLGTLPAEDYPLLTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLRAVTTDGHRLALCEI-LASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILSNE-KLRGVFLN-FNQDSLQLRANNPEQDEAIEDLAIQ-YQSAPLEMSFNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMR.. 381
228 0.000e+00UniRef50_UPI0003631D9D DNA polymerase III subunit beta n=2 Tax=Sporomusaceae TaxID=1843490 RepID=UPI0003631D9D  ali  30  1MRITCQQDVLNQALQTVQIAVPSKAQIPVLSGIYLNAEDGCLQLQASDHQTSMIYTMEAE--------IAEPGEMVVSGRYFYDLIRRLPSQTVTLSKDSSNTLKLVSGRYDYQLLTIPPQDFPVLKPQEGRTSFSILDHVLKDLVKKTGFSCSSDEARPIFTGCLIEINEGVIQMIATDTHRMALAQNGVEPSTT--TAKMIIPAKLLNEICRIVP-ANTQIQVHLLDGQVAFVFGSVYLVTRLIQGQFPDYRKVLLTQVQTQATIDTQQWLLAMERIFLLVREGKYNTVRMF-FKEDHLSIVYSNPDIGTASESVSCQ-LEGNELEIAFNARFLLDILKNIDSEQCTIALNTSLSPAAIRPVGESQYTYIVTPMR.. 370
229 0.000e+00UniRef50_A0A2M8EN67 Beta sliding clamp n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M8EN67_9BACT  ali  28  1MKLSCTKENLNQGLAITSHVSARNVNLPILNNVLLRADAGGLKLISTNLEIAITCTV--------RGKLEQQGEYTVPSKLFYDFVNLLPNERVDIDLHDDG-LSVKCGSAKTKIKGISPSEFPLVPPVVGKLKYIVPVHLLRGALSRVLFATATNESRPELTGVIFSFEDKGLILAATDSYRLAEVYEKIS--VEGTEQKVIIPQRTLTELSRMFGEAPKDVIIELADNQVVFRYGSVELISRTIEGNYPDYRQIIPNTSKTEIIIERTVLSQAIKSASLFSKLGLFDIVKIN-PTDKTIELSAADSGRGENKITLEAE-VSGDENEIIMNYRYLLDGLNAMPTEKVKIKIIDAASPCVIVPAENEKYQYIVMPIR.. 378
230 0.000e+00UniRef50_A0A1Y4H0J3 Beta sliding clamp n=1 Tax=Anaerofilum sp. An201 TaxID=1965588 RepID=A0A1Y4H0J3_9FIRM  ali  29  1MKIICDRSLLADALAGVSRAISGRGALPVLEGIHLKAEGFSVTLTGYDTEIAIITTIEA--------NVIEPGEAVIPAKLFGDLVRRMAADEVEVTTAMNGTAHIRGGSAEFDIAALSVDDYPALPTPGADPALELPAGVLTEMIGRTVYAVSQDDKKPVHTGELFSIQSDKLTVVALDGFRLAITEQPVEAAK---EIDIVIPAKTLTEVCRLLGDPEETVKISANRHYVVFAASGYTVISRLLEGAFLDYKKVIPEGHRTRVQVEVKPFVETVERASLIITERLKNPLR-VTFGDG-LTVRCQTT-LGKVQDQLPA-HVEGEAVEIGFNNRYLLDALRNSGCDNVVMELSGPLSPVKVLPADSDGFCFLVLPVR.. 368
231 0.000e+00UniRef50_A0A2H6EX96 Beta sliding clamp n=1 Tax=bacterium BMS3Abin05 TaxID=2005713 RepID=A0A2H6EX96_9BACT  ali  26  1MKFSVPRSEFFKAIQRIIGVVPQKTATPILSDVLLSLEENILKIYATDLEILISTEITVDG--------IEDGALAVSSKILGDILRELGDVQIEVLTEDNHRLRMISDRGVYKIAVDSSEDFPLMPISQLVEEFSIPSAKLSRMIDKTIFAVSHDELRPALMGVLFQVFENEFRMVATDGHRLSRI-INKDFKANVSEKKMIVPTKALNLLLKNISEEPGLIKISFGENYLVFKLNHTEIISRLVESQYPEYEAVIPTANEKKLILNRDLFYSSLKRVSIFSN-LLTKQVRLS-LKSDKVELFSQDLDVGEGMEVLPAE-YNGEEMDIGYNAQYVMETIRHIDTEEVMFMLDMPTSAGIVFPTENEELLMLVMPVR.. 369
232 0.000e+00UniRef50_E8LE21 Beta sliding clamp n=6 Tax=Phascolarctobacterium TaxID=33024 RepID=E8LE21_9FIRM  ali  31  1MIISCNTNSLNKAIQTVQRAIISKPSTPIFSGIHVIAADNKLEIQAMDLNMAISCTIDAE--------ISESGEIVVSAKHFADLIRKLPAESLTISKNEEHSIKVSSGKSEYQLFLMNEDDYPKFPTFDADRTIALDDGMIKELIKKTIFSCSTDEARPLFTGILVEAKDGKITFVGTNTHRLAIKSLPYEG---NEELSMIIPSKVLGEISRNLGEVPQQVLISLLNNQIMVVIDNIVIVSRLIEGQFPDYRRVIPPKFALTSKVNIKELAGAVERVALFSTDGDYSIIKMSV-AADEITITSSSPDVGTGLEVVSCQTI-GDPLNVAFNAKYILDILKNLEAEEAVLSMNTSLSPVCVTCADEPDYTYIVTPVR.. 366
233 0.000e+00UniRef50_A0A2E9QPK5 Beta sliding clamp n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QPK5_9DELT  ali  29  1MQLLIGRNSLLKLVSIAQSVVPKKSTKPILTHLMLEANAKGLTISATDEELSFSGTTEAQ--------IEIDGQTTVSAKDLYDVVRNFPAQPIELIYHDQGQLEIKSDRIEFRLHTLPSEEFPKWPELNPETSYQFPVDSLLEVVDRTIFAVSYEETRYYLGGVYFECEEGELRAVATDGHRLALAESVPPENFTLNPGQ-ILPRKLLNELRKTLDPKQGEAYIGFQDKRVLFQHGNHTLVSMLVEGSFPDYRQVVPKSPNIQCRVGRTELLDALRRISLLSPD-KTGGVRFQV-TPSLLRISSQHSGRGEASQEVEIREGGGE-VEVGFNANYFVDALQVIETSDVLLEFTNHLSPCLLRPVEEEDHLNVIMPMR.. 376
234 0.000e+00UniRef50_A0A0T8E6Z9 Beta sliding clamp n=345 Tax=Bacilli TaxID=91061 RepID=A0A0T8E6Z9_STREE  ali  40  1MEFIVNHKQFTQALSEVNKAISTKFLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAKYFIEIIKKMPSD-IAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPVLTGVHIELSNNKLICAATDSHRLAIRETLL---SSDVKANCIVPSATINELLKLMNSNSEFVYIYFSESHIIFTFGTTTLYSRLIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQGEKLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
235 0.000e+00UniRef50_A0A2H0V3V5 Beta sliding clamp n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0V3V5_9BACT  ali  28  1MKITCTQENLSHGLSITGHLANKNVNLPILNNVLIEAKDESVKFSTTNLEIGISCIV--------RGKVETDGVYTVDSKLLADYVGLLPSEAVQIALIKDDYLNVKCKNNNTRIKGIAADDFPVIPEIEKNNPHQIKIADFKQAISQVIFAVANSETRPEISGVFISINGGRLTMVGTDSYRLAEKKVATSGNTDKKE--LIIPVKTLQEVLRILGDTPENIDIYVSDNQILFVVDSIEIISRLVEGQYPDYKQIIPNEAKTKTIINTQELTKVIKTTSLFSKTGIFDINLEFLPENKSVVVSSNNIQLGESVSEIDI-KFEGEKNNTTLNFRFLLDVLNAVSSSEISFDVIDSAIPCLIRPEGDDSYLYIIMPIK.. 374
236 0.000e+00UniRef50_F4XUM5 Beta sliding clamp n=4 Tax=Moorea TaxID=1155738 RepID=F4XUM5_9CYAN  ali  29  1MKLVCSQSDLNTNLSLVSRVVPSRPTHPVLGNVLLEAKNQRVLLTAFDLSVGIQTSFNAD--------VETGGEITLPAKLLNDIVSRLPSGEITLEDDDSLIVTLTSATGRYQVRGMSSEEFPELPEVNTSVAVHIPVEVLKAGLQGSLFATSSDETKQVLTGVHLTVQSDKLEFAATDGHRLAVVERTIEESATDFPLEFTLPARALRELERIVSKAEDIIAIQFEPGQIVCQGGEQLLTSRTLEGQYPSYHQLLPKHFERQLILDRRQLLSAVERIAVLA-DQKNNIVKFNIDSNQRLHLSVEAKDLGSGRESMEVE-ISGDSLEIAFNVKYLIDGLKALSTSEIKMQMNEANSPVIFMPLGGLKMTYLIMPV... 389
237 0.000e+00UniRef50_Q8DGG8 Beta sliding clamp n=3 Tax=Synechococcaceae TaxID=1890426 RepID=Q8DGG8_THEEB  ali  26  1MKVVCSQSVLSSKLAPLSRVAPSNPSHPILANILLQAEGGRLGLSVFDLSLGMQIWLDA--------AVKVPGAITVSAKLFSEMVSRMPNRDIEITA-EDTRVILDYGSGFFEIQGMSAEEFPALPTLEDVTPITLTAEALRRGLQGSLFAASTDENKQILSGLHVTFERDRLEFAATDGHRLAVTVTEQPVPAEPLSP-ITIPAKSLKDLERLMAKQDGMVALRCDPTQVVFDIGNARITSRLLEGQYPNYRQLIPKTFARQVTVERSALADALERVAILAAQ-KNNVVKINIDTEQELKLSAEAPQLGSGEENLPAQ-ISGESMVVAFNVKYLLEGLKVMNSADVQLQLNGETQPAILLPLGEAQMKYLVMPI... 366
238 0.000e+00UniRef50_A0A0G0FST0 Beta sliding clamp n=15 Tax=root TaxID=1 RepID=A0A0G0FST0_9BACT  ali  26  1MKIEVLKENLKTGLNIVERVVGKNLSLPILDNVLMDAEDNFLSLSSTDLETAIKLWI--------LTKIVKKGKTVVPARFLSSFISLLPNEKIILEEKKQN-LYIECKNYKNQIQGYNPEEFPIIPEFKNLDYLEINNKKFCQGLAQIVDIASPSQTRPEISGIYLFFSKDVVKMVATDSFRLAEKTLTLENPVKK-EYSFIIPQKPAREIINILEEKEGLLKIYFSPSQILFDFPQVQITSRLIEGEYPPYHEIIPSKFKTRVTLKRDEFLNQIKTASLFS--GKINEIKFTVLQNKEIEIFAQSPDIGESRSILSG-KIEGEAIEASFNYKFLIDGLNNIKSSEVCFDLSKEEGPCILRPVGDTSYIYVVMPIKS. 373
239 0.000e+00UniRef50_A0A2S0KPL0 Beta sliding clamp n=1 Tax=Fastidiosipila sanguinis TaxID=236753 RepID=A0A2S0KPL0_9FIRM  ali  33  1MKIVCSKSQLDMAINHVQKAVSVRSTLSLLDSILFVAKDNEVHLTGYDLETGIEVRFEAD--------VIQEGEILLNAKMIAEIVKKLPDETISISSDSQFTTIISSGNSQFNVKGLDASDYPQLPEIDANEKLTIPQSMFKEMISQTIFAVSTDESRPAFNGALLNSNSNVVELVAIDGFRLAVRVEELDYDIPD--VKILIPGKALKNIQSILGD-NGDLELYTTQNHIKVNVGEVTLISRLIQQDFMDYHKILPNTYSTRIEINTKDFYHAVERALILPNQDRRYPMSLKFTGSQIMNVTATTN-VGNMEDGVELNYFDGDELEIDFNQRYFLDALKVINDENVTVEFNGPVGPCIIQPVEGNYFTYLILPLR.. 366
240 0.000e+00UniRef50_W2C1F1 Beta sliding clamp n=10 Tax=Firmicutes TaxID=1239 RepID=W2C1F1_9FIRM  ali  34  1MKFRCQQQKLSKALNIVSRAVTSRTTIPVLKGILLEVNNGKLTMSASDLDIAIKNTIDVE--------VVEKGSVVITAKLFGDIIRKLPSSEIEIKSDENNNIVIDCLTSEFKVVGMSTDEFPIFNKIDVTNSITFDKKSLKTMIEKTAFAASLDEARGIITGVLIELNEDEMTMVAIDGYRMAITKKDYTTV---NPKKIVISVKTLNEISKILNDEEENVNLYLNEKKAIFEMGNCKAELKIMEGEFIKYKDILPKDNKIEVIINRSMFLNSIERASLLSKAGKNNLIRMN-ISENVVTITSNSEE-GNVKEDIIVTK-KGENLIIGFNAQYVIDVLKNIDDDEVKMLLNTPITPCLIEPLEGNEYKYLVLPVR.. 366
241 0.000e+00UniRef50_A0A2E7ZVF9 Beta sliding clamp n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E7ZVF9_9DELT  ali  23  1MKVRIDKGALFTPLYRAQGVIDRKASTNVLACVHITAGDGTLTFTATDYDVTMTADVAAD--------VMESGAALVNGRALFEVVRALPDGDVQLSCDTNHRIRIEAGRSYYHLNGLAPSEFPQVLEDASGKSLHLDKDQLSNMLRRTLFSVSHDESRPALNGVLLEIEPDQIRMVSTDGHRLSKVERAVESDYDGAEHSCIVHRRGAAELLRIFEGPDQGVRIEFLGRTVVFTSDHARLQVRQIEERFPEYNRVIPEQGDVHITVSKTAFVNAIRRVSSLAT-GKHNLLRMD-LDDGRMALEMVHADFGDAHEELEIPEYQGSQVEVGFNPRYLLDVCNVMETDSITLELRDQFSPCLLQSEDESGSTFVVMPMR.. 374
242 0.000e+00UniRef50_A0A2U2ACD8 Beta sliding clamp n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A2U2ACD8_9GAMM  ali  27  1MKLVIQREQLMKPLQAIIGVIDRTQTLPILANVKCVVSEDEITLTTTDLEIELTCAFP--------HIPLEQGATTFPARKLFDILKALPSGEVQIEVGSDSRATISAGRSRFTLSCLPIDEYPVSDHLEFDKTLTLPKNALRKLIEQVAFSMAVSDVRYFLNGLLLDVNGAELNAVATDGHRLSVSYYQLPE-SSELQQQLIIPRKGVEELLKLIENESAPLHLELSANHLRVELGSIVFTTKLIDGKFPDYRRVVPPLGDKIIAADRQGLIDGLVRASVLSQD-KFRGIRF-TISDYLLKLQVNNPEQ-EQAEEEVEVNYQGEGFATAFNVSYLIDALKALDDDMVRLSFTAPNSSCLIQNSDNDNVRYVVMPMR.. 366
243 0.000e+00UniRef50_A0A0G1BZT8 Beta sliding clamp n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1BZT8_9BACT  ali  27  1MKISLLQENLVKGVNLLNRVVANKAQLPVLSNILLLTDNGQLKLSATNLETGMNLWL--------GGKVEGEGKLTVPAKVFSEVVNSLPPETVVLE-KEGEGLKISCERFRSKINGIAAEEFPALPSLRDGKTIKLDREVIEKSLGQVAMAAATDESRPIFTGVKLELGKKKLRLAATDGYRLSIKIVK-NLKGPKKQKSIVVPARALMELVRALGTEAKEVVLAATERQLIMAYGDVEVVTRILEGEFPDFDKIIPTSHTTSIVLDAEELLQAVRAAAVFAKDSA-NIVRFKVSDQGLL-ISANAPQVGENEVELAGKK-SGEDAEIAFNSRYLLEMLNVIGGKELKLELSGSLSPGVFKPKEDNGLIHIIMPVR.. 373
244 0.000e+00UniRef50_R7IMG2 Beta sliding clamp n=3 Tax=Sutterellaceae TaxID=995019 RepID=R7IMG2_9BURK  ali  23  7.....SRESLLTPLTTVSGIIETHQTVPILSNVLIQSDGSKVSFTGSNLEIQIKTHAELEQEGDPV-------AFTVSSRKIQDLIKSLPPTEVTISLEGGNQIEVSTENSRFSLQTIPADKYPSFPEADFTSSATIPAKQLKYILSMVHYAMANQDIRFYLNAVRLVIKDGKVRVVATDGRRLAFCEIPDKNSIVSEDVSVTIPRKAVLELKRLLPEEDDDVKIDFAANQARFTFNGVEVTTKLLEGTYPDYERVIPTNNDKVFLISREALLQALQRTAVLASD-KFKGVRW-LLSPGLLSIQSSNSDQEEGNDNIAVD-YQGDPIDIGFNIDFLSDVLSNLKNDKVKIALSGPQGSALITMPESDDFKYVLMPMR.. 386
245 0.000e+00UniRef50_UPI00048DBA85 DNA polymerase III subunit beta n=1 Tax=Proteocatella sphenisci TaxID=181070 RepID=UPI00048DBA85  ali  31  1MKFSIEQKQFQNALSIALKGISSKNIMEILKGIYIEAEDDHITLTSNNLEIGVKTRVQAE--------VSESGIAIIEGKILSDIVRKLPDEKITISVNDNNVVKISTSKTKFNIKSMINNQFPQVEEFENDRYEKIDMKLFSDMVRKTHFAASQDETKGVLTGSLIEIDSNSISMVSIDGFRLAIKRIP--TNYNLGEKKVVVPVKTLQEVTKLSSNENCDLRILFEERNVSFVIDNTIINSRVLEGEFLNYKQIIPKEFMTKIKINNHEFISSLERAMLVSN---NNLVKL-VISDDTVVVSAKNSEIGNLEEDIPVNQ-QGKDLEIAFNIKYFLDCLKNLDEEYIYMNFNTNLSPCVINPESDEDYTYLLLPVR.. 362
246 0.000e+00UniRef50_A0A2A7WQ14 Beta sliding clamp n=2 Tax=Bacillus TaxID=55087 RepID=A0A2A7WQ14_9BACI  ali  43  1MEFNINNDYFNQAISEVSRVISLKTTIPILTGIKIVANSQGLTLIGSNSEIVIEKTIPIEINDVKIVEVSKPGSIVVSAKYISDLVKKLPS-KIKVTVNEKQLMTIQSDEIITHINGFDSEQYPLLPLIKNENQIKIPISEMIEMIRQTVFAVSKNEARPVLTGVNMSILENKLKCVATNSHRLALKELKIDSVMNG---SFIVPSASLNEVVKLFSNDSDEMNVFITEQYIVFKSELISLYSRLIEGKYPEVSGLIPKELKTKMTLDTKQLLKGFERASIFASEWKNNNVYLEILDGSKLKISSHSSEVGKIEEIQIIKNLTGQPLNISIDANYMIESLKVIKEEEVSISFSGSMKPFIIKPINNNTHLHLISPVRTY 376
247 0.000e+00UniRef50_B0CDM3 Beta sliding clamp n=53 Tax=Cyanobacteria TaxID=1117 RepID=B0CDM3_ACAM1  ali  28  1MKLVCQQSDLNSKLSLLSRVVPSNPTHPVLANVLLTAQAERLGLTVFDLSLGIQVWIAAD--------VEETGALTLPARFLNDIVSRLPNCDIEVETDD-TAVTLTCDSGHYQMQGLVAEEFPGLPSLDEIPALDLPTDVFLEGLQATLFAASTDESKQILTGLHLNTSESGFEFATTDGHRLAIA--NFPDLVTPEPMTMTIPAKALRELERMLGRVNADVALRFDTNQAIFELGTERLSCRLLEGQYPAYPQLVPKQFERQVTVERQLLLSSVERIAVLAA-RKNNIIRLKIDSEQNVALSAEAPELGMGEERLPAQ-ISGEDLDIAFNVKYLSDGLKALDSQEVQLQMNSATMPAVLSPLSGRQITYLIMPI... 368
248 0.000e+00UniRef50_A0A1F2XQA3 Beta sliding clamp n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1F2XQA3_9ACTN  ali  28  14...TCARDDLANALGIVARGLSSRSAVQVLTGILVQVEEKKLTLAATDMEVSLRVSV--------SGEVSGGGAIVVPGRLLTDLVRLLPDEVVSLSYEGDGVLTIASGSYSSRVNVFSAEDFPRLPTLDVSLH-TIAAPALLGTIEKVARAASRDESRPVLTGILVRFEGDTLIMAATDSYRLAVKETSL--GESGPELDAIIPARALQELARLAAGTEE-VSLGVHENHVIFGAGDVWLTSRRIDGQFPNYKQLLPEAFELEVTTLREPLLNVVRRAAVMA--QRNAPLRLR-FDEGELTVSAQSQDVGEARESLQLD-YAGEPLEIGFNPDFLRDGLEAVGGETVQLKLINPLRPGLIVAP-DESFWYLIMPIR.. 371
249 0.000e+00UniRef50_Q48AS6 Beta sliding clamp n=36 Tax=Proteobacteria TaxID=1224 RepID=Q48AS6_COLP3  ali  25  1MKFSLNRELLLKPLLLVSGAVERKSTLPILSNILFEVSGQSLTLTATDLELEMVAYAEIQNQGD-------DGKITIPARKLLDICKSLPESSISFEVIDET-IKLSSGRSKYSLSTLPAVDFPNIEEWKGDVEFQLLKSEFLRLIESTHFSMANQDVRYYLNGMSIESEGNEIRSVATDGHRLAICKISNETLALPA-RQVIVPRKGILEIIRLLAPVDEAVQVFLGSNHIRIIDSEFSFTSKLVDGRFPDYRRVLPRNGDKVFETNKDALRQVLSRASILSNE-KFKGVRLN-FSDTNLKITANNPEQEQAEEEIEINFPYGE-LEIGFNVSYVLDVLSAIKDENVKFTLADANSSVVIEGSSNGEALYVVMPMR.. 366
250 0.000e+00UniRef50_A0A2E9MCS0 Beta sliding clamp n=3 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E9MCS0_9BACT  ali  27  1MKLTVDRNELWRGLNTVLDAVASKPAQPVLANVLLDAAESQLTLSATDLDISIRTRVTA--------AVDVPGRVTVPAKTLAEITREWPEADLQISL-EDGRIVLSGGEGRYSLAATPPDEFPDMPESLDGIELSIDGDLIRAMIDRTSFAVSKDETRPVLNGVLWRITSDFMSMVATDGSRMAEFRRNLDG-TDRGTAEVILPPQACQQLGKLLDGQDGLAKALVGDSQVLFQVGETQLLTRLIEGPYVDYEQVVPRENDKRLTIALDQLLPAVRRVSILSS-SYTHQVRM-MLQDGSLELTASSQEIGEAREVIPGD-YSSEALEVAYNAHYFMEILRKIGSDEVIIDMRDSVTAAVVRPLDGEELFYLLMPMR.. 382
251 0.000e+00UniRef50_E0E1L9 Beta sliding clamp n=6 Tax=Peptostreptococcus TaxID=1257 RepID=E0E1L9_9FIRM  ali  32  1MKILCNQKKLAHAITNAQRAINTKTTVEILRGILISAEDNKLKVRGYDNEISIETEIEAQ--------VELAGSIVINSKLIGEIVRKLPDSYISIETDDNFNVFISCMSSRFKIKGISAEDFPNIDSIEVGDMLKISQADMKNMIRNTVFAAATDNSNQTFNGELIEIDSEKINMAALDGYRLATMTNPFKSGVDKN-LSAIVPRNTLNHLNSLLSD-DGDLYIAISPRDVVFKFDNTRLVGRLIDGEYADYKSLLPKEYVTKISVETKKLQEAVERASLLFTSDKNNTIKM-TVTDKLLVITSNN-ENGNAYEEIGVE-FEGDMLDIAFNSRYFLDGIKYLNSEYVSIEFLGAINPCVIKPLDDIEYTYLILPVR.. 364
252 0.000e+00UniRef50_A0A1G0I042 Beta sliding clamp n=8 Tax=root TaxID=1 RepID=A0A1G0I042_9GAMM  ali  26  1MNITVHRNALLKPLQAISGVIDKKQSQPILANVLLSTKDNQLCLTGTDLEMELVGTVP-------LLSMTEPGRTTVSARKLFDICRVLPEDAISLSLGKNNLL-LRSGESCFTLKTLPAEEFPNLENHIYATELTVSEAGLKQLLTKTYFAMGEQDVRHYLNGILLDIKQKKIQCVAMDGHRLAFAAIH-EDRIDHVEMQALLPRKSVLELMRLLEDSDADMTLRVNEQRICVTAKHFIFTSKLIHARYPDYQRVIPQG-ATTVVLERDAIKQALIRAAILSNE-KFRGVRLQ-LENNRLLISANNAEQEQVEEVVSLD-YAGNAMEVGFNVSYLLDAISTLSSAAIRFIFTDAQGGLLIRSETDEPHFYVVMPMR.. 366
253 0.000e+00UniRef50_E1R6N1 Beta sliding clamp n=10 Tax=Spirochaetes TaxID=203691 RepID=E1R6N1_SEDSS  ali  30  1MKFTCEKNALLKEISIAQEIISTRNALSILSNVLLEADDGSLTIKATDLKVSFETRIPVE--------IAAPGSTTVFCDKFLGILRSLPEGDIEVELVDN-RVMIRFQKINFQLKSIAGDKFPELQEVSEDLYFEIPQKDLIEMIGQTIFAVSDDETRYYMNGVYVEQDGESISMVATDGRRLSLIKRRIESELKEFDA-VIIPPKVLQLIRK-LSSGEGNLKIAISDRNIFVQFDDQRITSNLIEGQFPNYRRVIPDSQDYQLVVNRDQLEEALKRVSLLV-EQKSRRVYLSV-ENAMMRLTSEESDIGVAKEELSC-SYEGPETTIALNYLYLAEPLKVMRCEEVVLRFTEANKAITLEPVPEGDYFHIIMPM... 364
254 0.000e+00UniRef50_A0A285N1D6 Beta sliding clamp n=1 Tax=Persephonella hydrogeniphila TaxID=198703 RepID=A0A285N1D6_9AQUI  ali  30  1MELVIEKSDLQNVLKKAISATEKKSALPILSNFLLEAVDDKLIVQGTDLEVHVSVSVFAK--------IEKEGKACVNAKKITDISRLLPSNEVYIKL-EDSVLKIKSGKTKYSLPVVPSEDFPMMYPFPEDNAFVVSGDDIQKAISKTSYATSKEETRYALQGVLFKSLDGTIDVVATDGHRLALYTINRNGT---GDVEIIVPQKALNELKKLLTGL-EDVEMAASDQYVFFRTKEWILMSRLLEGAFPDYTKVIPQDFNIEIKLDKKEFLDAVKRVSAVI-EGDPKPIKL-TLKENTLQLLSKSSEYGEAVDELSVD-YTGEEFSIGFNARYLIEAVEVIDGDTVIIRFTTPNAQTLILPKDENDYKAIVMPM... 361
255 0.000e+00UniRef50_A0A2M6XCS1 Beta sliding clamp n=1 Tax=Candidatus Shapirobacteria bacterium CG08_land_8_20_14_0_20_39_18 TaxID=1974883 RepID=A0A2M6XCS1_9BACT  ali  28  1MKLVILQEDLNKALVTVSRSVSSKSSLPILANILLETEEGRLKLSATNLEVGINYWLGVK--------IDNEGSITIPARIVNELIASLPAAKIELETKEST-LFLSTNNFKINVAGLDSAEFPKVPFFPKNPLAVFGKEDLIKGLSQVVIAAAQDEGRPVLTGVLFTSRIEGLTMVATDGYRLSLKKISAQEIDKSVE-KLIIPGKTLQEVVRIADNKGGSITIKLGKSQAVFSFPNIDFSTRLIEGEFPDYQKIIPQSSTTKVIFGKEEFLRAIKTASIIAREQA-NIVKLVIDSSGKMTITAETAQVGANESEIEAKT-EGEKLEIAFNYRFLLDFLNVVEGDEIIFEAGGPLAPGVFKPTGDDSFLHIIMPVR.. 376
256 0.000e+00UniRef50_R7K7K2 Beta sliding clamp n=1 Tax=Subdoligranulum sp. CAG:314 TaxID=1262970 RepID=R7K7K2_9FIRM  ali  34  1MKLICDGLELSDAIGKVSKALPQRVVNPVLEGIKITAEGETLTLYATDSEFSVERKINAE--------IIEEGEILVPGRIFSDYIKKLTDEQIELSETEKNRLRIRYNESEGYLQCLDKDDYPDKADINREKGFHILENELKDVINKTLFSASTDDSRQILKGCLFEIDEYTLTVVALDGYRLALAKKALEQKSGRM--SVVIPSRALNELSKLLGDGDKIARLFVEENLLVVEMENTTVSTRLLVGEYINYRQIIPEEFTTNVIINKQQFEAALDRASLLSRGEKNNLVKFE-IKENIVCITGNS-ELGNIKENVSI-SLKGKDLNIAFNAKYISDCLRAMDNDFVKMNFTSSVAPCIITPCETDEYLYLVLPVR.. 364
257 0.000e+00UniRef50_A0A1F5CB19 Beta sliding clamp n=12 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5CB19_9BACT  ali  23  1MKITCLRENLKEALDHAERMTSRNTTLPILNHFLLITDKGQLKVSATDLEVGFSAYV--------QGKISNDGSLAVPAKLLTQFVNNLPNKKIDLEIK-NSSLHLNCESARAVIRGLNPDDFPIIPKIKSTQVLIINSKVLKEAFGDVINACAASDARPEIAGVYVIISSDYIKFVATDSFRLAEKTVKNDIKKYQDNYNIIIPVRTVSEVLRIIGDKNQDISIFIDPNQILYDFGESRLVSRLINGKYPDYEAVVPKDYETQVLISRDVFEEAIRLASCFT--GRLSDVVFKTNSKNELEVFSNDTDLGEHQTKLKSD-IKGKDVQAVFNWRYVLDGLKNIRSEELLIEFNGGERPAIIRPVGRSDYFYIVMPIK.. 367
258 0.000e+00UniRef50_F9MS90 Beta sliding clamp n=3 Tax=Firmicutes TaxID=1239 RepID=F9MS90_9FIRM  ali  32  1MKVEIHKQDLIGPINTVQKAISGRTPLPILEGIYFKAENNQITLMGTDGEISIQSTVAAK--------VIEEGEIVLGSRLFGDIIRKLPSATIYLTLTEHN-LNIRCQQSEFNIMGQSTQEFPQMPEINDPVKIQLARESLVDSLRSTSFAVSLDDLRMALTGVLLDCKPGKMSFVALDGYRMALNELEI---QSDAEIQAIVPARACTEIVRLLDDSLDTILIELADNYIKIDLGSTIFVSKLINGEFFQYQGLVRNDHKINVKLKRQDFVQGLERANLLAKEERSNLVKLD-ISANEILIESHS-DIGDVHELIPCTT-EGEGLKIAFNSKYLLEGVKAIQEEEIICHFIDSVNPCIIESSEKSGYIYLVLPVR.. 362
259 0.000e+00UniRef50_A0A2D9LDQ4 Beta sliding clamp n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D9LDQ4_9RICK  ali  30  1MKITVERDELLRALNHIQGLVEKRNTVPILSNILXDVNDNKLRXXATDMIIEVVQSLNC--------XVLNTGKTTISAHTLYDIIRKLSTGQVEIMQAGTKDIEIKSGKSNFKLPSISPEEFPXMDNAKMPFNFLIKSNDLCLLLDRTKFAMSAEETRHYXNGIYLHAENEALIAVATDGHRLAKIQLDKXDKIGNMP-SIILPRKAVLEIRKLLEDYEKEVSISLDENKICFSLEALTFSSKLVDGHFPDYSKVIPEGNKNILIVNRKSFSEIVDRISTVSTE-RSQAIKIS-LEKKMLAVSASSPDSGSAVEQLAV-NYDSEPISISFNARYLLDITNNINEENIRLELETPSSPTLIRGEQDTSCIYVIMPMR.. 371
260 0.000e+00UniRef50_E6PG72 Putative DNA polymerase III subunit beta n=4 Tax=root TaxID=1 RepID=E6PG72_9ZZZZ  ali  26  1MKLSCDTKEIAAAVGAASKVVNAHTTVPILSNVLIHAENGSLSVRATDLELTLEQRMKAE--------IEEPGSITVPAKLFAGYLANLPATS-TIELSGTNRVGVKCERTNYDFNALPGDEYPPLPAAVKGAQFSLSGKRLREGIDAVIFAAATEEARAVMMGTLLEIEGDKLTMVATDGYRLARYETTLDESPGGHER-FIVPSRALAEVARNLAGA-ERVNVNVQNNQLQFSAEHAAVTVRLVDGQYPNYQQVIPAKFDRKVTASVPALVAALRRAELVAGDRAS-MVKMN-LSNHTLIVTANSERSGNAYEEIEIEQ-EGDDLTIAFNARYMIEVLNHVKSAQCRIEFVGPLSPAALTPVEGASQLYVLMPLR.. 371
261 0.000e+00UniRef50_A0A2M8G6V1 Beta sliding clamp n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2M8G6V1_9BACT  ali  25  1MKVKILQESLNRGLGLASRIVQTHPSLPVLGNVLLEAKDNKLFLSATNLEVGMILKLKAQ--------VLEEGKISVPARLLAEFINSLPPAEIKLELQGKT-LEISTQTHRSTLNGIEAGEFPPLPQIQGEAVLKIKNTIFDTAINQVVFAAATDEGRPVLSGVLLTGEADNLVLVATDGFRLSHKIVTQKHPLASGQLKYILPARGLLEVGRVLGEKESEVELGLDQNQMIFKLSSAEISCRLLEGQFPDFKKIIPKMFVSRAILEREEISKAVKLASIFARDSA-NVIHFSFPSQKKVSVDAQTKELGQSRTEIEG-SLEGDPLEIAFNARFITEILAVLDSEQVSLELSGALSPAQIKAVGEQTFFHILMPIRT. 376
262 0.000e+00UniRef50_A0A2H0W9S7 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_13 TaxID=1974514 RepID=A0A2H0W9S7  ali  26  1MKIIVLQSNFAKGLNQISRIVGSRATLPVLNNVLISAEKGKIQMSATNLEVGISTQV--------IGKIEEDGELTLPVRLLSDFVLNNKDESIEL-VTEAVSGKLKSEHFEATIQGISAEEFPTVPKPPTEVVAKISRTKLIDAFKKVNIAAATDETRPVLAGIYCQFSGNKLTLAATDSYRLAEKKITLETKVAEQ--NLIVPLRTAAEVLRLISTEDEDVKISAKENQISFSIGNTYIVSRLIEGAFPNYSQIVPESFKITAKTKLSDILSAVKMSSLFARDSANNNVR-VIVKKNDLTISSVASESGTAKSSI-ASETTGGDVEIAFNARYMLDILNVISDEEIILNFNESTAAGAIKTPKDPDYFYIIMPLK.. 366
263 0.000e+00UniRef50_G4D1R1 Beta sliding clamp n=3 Tax=Peptoniphilus TaxID=162289 RepID=G4D1R1_9FIRM  ali  35  1MKLKVSRKEFIKAIQIAQRAISPRSTIQILEGILLKAKNNEIVLISSDTEITIKTSIAA--------IVMEEGEIVVNSRLFGDIIRKFQGDTIDINL-DGTSMNLKCEKSNFHIQCQLPDEYPMLPIVEKNNTFNISSQELSDSIKKTSFAVSMDETRMVFTGVLMDLSPAKINFVALDGFRMALKTV---NNPNENTTSAIIPARTLNELIKVLEN--EDVNVCISRNMALFRTKTTEVYTTLLSGEFFKYQGLITESHTTICTISRVNLQSALERASLLAKEDRANLVKFE-IEEGFIKISSNS-EIGNVEEIVE-SKVEGGNLKIAFNSKYLLDGIKIMESEEVRLYFTDSVNPCIIR-EDDEDYLYLVLPVR.. 359
264 0.000e+00UniRef50_A0A2D7TM14 Beta sliding clamp n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7TM14_9RHOB  ali  29  1MKAIIEKKKLMQALSXLHGVVEKRXTIPILANVLIXAXDXFLSLAATXMEXAXLQKVSCXX--------KQNGVITTPAXVLHDIVRKXPEAXXELESFEGKKXEXKTDKISFSLMCLXPKDFPXXHXGSFPDSFEIQAEKLSRLIDKTLFSVSTEETRYYLNGIYIHSNEEKLRVVATDGHRLSRLSTELPLNANNLQ-GVIIPRKTVIELRKIIDSKQNTVKIQLSKNKIRFIVDNISLTSKLLDGAFPDYEKVIPNNNTKELIIDNKEFIDAVDRVSTLSSD-RTRAIKFE-LSNKSLTISAENPDQGSAKEYLNV-HYTGDNLEIGFNSRYLLDIAKQISGAQVKFLLSDKLSPTLIFDDDDKQALYLLMPM... 369
265 0.000e+00UniRef50_A0A0G0YT26 Beta sliding clamp n=1 Tax=Candidatus Kuenenbacteria bacterium GW2011_GWA2_42_15 TaxID=1618677 RepID=A0A0G0YT26_9BACT  ali  28  1MRIICTQENLIKGLNVVSRLAGKNISLPILNNILIKTEGGLIKLISTNLDIGIKTTL--------RGKVESEGEITVGAKIFTEYVALLTGGNVEISVDNNNIL-IKTENQQTTIKGQGTDDFPVIPWLESGNEIELGSETLKEGLSQVINSASYNNVRPEFSGILMVVNKDNLVLAATDSYRLAEKNIKIVKNNLNQEKAYIAPLKALQEVIRICGDGEEPVKIKFGESQIVFGFKETTIMSRLIEGNYPDYKEIIPNGWKTRVVAEKSALTTQIKTASLFSRAGI-NDVLLEFNKNNNIIISAANAQCGENKSTVEAI-IEGENNSAVFNYKYFLDGLQNINQKKIVIEVNSSDLPVILRPENDNNYLYLIMPIR.. 367
266 0.000e+00UniRef50_A0A2E5LFK0 Beta sliding clamp n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E5LFK0_9PROT  ali  27  1MKLQLSKSNFVKSLSFVQNIVESKTTIPILANVLLEAKQGRLNISATDMDITIFDKIKV-------NNIETDGATSVPAHTLYNVIKELPEDPIDLSYDDNKKLHLMSSKSKFVFSCLSKDEFPISSTESFKISFDLKADILKEIIDKTYFATSNEETRYYLNGLYLHSNKNYLRAVATDGHRLAQYQINMPAVSAKDNFGVIIPKKLIFELRKLIDDLKDNIKIDLSDRKIRFSFNETVIVSKLIDGKFPDYEKVIPKNTSNTFSIDRKKFLESINRISTISSE-KSKAIKLN-LNNDKLTISASNEEGGSGVEEINI-KYSGPSLDIGFNSVYLKEIINQFTLEEISVLFSDSTAPTIIKDGSKSESLYVLMPMR.. 374
267 0.000e+00UniRef50_A0A2E6M3I3 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6M3I3_9GAMM  ali  26  1MRFAVQQSAILRVLQQVVNAVERKQIMQILGNLLFDVQGNCLTLTGGDGEIEVSTQL-------MLDTVYEEGKTTLPARKLFDVVKSLPENTVMEFVKEASHCQVLAGSSRFALATRDAADYPKLQDLNAPHVVTFSQKKLKRMLDRTSFSMGVQDVRTFLNGLLLEFDEGTAVAVATDGHRLSLNRQDVNGLGPDLKQQVILPRKAVSELIRLLGDGDSPARMSFGESHLIVEVGTLTFTTKLINARFPDYQKVIPKNLETSCVIQVDFLKQALARSAIMSND-KYKGVRFA-LEQSKLTLLARNQEQEESRDEMSVD-YSGDPLTVSFNISYMLDILNSVDDEWIRITFANLNSSALVEEVSANDSLYVVMPMK.. 368
268 0.000e+00UniRef50_A0A1Q6S3H5 Beta sliding clamp n=12 Tax=root TaxID=1 RepID=A0A1Q6S3H5_9FIRM  ali  30  3.RFSCEKALLQSAVNTTSRAVAAKSSIPALEGILLE-GGDTLTLSGYNMQTGIRTIVDAQ--------VQSPGRIVLSARLFGEMIRKMPDDVIVFAADENLSVHLTCGDASFEILGLSADDYPELPEVDDQFSVDIRQGTLKAMINQTSFAVSTNESRPVHTGSLFEVGDQDLTVVSVDGFRLSLRREPLD-RAEGGAFKFVAPGSALNEVEKICEDSDEKVTIIQGKRHLLFEAGATQLICRRLEGEFLDYKNAIPRNNPIRLTVDTKTMLGSLDRVSVVISEKLKSPVR-CVFENGRVLLSAKTG-AGEAKDICPLDG-DGNGLEIGFNNRYLMDALRYAPADSVSLELNTSISPAVIVPADGESFLYMVLPVR.. 366
269 0.000e+00UniRef50_UPI0009FAB425 DNA polymerase III subunit beta n=3 Tax=Peptoniphilus TaxID=162289 RepID=UPI0009FAB425  ali  33  55.KFQIEKSVLSTIVSTVSRAISSKTNMQILEGIYMEAMEGQLILRATDTEISMESR--------HTCFVQEPGSIVLNASLFGDIVRKLPNAMVHMES-EGQKLSLVCEQSEFEIMGQNPEEYPQLPELGGAEQIVVTGESLLKAFKETQFATSNDDMRMVLTGVLLDVKKEDITFVALDGYRMALSRIEGEQA---LERDLILPARSVSEISKLIDET-KTLTLEIGNNHVLIQFDETKFFTKLLNGEFFRYNSLIRKEHDVTVVADRKQLIDSLERASLMTGKERNGLVRLE-IKDDQIEILSNS-EVGKVHETIRAQK-TGADLTIAFNARYLLEGIRVMDTEEISMGFTDAVNPCIITPLNGNDMLYLVLPVR.. 414
270 0.000e+00UniRef50_Q1GC42 Beta sliding clamp n=25 Tax=Lactobacillus TaxID=1578 RepID=Q1GC42_LACDA  ali  41  1MKFTVQRNLFINDLNSVLKAVSSRAQIPILSGIKLELTEAELIMTGSNADISIELSQPVSDD----LRVESTGSIVVTAHLFSEIVRKLPGREFTFEVKEGNQIQITSDKADYVINGLDASAYPRLPEI-AGTSFSLPSKTLRELITQTVFAVSTEESRPTLTGVNFSFKNGQIKAVATDSHRLSQRIVDIAAGPSE-DLSLIIPGKNLQELAQIIGDADQDIKVYLGDSQIRFEFENLSFYTRLLEGVYPDVDRLLPTESTTSVQFTVSDFMQTLSRASLLTHANRTNAVQMTLVADQTVLVSGNSPEVGKIEEEVGFSSLTGRDLTISFNPDYMAAALRASVTDSVIINFTESLRPFTVVPNDQSEFVQLITPIRTF 375
271 0.000e+00UniRef50_F9UCD3 Beta sliding clamp n=4 Tax=Chromatiaceae TaxID=1046 RepID=F9UCD3_9GAMM  ali  24  1MELVVNRENLLPVLSKVVGVVERRQTLPILGNLLLSASDDRLDICGTDLEVEVKTSCNA--------SVLREGETTLPARKLMDICRNLSEGEIRFRQT-NERCLVTAGRGRFTLGALPAPDFPLMDAEIDGVEVKVPERILREILEKTSFAMAQQDVRYYLNGLLVEWEHSGITAVGTDGHRLAKFHRALDLEIPE-PVQVIVPSKTVLELRRQLAPTDEAVSVAVGSKSIRVAVGGMVMTSKLVDGRYPEYGRVIPRELGKVARVGNEALKRALARTSILSNE-KYRGVRLA-FEEGVLRLQAHNPEQEEAEEEIELD-YGGESVAIGFNVAYLSDVLGAVEGSEVEVRFSDAGSSSVWRGVGAEDETYVVMPMR.. 365
272 0.000e+00UniRef50_A0A1Y4LB21 Beta sliding clamp n=15 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4LB21_9FIRM  ali  33  1MKFSCEKALLVSAVATTSRAVAAKSSIPAMEGILIEA-DTRLRLTGYDLEKGIQATVPAE--------IQEPGSLVLSARLFGEIIRKMPDDVVVFTAQ-NYMVNIKCGLSEFNILGTDPEEFPELPTVDQQNSLSLEQSVLRSMISQTLFAVSDNESRPIHTGSLFEVEKNGLTVVSVDGYRLALRREAVDKIDGAESFSFVVPGSALSEVEKICS-GEGPVTISQGARHILFQAGETLLVCRRLEGEFLAYRNAIPRNNPIQVECDARTLLASIDRVSLIISEKLKSPLR-CVFGDGMVSITTKTG-IGDAADQCPITG-DGQNLEIGFNNKYLMDALKAAPADKLKLEFSSGVAPCVILPEGEENFIYMVLPVR.. 364
273 0.000e+00UniRef50_A0A268FIL9 Beta sliding clamp n=34 Tax=Terrabacteria group TaxID=1783272 RepID=A0A268FIL9_BACCI  ali  44  1MEFLVDSEYFNRAITDVSKAVSQKTPFPILSGIKIMATKESLIVIGSNADIIIEQVIPMEIDGVQVLEVKEVGSVVLSAKYVSELVRKLP-GKIHLTVNEKQIATLKADEIVTTLNGFHAEEYPTLPSMEETTHIRIESTYLIEMINQTAFAVSKSEARAVLTGVNMLFEDTKLTCVATNSHRLAWRELPIESGVRGA---FIVPSTSLHELTKLMQKTTGMIKIFATDRYIVFKTNSTTLYSRLIEGNYPNVAGLFPNNARTKITVNTKQLLKGVNRACLFASEWKNNNIHMEIKDGSKLKITSNSSEIGKIEEIQPINKLAGEDLSISLDGSFLMDALKAIKEEEIKISFGGSMRPILMEPVGNNSYMHLISPVRSY 376
274 0.000e+00UniRef50_A0A1J5AQ22 Beta sliding clamp n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1J5AQ22_9CHLR  ali  28  1MRLSILQENLSKGLSIVGRAVSSRSTLPVLGNILLSTDENRLKLAATNLEIGVSCWLGAQ--------VEDDGAITLPARLLTDWINSVPPERIDLEVVRTMSMNLKCARFESNIKGIDASEFPLIPTADGEEALGLPAATLRKIIDQVVFAAAKDTSRPSLTGVLTRFEGERLTLAATDGYRLSVRRTLLTAAAPEQAVAIIVPARSLAEVSRISGDPDKPVEVAVARNQILFRLAGVDLVSQLIDAKFPDFNAIIPKGFTTRSVLDTAAFLRSLKVASLFARDASDRVMLQITPGPGLLTLKATSAEAGDNVSEIDA-LVEGDALEIAFNARYLIDVLSVIDTPQVVLETSRSDRPGVFRPVGTEEFTHVIMPM... 393
275 0.000e+00UniRef50_A0A2E1UTI8 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A2E1UTI8_9GAMM  ali  28  1MKIIITKENLIKALQKIIGVVEKRQTMPILSHILFREKEGGFEVVASDLEVQLSASLVLENGSDFTEN------ITIPGRKLFDIGKGLPDEAIEIDKIEEGKLQIRSKKSKFILSALDAATFPLMDASDENNDFIIKSSDFKQIVNKTAFAMAQQDVRYYLNGLYLNLSNKELFGVATDGHRLAKSGVETEFIMQE-SVNAIIPRKGVVEIDKQLEDVEENLNATISKNHLQISNKNTQAISKLIDGKFPDYEKVIPADANMQVIVDCKSLKEALIRVSILSND-RFRGVRLN-FDNNEIKVSANNPEKEEASDDIKA-TYSGDPLEVGFNVNYLIDVLNVIKTKNVQILLKDNNSSALLTPENDNSSSYVVMPLR.. 369
276 0.000e+00UniRef50_C6M528 Beta sliding clamp n=104 Tax=Proteobacteria TaxID=1224 RepID=C6M528_NEISI  ali  27  7.....DRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQAGDF--------RITTNAKKFQDILRALPDSAI-VSLDADNRLTLRAGKSRFALQTLPAEDFPLMSVGEDSAAFSLSQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRLVATDGHRLAYAASQIEAELPKTE--VILPRKTVLELFKLLNNPSEPISVELLNNQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANE-KFRGARLF-LQPGLLSVVCSNNEQEEAREELEIA-YQGGELEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVMPMR.. 366
277 0.000e+00UniRef50_A0A257BDK5 Beta sliding clamp n=1 Tax=Armatimonadetes bacterium JP3_11 TaxID=2012635 RepID=A0A257BDK5_9BACT  ali  28  1MKIQLNRKQFDEALGVVAGAAATRASLPILSHLYLEAQGDTLRLVGSDLEQWVECRIPA--------IVGEDGATTLPARLLTELVGSLGGEEINIETGERHQAIVTSGDSRYQLLGLPAEEYPPVPEIESPSELALPAKHFLEMVDSVEFAVSKEEARQALTGIRMEFEGDTLRLVATDTHRLAVRTACIDSGA-GEPTSAIVPLKAIQLVHKI--PTSDTITLRLGAHRAAFLGENAAVYTQLIEGQYPNYQRVIPQSYTRKWTLIAQDFRNALRRAYLVAR-SNSNKVYLRT-DGEKLVISAQ-GDVGEATERVDLIR-EGDDLEIAFNARYILDVLDVVKSEGVVIELTESLRPAVFKPAETGDYLCVIMPM... 361
278 0.000e+00UniRef50_A0A2D5WXK8 Beta sliding clamp n=2 Tax=unclassified Pelagibacteraceae TaxID=1655516 RepID=A0A2D5WXK8_9PROT  ali  28  1MDFRVNSTDLLKALSHIHGIVEVRHTLPILSNIIXTTNDNSLSLSSTNLDIF--------CSDDLXAEVGQNGSTSVSASTFYEIVKRLPSGEIHASLEEDSTLVLKCGRSKFNLTTISPDDFPKISHDDLNIQFVLSATELKRMIDKTKFAISNEETRYYLNGVFLHQTQKNLRAVATDGHRLAQYDIPLPQGAKDMN-GIIIPKKMIQELRRVLDDANGDINIQLNENKIKFSFNNMQIISKVIDGTFPDYTKVIPQSNDKSITTNNDELKKAIDRVSAVAEETKSKAIKL-IIESNKISLSVDSTSRGSAIEEIDLE-YNSEKVEIGFNSRYLIDICNEIDGDKINLKFLNSTSPAIILDNTDENLFFVLMPMR.. 374
279 0.000e+00UniRef50_A0A2H0BV12 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0BV12_9BACT  ali  28  1MHVACTQENLLQGLSLVSHIAGKNSNLPILSHVLLKTDGGGLKLSATNLEMAVSAQV--------RGKIEATGEFTVPVKLLQDYITLLPSGKVELVVQDD-VLEIVSDGKKTTIKGMPSSEFPLLPKLVGDGGYKIEAEVLREAIDQVAFAVSSSESRPELGGVYFNFGPGALVMAATDSYRLTERIVKLAAGNPTGELRCIVPAKAMQEAARILSATPEEVVWTMNESQLVMNYGSVELISRLIEGSFPDYRQIIPTETATTAVVARRELAKAIRAAALFARQGIF-DVHLEVLADGRLKIASSDSGTGTHSDAIQA-SVDGGENAVTVNFKYMMDGLSALRGNEVVIKLIDAMNPVLLQEKDGEDYRYIVMPIR.. 375
280 0.000e+00UniRef50_A0A2V2RPU4 DNA polymerase III subunit beta n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2RPU4_9BACT  ali  27  1MKFKINRDHFVAGLQKVQNIVGNRVDMPILNNVLIKVEPDHICLTTTNINLGIRCHIKTEPNNQV-------GSITLPVKKLLTIVRALPNLAVDLEASDSYQAKITSGGARFKIMGMSETDFPPLPTIADLEGYVVTQNELLKMLKSVSYAQSTDENRHMLNGVYFSFKEGKLTLVATDGKRLGLATKELPT-TQESEKSFILPAKTAAELERLLG-QEKNVTISFNNKQAVFDIENIYLVSKVVDSIYPNYKQVIPSETVHRVKIDRELLLECLSRAALVTNE-KSNSVKLK-ISNNLLEITASSPELGESQESMAINS-ENANVELAFNPQFLIDPLKSLYNDEVFFEFKDELSPGLFKTL--DSFLCVIMPLRT. 376
281 0.000e+00UniRef50_A0A2V2ENL0 DNA polymerase III subunit beta n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2ENL0_9FIRM  ali  33  4.KFSAPKENLLYGINAVQKAISAKNTVPILSGIYLKAQGGRLTFAATDLEISIECTVPA--------LIISEGDIVLPGRYFAELTRRLPEGEVIFEYQPDSVMKITYENAESSIKGWKGEEFPTISQINGDKSIAIIPSEFKNLVKQTTFCANKDDVRPVFTGALLEVENNQLKMVSTDSYRLSFKAGAIQNP-DSCSFQKVVPVKALEELSRILKDDDEDLHITYNQNQMSFSNSEIHFNTRLIDSNYPDYRRVIPSEHQTLIKFKKRSLQNTIDRATLFSSEKDGTNVIKIKIEDENINITSQS-DYGKIDENLPIYQ-DGENLSIAFNAKYLTDAFKTMDYEDLQATFCGSLGAAVFTGLNDDSYLYLILPLRS. 371
282 0.000e+00UniRef50_D3EYQ5 Beta sliding clamp n=11 Tax=Actinobacteria TaxID=201174 RepID=D3EYQ5_CONWI  ali  25  1MKISAAREELLAQLQTVSRVASTRGAIQALSGVQLIAAGGRVELRATDMEVGLRVPLPAE--------IEREGSVVLPARLIVDVVRSLSGPTATLELRAEQDVELVAGNAQFHIRTLRAEDFPPFPEPESEGVVSVPAKAFVETVLRVANSASRDETRPVLTGIMVSASERELRMVATDSYRLSVKETTLEEPLVGG-FEANVPARALQELARLVQQIDGELSVGVRQNQVVFQIGEVVLSSRLIEGQFPNYRQLLPDSYEHELTITGSEVTDVVRRISLLA--QKNAPLRLS-FAPGELTVSAQTPDIGEARESLPVA-FQGEPFEIGFNPDFLRDGLESVGSGDVMLKLISPLRPGLIQSAEDGGFLYLIMPIR.. 366
283 0.000e+00UniRef50_A0A1V2YHB0 Beta sliding clamp n=11 Tax=Firmicutes TaxID=1239 RepID=A0A1V2YHB0_9FIRM  ali  33  1MKIYCNQKALMSCINTVIKASSTRTSLPILECILINANSNYVTLTTNNLDLGIESTFEAD--------VITNGLIALEAKLLSEIIKKMPNEEIEINLLENNYVSIASGKSKFTIVARTGEDFPALPKVQVQKGYTIPRAALKDMINQTIFSVASDESRPAFMGEMFHIKDNTFNLVSVDGFRISYRQAEIVNEFGEIES--IVPAKALAEIARILPHDDGDVIMYFDNRHVFFDIENTKIVSRLLEGEFLKYSQMFTPDYDTQIIVNCKELLMCIERASVISREGKKHPICLEINTE-QMIIKS-NTDFGTSIEELNAD-IQGKNLTIAFNPRYLMDALKAIEDDEIMINFLSIIEPCIIQPKNGNAYKYLILPIR.. 364
284 0.000e+00UniRef50_K2EHK5 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=K2EHK5_9ZZZZ  ali  25  2MKFSIKRESLLKPLQLATGVVERRQTMPILSHILLTAHGKLLTFIGTDLEVELHGLVNTDHA------VKNPAQITVPGKKFLDICRTLPENS-TIELTENNRITVACGRSRFVMTSLSTKDFPCVPEQKAVMNFELKQKTLRELIEKTSFAIPQQDVRQYLNGLLFEVKDGSIQTLATDGHRLAVHSIESP-VVDSSFAQVIIPRKCVFELMRLLENPDEEVSVSFNNNFVRIKGSNFILISKLISGKFPNYNKIIPKRGDKKVELDCNELKQALTRVGILSNE-LFRSVNFK-LRNDTLVLTTNNPDQEEAIEELTVD-YKNENVDIILNIGYFVDILNAIETEKINIFFKTGDSGIVIEEVGNPNCLYVLMPIR.. 369
285 0.000e+00UniRef50_I0IBA5 Beta sliding clamp n=11 Tax=root TaxID=1 RepID=I0IBA5_PHYMF  ali  28  1MKVICDRRVLIDALALMGGVVLTRTPKPVLSCVKLDADEPGLTLEATDAEISVR-------LRSERVEVAEAGESLLPADKLSSIVRESIDSTITLATDGDVTL-VTGSDSKFKIFGQPVGDFPAVAAFPGEADFRIKAGELHRLIAQTIFATARENSRYAINGVLFERAGQQVTVVATDGHRLALAKVAADGGSDEAVKSSIVPAKTLNLLLRLFDDAEQEVEVKLADNRIHFRTDQAVLASSLVEGNFPPYSDVIPKDGDKKATLPTDGFISAVRRAALLTNEE-SKGVRMA-FAEGGLTLTSRAPEMGEAEVSLPLADYTGDALEIGFNPAYLLDALKVVDDEKLQFEFKAPNKPGVLRT--GPDFLYVVMPV... 372
286 0.000e+00UniRef50_E3HLR6 Beta sliding clamp n=1436 Tax=root TaxID=1 RepID=E3HLR6_ACHXA  ali  27  1MQLVTTRDALLKPLSTVAGIVERRHTLPILANILMRKEGNKVAFIATDLEVQITTHADFGVGQDNE-------STTVAARKLLDILKALPDGDVRLALASN-KLSVQSAKSRFALQTLAASEFPTVAQPEQDVSLTMPQRTLRHLFNMVHFAMAQQDIRYYLNGMLLVFEPGRVRAVATDGHRLAHCSTEADGISERHE--VIVPRKTVLEMQRLLEDSDEPVSIDVAPGQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRHFLVNREALQGSLQRAAILTTD-KFKGVRLQ-LAQNQMKISSSNAEQEEAQEEIDID-YGHEALDVGFNVGYLLDVLANVKVDNIQWSMPDANASALITLPEDDQFKYVVMPMR.. 368
287 0.000e+00UniRef50_A0A2G6CQQ0 Beta sliding clamp n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CQQ0_9PROT  ali  25  1MELKINRAAFLKGLYLAQSIAERKSTTPAVANVLLRSEGDAIVCAATDLRTSMVAELPAE--------VKSEGGVSIGAKHIYEIVRNLPADMVFLSKSENNWAEIKAGKARYKLVGMSDRDFPRLPDHREVVFSEVSAPALVDMIGKTLFSVSTDNTRHHLSGIYFECDGKRATMVSTDGHRLSKIEADL-GTGPTLDAGVIIPRKGVMEIKRLLEPVDETCDLGFADNNIFVRAQDVVLSVALVDAQFPSYKQVIPTANEKAIRLPRAGLLESLKRVSLMSSERSF-GIRMA-LSQGRLRIMSDNPDLGEALEDLEVE-YNDEELTVGFNARYFIDILNEINKDNVILEFNGELDPGLVRPDDSRDYVGVVMPMR.. 366
288 0.000e+00UniRef50_A0A2M7H318 Beta sliding clamp n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A2M7H318_9BACT  ali  26  1MKFSCTQENLNRGLALVTHITGKNVNLPILHNVLVEAKDNAITLSATNLEIGIRVRL--------RGKVDEAGSFTVPAQVFASYVGLVSAEKVDVERADDG-LNIQAGNQNTKIKGEEATEFPMIPEVVLENPISVPASELKMALAQTIVAVSHDDSRPELTGVYTQIEDHRVVFAATDSYRLAERALPIAG--THTERQIIVPGMAMQELVRVLPDDAGDVRMYFSDSQALFMTDEVEITTRLIEGNYPDYRQIIPMEEKTKAVVDRYDLVKAVKAASLFSKSGI-HDVNLQFSPDKQVTLTTVNNQVGENVSKVNAEIV-GDSNSIIFNHRYLLDGVQQVSTPQVVFYVVDGVSPGIIRPHGGDTYTYIIMPIK.. 369
289 0.000e+00UniRef50_D4W3R2 Beta sliding clamp n=5 Tax=Turicibacter TaxID=191303 RepID=D4W3R2_9FIRM  ali  44  1MKIKVDRQLLLTQLSYISKAIPTKTPLPVLTGIKFVVSDEGLYLTTSDSDITINTFLPLEVNDTQVIQIDAVGSIIIPGKYFIEIIKKLNGDTIEISTFEGNYVTIKCGRSEYTLNGFDVTQYPNIELIKNDDPIHMEKQLLKTIIRQTVFSTANSENRPVLTGVNFRYDADELMCVATDSFRLSKKTVPLNKLHD--SFNIVIPGRSLIELSKILDDSHNSVDIYLANNQILFQIGNISFQSRLLDGIYPETKEFVPTTFGIEIKANYHELLNAFDRAALIARDQVSNVVKLNILEESKLLITAQSPEVGKVEEEVQVEMISGGELRIACSALFIIDALKAINNSDVIMSFNGDMRPFVLRDKYDETTIQLIVPVR.. 376
290 0.000e+00UniRef50_D1PRN1 Beta sliding clamp n=33 Tax=Clostridiales TaxID=186802 RepID=D1PRN1_9FIRM  ali  30  1MKFECEKSLLASAIEGVSRAITNRSAIPVLEGIYLKAEGFNLTLTGYDMEMGITTTIEC--------NVLVPGETVLEAKLLLSMVSRMPAGDVRIELTDEGQAIISGGVAEFEIPALNASDYPSLPVTGADNTMTIPTSMMRELIEKTIYAVSQDDKKPAHTGELFVIEPGSLTIVALDGYRLAIIQRDVE---CTRDIRIIIPAKTLQELLKIMGGPDDPVKIDANRRYVVFTTNGYTIMSRLIEGDFLNYESVIPKDNRTRVTVDCKTFINTIERASLIITERLKNPLRIS-FAEDKITVRCQTP-LGKVVDEFPPVAMTGDPVEIGFNNRYLLDAMRYSKCERMVLEINGPLSPVKILPEDGKDFIYLVLPVR.. 364
291 0.000e+00UniRef50_A0A2M8KZI5 Beta sliding clamp n=9 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A2M8KZI5_9BACT  ali  26  1MKLQVTQENLSKALGTVARVANTRNTLPILSNVLLRTVDNRLSISATNLDIAITHYI--------GSKIEKNGAITVPARLMQDFVSSLPDSVLNLELTD-HKLNITTDKYQSSINGIVADDFPVMPAISGGSVWKLPAKDFKKALGQVVLAASGDDTRPVLTGVYFHSRGNEVVAVATDSYRLAENKLA----KHKEPVNFLVPASAISDVLRIVSDTDKEVVITHDEQQVSFKVGDVMLVARLIEGNYPDYRKLIPTKFATVTRLKRADFINIAKVSSLFARESAGSITIKVDKAEKQVSINAVASQLGENTAKATAE-VSGDG-EVTLNSRYLIEALNAFLGEDIEFCFNGKLEPCILRSSSDTGYIHLIMPLRS. 363
292 0.000e+00UniRef50_A0A2M8EID2 Beta sliding clamp n=1 Tax=candidate division WWE3 bacterium CG_4_9_14_0_2_um_filter_48_10 TaxID=1975078 RepID=A0A2M8EID2_9BACT :  ali  29  1MKATVLQENLLPKVAAVARIASAKSALPVLENILLSAEKGKLTLAATDLETGIKTEVGAK--------VEKSGALTVPARLLVGLIGNLPPGKVTLSAEKD-LLTIEAEGISSRINGLAAEEFPAF-TVEGKELFTLKASELKKAIDQVSFAAAQDESRPILTGVLLRIGGGELVLTGVDGFRLAEKKLKVSVSVKSEPGSLVVPARGLIEVGRLVEG--GEVKVSIPETQLLFQTEEFSIFTQSLEGEFPDYEQIIPTNFETKLTFEKEEFVKAVQLTSIFS-ERGTSVIKLSHPAKGTAEVSSQEAELGEVKIEIAIKG-EGKVGEIAFNCRYLSDCLGALDSGRIELSLNSALDPALFRAPSDPSYLHVVMPVR.. 369
293 0.000e+00UniRef50_A0A2N1V4P3 Beta sliding clamp n=2 Tax=Bacteria TaxID=2 RepID=A0A2N1V4P3_9BACT  ali  28  1MKITCQTEDLKKTLQAVQRAVANKGILPVLSNVLLSSDQESLKLVGTDLEIGIEARLEAELNEPVH--------TTLPAKKWFEIVNKFPDEAITLEFKADGTVSLLGQKLTFHLNTLPADDFPRLPLVQRDKVIELNLLEFCQAIRQTCFAAATDSAKTILTGVNVQIQDGQLKMAATDGYRLAVRQLTLAGDSPTAT--AIIPRRTLLELEKLVKDEQESLLMSLTDNHVLFESQDKILTSRLIEGKYPDYNKILPKQFERKIWLETRPFLAAVERVAIMASEQ-THVVSFAV-QSGSLVISAG-AEQGRAQEEVDIKS-EGEPLTISFNSQYLIEVLRTYAEDHIMLQLNSEVQPVVVSAVDKDDYLCMLMPIK.. 369
294 0.000e+00UniRef50_Q6HI40 Beta sliding clamp n=209 Tax=Bacilli TaxID=91061 RepID=Q6HI40_BACHK  ali  40  1MEFIVNHKHFTQALSEVSKAISTKAVIPILSGIKITADQSGITLIASNSNIFIEKFIPSVIDDEQITTILQAGTIVVPAKYFIEIIKKMPSD-IVIKSKNEQTITIQSGEITLNLNGFPANEFPNVPQIDGHTEIQIETKQLIDAFKQTVFAVAKNESRPVLTGVHIELDHNKLICAATDSHRLAIRETLI---STNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDGLQGEKLNISFDGRFMVEVLKAIKEETITLSFGGSMRPILIEAGEQSAVVHLISPVRAY 376
295 0.000e+00UniRef50_A0A0G1D6W7 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1D6W7_9BACT  ali  28  1MKIICTQPNLQRGIVAVSHIAGQGGTLPVLQNILLKAEKGMITFSATDLEIGITATI--------RGKIEQEGAFTVSSKIMNNVVGLLPDENVELEVKGQN-LHIKSGGSKTKINGIEATDFPIIPTLNEGDGVLVEASAFKKALSQAIVAVSQDMSRPELNGALFRFSDSILTIAATDSYRLAEKKVVVKKEGAGLSGQVIVPLKAIREVLRTVEEADGRVLIATHEGQLLFLSTDIRIVTRLIEGKYPDYEHIIPKTFQSSFVVQKEGFLRAVKAAGLFTQMGVNGIVRLH-PEENLLEISSQNTQTGENASTLSVSG-NGVAGAIVFDYRYLSDGLNTIDQDEVTLALNEPTSPGVLRPNGKDDYIYIIMPIRS. 370
296 0.000e+00UniRef50_UPI0004F3D3EA DNA polymerase III subunit beta n=1 Tax=Candidatus Hepatobacter penaei TaxID=1274402 RepID=UPI0004F3D3EA  ali  27  1MHIHLDRAPLLKALQYQQGIVDRKVAIPILSHLLLKTDDGHVEMVGTDLELTLVQKIPA-------IDVKEPGSLTVSAHLFYDIVRKYPEDPIVLKFDATNLLSLMCGMSEFHVPTLPEEGYPSLDDHQATHTFSLSGKEIKRLIDQTRFAMSGEESRFFLNGIYLHAEDNYLKAVATDAHRLALSWVPLPSGADGLK-GAILSRKTVAELRKIVDSDDLVVNAEFSQTRVAFSYDDTKFFARFVNGTFPQYDKAIPQANPSTLKIDTRLFREAVDRVSVISSGDKIRGVRLHV-EKGVMSLSSKGADSGSAEEEVSVD-YEGTPFSISFNARYVLDAVHQIKGDVFFFHFKDAQTPVVLKDVADDKVLYVLMPVR.. 370
297 0.000e+00UniRef50_A0A1F6R8Q7 Beta sliding clamp n=3 Tax=root TaxID=1 RepID=A0A1F6R8Q7_9BACT  ali  35  1MLFTVQKENIYNALNAVIKATATRGIQPVLANVLIETDSDQIKLCATDLDISIEVNIPAE--------IITTGSITLPAKKLVEIVTKLPNQPIKFDLNENNLTEITCGKSKFDLIGISSSEFPTISHIESEDSIEIEIEPLLKAIKETVFAAATYDTNNVLSGIFFQVKDNSLEMAATDGNRL-TRTVKNINSLDGKEYSIVIPARTLNEFSRILTGSDEKVSITIKSAQISFKLTDRVLTSRLLEGQYPKYTQLIPSNYEILAKADKNLLIAALERTSTLVNE-RTSIIKL-IFNDNQLELLAETPDLGDSSDQIDID-YAGDELKIAFNYKYILDTLKVLDSDNVKIELGTSLSPTLFKPDSDEDYLCLIMPV... 367
298 0.000e+00UniRef50_A0A2D9SEJ8 Beta sliding clamp n=3 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A2D9SEJ8_9PROT  ali  29  1MKFSIVKSDFLRPLXHIYSVVEKRXTIPILSNVVIESLENKIAFTATDMEIDIVEEINA--------NVINPGKITVPAHTLYDIVRKLTDNSEIIMSLEQNNLILSCNKSQFTLPTLPFDDYPVMTKIIEGKSFYISSXDLQNLIDNTKFAISLEETRYYLNGIFLHENRDQLRAVATDGHRLAQAEINLPXGAEGMS-SIIIPRKTVGEVRKLLEDTEGDIKITVSSNKIKFLINNCSLTSKLIDGSFPDYQRVIPKENTNNLIVSTRDFKDAVDRVSTISIE-KSRAVKLSLNNNNLVL-KVNSHDTGNASEEIEV-SYNKTPLEIGFNSKYLLDVASQIKGKEIQFALSDSSSPALITDPEQEGIIFVLMPMR.. 368
299 0.000e+00UniRef50_A0A0E9M8H4 Beta sliding clamp n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0E9M8H4_9PROT  ali  27  5...TLTRDALLKPLQIVIGIVERKQSLPILSNVLIEKSQRELKLTATDLEIQVSTSVDVGISKDDY-------AITLGAKKLADILSKISDDDVSLDLSDG-KLQIRSGNSRFNLQTLPSNDFPTLKKIEANVCVVLAQGKLKKLLGQVKYSMAQQDIRYYLNGVLFSLDGPNLCLVATDGHRLAFTSTILENTYPKKE--VIIPRKAINELLRLLDDSDSEIVLNISDNNISAEFSNVFFQSKIIDGKFPDYRRVIP-EYSNHLLLDRKTILSALGRVSILSNE-KFHGVRF-ILTEKNLKIISNNSEQEEAQEDIETD-YRGEALDIGFNVNYLLDGLNNISADTVQISFGGANSSVLIALQNNLEFRYVVMPMR.. 367
300 0.000e+00UniRef50_A0A2A4R4H9 Beta sliding clamp n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2A4R4H9_9PROT  ali  27  1MHLKISRTTLFNQIQRCQNIVEKRNTNPILANILFETHEQNLKLTATDLQSTFSSSQTAE--------ITKQGSFTVEAKKIFEIVRELPETPVELSV-DNHFLEILSGGVKFKLATKPADEFPSEPSDETDLSIDVQASELTRMINSTSFAMSNDETRKYLTGSLFEVSTDGLRIVTTDGHRMALSEVSLDNQSN--ETDCIVPKKAVLEIRRLAETAEYKITLCLGKQQVRVEIDNQRFTSKVIDAKYPVYEDVIPKNNQYEAIVDKNQLDQALRRSMVVAND-FTHDVKL-TFTKGKLAIAAHNTEQEQAEEDLAID-YDGLDIEVGFNAKYMRDVLAAIQSSTVRVQLKDSLSPALLLEADHERSRHVLMPMR.. 365
301 0.000e+00UniRef50_A0A173XV60 Beta sliding clamp n=7 Tax=Ruminococcaceae TaxID=541000 RepID=A0A173XV60_9FIRM  ali  30  1MNIICDKTLLSAAIDGVSKAVTLRSTIPVLEGILLKAEGFQLTLTGYDLEMGIVTTIEA--------NVKEPGEIVLNAKLLSSMVSRMPSGQITIQSADNGKTTIQSGVAQFEIQSMSASDFPELPNTGAEETLTIQTGVLRDIIDRTLYAVSQDERKPAHTGELFEILPDKMTVVALDGYRLAIVERPIKAVK---DIRIIVPSKTMNEVSHLLANDDEEVHICANRRYVVFMTAGYTIMSRLIEGEFLNYHNVIPDGSRTRVTLDTKEFIETIERASLIITERLKNPLRIS-FTAGKVVVRCQTN-LGRVVDEFNAQC-EGDDVEIGFNNRYLLDALRNARTEQVRLEISGPLSPVKVLPAEGSDFLYLVLPVR.. 364
302 0.000e+00UniRef50_A0A2R3MYP3 Beta sliding clamp n=1 Tax=Lachnospiraceae bacterium oral taxon 500 TaxID=712991 RepID=A0A2R3MYP3_9FIRM  ali  35  1MRFKCDKDKLADGLNIALKAVSSRSTLPILQSFLLKSAGETVKCIGNDLEMGIEATVPA--------NIEEEGMIAVNARMFFEIVKKMPDGEITISS-DLTTVKIVSGRSEFNINAEDSKEFIMLPQVEKKQVLTLPQATLKKKIGQTIFSISLDDNRKVLQGELFDIVGDRLNLVAIDGYRISIQSLELKQEYP--ESSIIIPGKTLSEIQKILSEEEEQVSVYFTDKHVLFEMDQTIVVSRIIEGSFPKYMQMFSEDFKTMVEIDRHKFLYGIERAALLARESKKAPVKLE-IKDSRLIITS-NTELGTVYEELEINQ-SGDDITIAFNPRYLLEALKAIEEETVNLRFTIASNPCIIRPEKSEEYKYLILPIR.. 367
303 0.000e+00UniRef50_P52023 Beta sliding clamp n=364 Tax=cellular organisms TaxID=131567 RepID=DPO3B_SYNE7  ali  29  1MKLVCRQNELNTSLSLVSRAVPSRPNHPVLANVLLAADAGRLSLTAFDLSLGIQTSFAAQ--------VERSGAITLPAKLLNDIVSRLPNDDVTLE-DNDAAATLSVGSGQYQMRGISADEFPELPLVQSQEALQLSASALIEGLRGTLFATSGDETKQILTGVHLKVQPDGLEFAATDGHRLAVVKTENAAATPATEFAVTVPSRALRDLERMIAGSDEAIALYHDQGQTVFQWGDQYLTSRTLDGQYPNYGQLIPREFNRNVAVDRKRLLAALERIAVLA-DQQNNAIRLSLPENNRLALAVDAQDVGSGQEAVPAEII-GEPLEIAFNVRYLAEGLKALNTTDIQIQLNSNTSPVVLSPLGPVKITYLVMPI... 371
304 0.000e+00UniRef50_A0A2E6YKQ0 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6YKQ0_9CHLR  ali  28  1MKISCLQENLIKGLSRVQRAVANRTTLPITQNVLLETEQGRIKLVATNLEIAITSWIPA--------RIDEPGLITVPARLFTDLVNSLPPGQIDIESTEEPLINIKTGEVNSQLNGLDPSEFPPIPSVDDGIVCELESQFLKTAIDHVAFAAATEESRPVLTGIKVDVNKNNITFAAADGFRLAVYTGTLETEFDGV-LDFVIPSRGLQEVNRLIESTEETVQLTISKSQAVFHLENAEVVTQLINGEFPPYQTLVPDKHETLAKINVSDFFSASKTASIFARDG-SGILRLLFDDKGNITITSKSDEVGESTNTISAD-IEGSKNQIAFNNKFLTDVLGILKQKDIELLVTSSSAPGLIRPIENESYKYVIMPM... 374
305 0.000e+00UniRef50_A0A2H5VL04 Beta sliding clamp n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5VL04_9BACT  ali  28  1MRAIIERTQLHRELGLIQTVIERRATIPILAYVRMDVTDGQVVFTGTDLDVSMRLGCEARET--------ERGVVCLPARKLGEIVRVLPDEPVVFTGDEQ-RVTLSCGRARFRLAGLPVENFPEVPTFPAERGRSFPAAALGPATERVIFATSLEESRYTLSGVQMEWWDGGFRLVATDGHRLALVD---SSSPSPERSACLIPRKTMQELLRLIEAEEEEVRFAHDANHVYFQVGGRELISRLLTGQFPNYEMVIPKEHGARAVVEASVFREACRRVATLA-DERSRGITLS-FSEGRLTLTARTAQDEEAVEEMLCE-YEGEPLVIAFNSEYLLDFFDVVREGMVEVELKDAQSPALWRPSAD-RYVYIVMPMR.. 363
306 0.000e+00UniRef50_A0A2V2FJH9 DNA polymerase III subunit beta n=1 Tax=Clostridia bacterium TaxID=2044939 RepID=A0A2V2FJH9_9FIRM  ali  33  126MRIHINTQELNAGISTVIKALSVRTTVSILEGIYLEASNGWLLLRCTDLSLQIETNVAA--------TVQEEGAIVLPGRLFSEMVRRLPGEMTFIDVKKGT-ATIESGSFKTTLQGEDAEGFHTMSTVTREHIIKMKCDAFKNMIRQCIFAAAQDDAKPILAGALLEQHEGDLSLVALDGYRLAMRMERIPGGML-ADRSAVIPARSLLEISKILPDSDQEFDMIFSKTHVMIDLSHTNITARLMDGEFIKYKQILPDGHKTRVRVNRQELMSGIDRVALMAREGKSNLIKF-TFTSDKLTI-AANSELGRSHEEIAVDAM-GEDIEIAFNAKYFTDVLRVLDEDELYLDMNNNISPCVVRPVQGSAFYYLILPVRLF 491
307 0.000e+00UniRef50_W7KRE9 Beta sliding clamp n=4 Tax=Bacillus TaxID=55087 RepID=W7KRE9_BACFI  ali  41  1MKFEIQKEVLIHAVGVVIKAISPKVSVPILSGLKITATSKEIIFVGSNNDISIQKTVPLEKNGDEKAKVHEEGSVVLNAKFLNELVRKVPKDDITFTVEKNNVTKIKSGKSVFSLNGFPAEEYPKLPEIEGEADFTLSAGDLNSIVKQTAFAAATSELRPILTGINLNLKDG-LKAIVTDSHRLAIKELKL----AGEDRNVTIPAKALIELSKVFEDQEEQVEVILKDTQALFKSHNLLFYSRLLDGNFPQVSKLLPTTFNTTLKVDRKGLSAALNRCALI--ESKNKVVVLEV-KDKQAVLTVSSPEVGQIEEYLEDFEIEGKDIKIAFSYKFTQDALSAFEDEKVQFQFVEALRPFIIKGEKCDSVTQLVLPVRT. 370
308 0.000e+00UniRef50_A0A231HH31 Beta sliding clamp n=2 Tax=Betaproteobacteria TaxID=28216 RepID=A0A231HH31_9BURK  ali  26  1MQLVTTRDALLKPLSTVAGIVERRNTMPILANVLLRKNGNQVSFLATDLEVQITTHADFGVGDETE-------STTVAARKLMDILRALPDNDVKLALSAG-KLSIQSGKSRFALQTLPAGDYPTVSQPEADVSFSLPQKTLKHLFNMVHFAMAQQDIRYYLNGLLFVFEPGLVRTVATDGHRLAHCAAAVEGI--EQKHDVIVPRKTVLEMQRLLGEVDDLVQVDVASGQIRFRFGDVELISKLVEGKFPDFTRVIPTTYTRHFQIRREALQGSLQRAAILTTD-KLKGVRVQ-LGDNVLKVSSTNAEQEEAQEEIDID-YGHEALDVGFNVSYLLDVLSNVKTEEVRWSVQDPNSSALITLPDDDQFKYVVMPMR.. 368
309 0.000e+00UniRef50_B1XL06 Beta sliding clamp n=10 Tax=Cyanobacteria TaxID=1117 RepID=B1XL06_SYNP2  ali  28  1MKFVCSQSDLNSQLSLVGRAVPSRPTHPILGNVLLTADANQIQLTAFDLSLGIRTSFPAQ--------VIEGGTLTLPAKLLNDIVSRLPEGEVTLSMKGDAQATLTAATGRFQIRGMGAEEFPELPTIQDGKKLMLPAIALSEGLGGVLFAASPDETKQVLTGVHLTHHQDCLEFAATDGHRLALVETS-DQVSPEPESSLTIPARALRELERMLANEADLIALHLDDSQVIFEVNHQHLTSRKLDGAYPAYHQLIPRQFSRDVTLERRALISSIERVAVLA-DQKNNIVKFRLNSEQKLHLAVEAQDVGSGEEALPAQ-VSGTDLEIAFNVRYLIDGLKALPSNEIKMQLNENNQPVIFTPLGAVQMTYLIMPV... 390
310 0.000e+00UniRef50_A0A2F0AMG6 Beta sliding clamp n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2F0AMG6_9DELT  ali  26  1MKFAINRDLFGKALGRIQGVLSRRASLPVLSNVRLEVDEGKLRISATDLDVTYDGYLLCRSAAK--------GSVTVDGKRLYEVVRSLPGEEVDIDVTDESRIVLKCKNAEFVLLGTSSDTYPALPDAHGVKLFSVDGVGLRELLERSMLSISTDESRPNLNGVYFRLDNNRICMVSTDGHRLSQGERSVDRDAPIPEHGVIIPRKGILELKRMLDEAGKEVSFGFLDNNIVIASSNSFLFVRLIDATFPDYMQVIPKSSERVIVLDRVPFLDSLKRIGLLASE-RTHGVRIE-LTDGLMTLLSDNPEFGKAREEIEID-YNGGDLIIAFNAKYVIEILSTLGAAKVEMALNEALSPGLFREHQNDEYLFVVMPMR.. 369
311 0.000e+00UniRef50_A0A1W2BCY6 Beta sliding clamp n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1W2BCY6_9FIRM  ali  33  1MKFNCNKSDLIDAISIVQKAIKTNSTVQILDGILIQADENGVKLTGYDLETGIEADL--------VSDVKENGSVVVNSRFFGEIVKRLPEEMTTISSDDRNQVTILSGSANSVIKGNSAESYPKIPIIDNKDRITVSQKLLKNMINHTIFAVSKDDTRQSLTGCCLESDGKTISMVAIDGFRMALRRE--DAGSDFPVMNFIIPGKALSEASKIFENDDNEVIIYSSSNHLLFDVGHVRIVSRLIQGPFVNYNSIIQKNPKSIMTVSRKDLLDAVDRAALIITDERRCPVQLTMSDDTTLMVSA-NTETGTHKEDIDV-TVEGDTVDIDFNSRYLIDALKNIEDETVRIEFNGSQGPCIIVPTEGNSYVYLILPIR.. 368
312 0.000e+00UniRef50_A0A2W4KHE4 DNA polymerase III subunit beta n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4KHE4_9FIRM  ali  31  1MRVTVDRDALVAALGTAARATRTNATLPVLAGVLVQASETAVRLTATDLDLTIQTSVAA--------TVEDPASIVLPARYLLELTRRLPPGEVRIEVQDTAAV-VQAGRSRFTLHGMPARTFPAVPSIEGEP-VMLNAGALRDLLRRTRFAVLADETRPILTGVELRGDGERLRAVATDSYRIACAEKH--GLGFKPIPSTVLPGRALAEVERLLRDDEESVTLFLAQSSATVEVGDVRVTTRVLEGQYPDVLGLVPQEYPHQARVNRQELVDALGRADLLAHTQSKHQVVLD-FDAGRIVVTAQDPELGTAREEVPA-GYEGQRLVIGFNARYLLDGLRVIDAEEVEIRLIDPKSPAVVQGVGEDGFRYIVLPV... 364
313 0.000e+00UniRef50_A0A2D5HKA9 Beta sliding clamp n=1 Tax=SAR116 cluster bacterium TaxID=2024888 RepID=A0A2D5HKA9_9PROT  ali  28  1MKIITEKSALLKPLSHIQGVVEKRNTIPILSNVVIKADEDGLSLSATDMDIDILEKFNC--------NVINPGSVTVTANIFYDVVRKLMDGEIQIEFNGGT-ASLISNKSKFQLPVLPVEDYPNLNQDDLPINFKVTVDELCKLIDKTKFAISMEETRYYLNGIYIHKHDKKLIAVATDGHRLARTSISLPSGA-DLINGVIIPRKAIYEIRKLIEDHDDQVSISLSDSKIRVKISNTIITSKLIDGNFPDYEKVIPKNNDNIVKLDCLVFSESVDRVSTIFSD-KSKSVRLS-LSKNNLSLEANSPDTGSASEEIGI-TYDKDDISIGFNSRYLLDVTSQIGSGDLIMALKDSGSPALISLPDDTESLFVLMPMR.. 367
314 0.000e+00UniRef50_UPI0006D0EEA0 DNA polymerase III subunit beta n=1 Tax=Methylogaea oryzae TaxID=1295382 RepID=UPI0006D0EEA0  ali  22  1MKLNVARADLLGLLQKVMGVVERKQTLPILGNVLIHSEQGRLSLTATDLEMELIA-------EAALPEVSEQLAVTAPGRKLLDICRSLADGDVGL-LVEGDKLRLQSGKARFTLATLPVDNFPSFEAPAVEERFVIDGSKLRRALEQSMFAMALQDVRFYLNGLLLEVEGTALRAVASDGHRLAYSEQILDAPVNAQK-QVIIPRKGVVELHRLLGDWSGEVELTLGGNSLRAVIGDTVFSVKLVDAKYPDYRRVIPSDVGRVISVDKESLKQALARVSVVCQE-KFKSVRFD-FTAGTLSLSATSPEQEEASDVVDVD-YQGKPLETAYNGSYIMDALNHCGGESIRFGIADGSTACVIASEGDAASRFVVMPLR.. 366
315 0.000e+00UniRef50_A0A0G0R235 Beta sliding clamp n=15 Tax=root TaxID=1 RepID=A0A0G0R235_9BACT  ali  27  1MKVKCHQKDLALALNLVNRAVSTNTTLPVLNNILIKAQGKKIYFSATNLEVAITYFIEAD--------ILNEGAITVPAKLITNYISLIKEDEINLKLDEGTTLDIKTAFSHTKIKGIDSSEFPVIPEIQKGEQFTIKSSLFLQAINQTSFSASMNLARPILTGILFQFEKDKVVMVATDSYRLSEKKVPILTNVSK-DSNYIIPVKTIIELGKILGGENDDVECQLSKNQIAFSVQNLRILSRLIEGVFPDYKKIIPDDGKTNVTLNTQDFIMAVKKVSLFA-EETNNNIKINVTNDGKLILSTSETQIGEGVTEIEAI-VKGENNQVAVNAQYLLDILAHINDENIQLIIDNKLSPITIHPAQKKDYTHVIMPLK.. 369
316 0.000e+00UniRef50_A0A1V5KMB4 Beta sliding clamp n=1 Tax=Firmicutes bacterium ADurb.Bin467 TaxID=1852894 RepID=A0A1V5KMB4_9FIRM  ali  34  1MRFTCPTPALMEGLQIVTRALTARTTNPILEGVLLEAQSGRIQLTASDERLTITTRVDCD--------VREFGRGVLPGKLFSEIVRRLPTDTTEVRMSDRFLFTLTSGASRLNVAGQDPDLYPALPKIDGDCEITLPQDMLRDMIQKTEFAIASDDAREVLTGCLLEIAGGDVTMVALDGFRMAYKRAKCSDVLEN--VSAIIPGRAVGDIGKLLSGEEDAFTLNFNGNKLQIRLQKTDVYVMLVDGEYINYRRILPTSFNMRAIVNLEALRRAIDRAALLAREGSNNLIRF-YLHDGILEIEANS-QMGDAHEEMEVE-IDGSELAIAFNVRYMMDVVRAIDAESVEMSFTSSLSPCVISPVGDGDYVHLVLPVRT. 366
317 0.000e+00UniRef50_A0A2M6WP91 Beta sliding clamp n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M6WP91_9BACT  ali  25  1MTFISLQENLKQGLAIVSRIVSKNINLPILNNILFKVNKSNIELIATNLEIGITHQV--------RGKIDSEGEFTVDSKIITDYINLLPGDKVECE-QDGSEIKIKCQNYKTKINIQDASDFPLIPKVNKDSFYSVPIDDLRSALSEVIFAVANNETRLELSGVLWLFTGDSLILVGTDSYRLAEKKIKIKSNYESPINKVIVPARTLQELIRVLSENAGEIKICLSDNQILFIFGSTELVSRLINGGYPDYQQIIPLNYKTRALINKNELMRAIKASAIFSKAGVNDVALDFKSETGKITISSASSQVGESSVELNSE-IEGDNNEIIINYRYFLDGLNNISSDIIRLDLVNSGTPCVLRPEKTDDYLYIVMPIR.. 375
318 0.000e+00UniRef50_K1MFW9 Beta sliding clamp n=4 Tax=Facklamia TaxID=66831 RepID=K1MFW9_9LACT  ali  36  1MKFTINRSKLIQELSNVQRAIPGKTSMEILLGIKLNLTSNGLYLLGSDSEISIESFINV-NKEDAHLKIEETGSVVLPARLLNDIVKKLASDEVKIEVETDYVTKISAANAEFKIIGINAEDFPHLPTIEEQSQIILPAAQLKKVIDQTIFSASNQELKPSLTGLYLAIDKDQLTAVATDSHRLSQRKLLLENQHLSGITPMILPKKTVKELARVVPDY-ADIKMTIASHQVVFQFENITVYSRLIDGTYPDASRLIPTEFNTEVVLNAQYFSGAMDRASLMSHEGKNNIVQLS-IEDQHVELKVLGAEIGNVTEEIEYQELVGENIKISFNPDYMNEALKSFGDQTICLQLISPVRTMLLKPEKDSKLLQLLTPIRTH 380
319 0.000e+00UniRef50_A0A258XAW3 Beta sliding clamp n=1 Tax=Alphaproteobacteria bacterium 16-39-46 TaxID=1970490 RepID=A0A258XAW3_9PROT  ali  26  1MKATIGRSELLKALQHAKGIIEKRTTVPILSNILIEAQGNELTLSSTDLELSIHESLVAE-------KVEELGAITVSAQMLYDIISRLPEDELSCTVDGREPFNVKVNRSTFRLGTLPAEEYAEIKRVVSPYEFTMKASDLGDLIEKTRYAMSLEESRYYLNGLYFEFNDDKLRAVATDGHRLAKAEIQFGKNVEGQSLKIIVPQKTISEVVKLL-DKGGEVIVSFSSRSISFTFGGVHLQSRLIDGAFPDYEKVIPNDNPFFLKVPTKLFADAVDRVSVMASD-KTHTIKL-TIQEETLMLSSSNPELGTAFEEVEV-SYAGVPFETGFNARYLLDAARHVKGDMLSIALKDPGSAILLQDEKDPGLSFVVMPMR.. 381
320 0.000e+00UniRef50_A0A1G1VUH8 Beta sliding clamp n=2 Tax=Candidatus Chisholmbacteria TaxID=1817900 RepID=A0A1G1VUH8_9BACT  ali  28  1MQVSVLQDKLVKGLSSVAYAVSSKPSLPILSNVLLTAKEGILQLAATDLSLGIQLRIGAK--------VKKEGAITVPAKVFGELVSSFPLAPVELSLEGES-LRIQCGSYRARLSGIPAMEFPSLSQVSGTGEFSLPVSSFREAVERVVFAASSDETRPVLSGVLLRLEGNGLQFVATDGYRLSVVQLSSDSEKKGEKEGLIVPARALRDVDRLADEGASEVSFGLEQNLLMFRLGDGEVTTRLIEGSFPNFSQVIPKEEKIVANIDRESLLRAVRAAAIFARDSAN--IIQWKLQKTGLTISANAPSYGEGENMVEI-SLSGGEGEIAFNSRYLLELLSIFPTEKIVFGMNGGLDPGVFRPAEKEAFFHLIMPVR.. 379
321 0.000e+00UniRef50_A0A0G0K1M4 Beta sliding clamp n=15 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0K1M4_9BACT  ali  27  1MKISSLQENLKNSLAAVGHIAGKNINLPILNNVMIEAKNGDIKFITTDLEVGIVCK--------ARGKIEKEGVFTVEAKIISDYISLLPNKKVDLEVDKKNLL-IECENYKTIIKGQEADDFPLIPTVDKNIYFKLSIKEFKKILSQVVFAVANSETRIELSGVYFLFNKEKLTLAATDSYRLAENEIKIKTNTEE-ERSVIIPAKTLQEVLRILSEEENELTFYLSDNQILFTVANIELVSRLIEGQYPDYKQIIPLNHKTRAIINKSELLRAVKAAALFSKTGI-NDINFDFPQKNKVIISAASGQSGENITELDA-TVNGDDNGIVVNYRYLLDGINNIDSEEIVIELTNSNTPCILKSKTESSYLYIIMPIK.. 374
322 0.000e+00UniRef50_A0A1U9NHA1 Beta sliding clamp n=11 Tax=root TaxID=1 RepID=A0A1U9NHA1_9BACT  ali  27  1MKVKFNRAALQEALGLVTSVVPSRTPKPILQCVQIKTEVDAVTVCATDLEVGINYQV-------TQVEIEEQGEIVVPADKLSSIVRESVDEVIAIEESE-ATVEIKGADSHFTIYGHDADQYPSVPGFEGDAHFTISLGKLQEGIELTVFAAAKESTRYALNGILWEVEGKKLTLVATDGRRLARCAVNLDTVEKDPDGRIIVPAKTMNLLDRVGGSADTKVSVRFVDNQIVISCGQVIISSNLVEGNFPKYEDIIPKDYTNSIGLNTDAALSAVRRAALLSNED-SKGIKLA-LSDNKMTFSSRAPETGDAQVEMTID-YSGGEMEIGFNPAFLIDVLKVIKADDFKLELGDSERPGVIRS--GDQFLYIVMPV... 365
323 0.000e+00UniRef50_A0A2A4SVH7 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SVH7_9BACT  ali  28  1MKFSVSREQFLHGLNLTSRAVSTNNTLPILANILLHSEGNKLYFQSTNLEISIRYFI--------QTDIQNEGKITIPARLFQNYVNLLHDDEISIHVANGDTINVISNNSKTQIKGIPAQDFPQTPTVERQFELEVPAKKLAEGITQVVFSAATGNARPILSGVFLRGQKNELKLVATNSYRLSEKKITLEKPL-DTELQAIVPARTMQELGRIIADSSEKVTIIVSDNQILFKVGNVELTSRLIDGMFPNYEQLIPKNAKSNAKVEKSSILQDVKRVNLFARENNNNIKVKFNPEESKIHITTEATQIGTEEANILA-NIEGEENEISLNSEFFLDILNALPAGELHLSVTDKFAPILIKHKDMSDYLHIIMPLR.. 368
324 0.000e+00UniRef50_A0A2W5EGI2 DNA polymerase III subunit beta n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=A0A2W5EGI2_PSEFL  ali  27  1MKLSISRETLFKALRHMSAVVEKRSSIAILGNVRLKAENNRLETTATDNDLSVQGIAEA--------FVDQAGTTTVGALKLFEIVSKIPEGMVSLETDGGSRLAVVAGKAKFSLATLGAEAFPDMTKVEDGVSFKLTATELKKALDRVQFAASTDETRAYLNGVYFHVKVKLLRTVATDGHRLAKADMTCPEGAADMPA-VILPRKCVTELKK-LADEAKDITLTVSEKKIQAEATDITLTSKVIDATYPDYDRVIPKGNPTQLTVARRSLLQAVDRVSILSHE-KTRSVRFNAI-ENALALSANNPDQENANEEVKAE-YAGTPIEIGFNAKYLSDIGTQISGDDIHFFLKDASSPVLVKDPADSTTTFVVMPMR.. 374
325 0.000e+00UniRef50_A0A2E6P5S5 Beta sliding clamp n=18 Tax=root TaxID=1 RepID=A0A2E6P5S5_9GAMM  ali  22  1MKFQLKRDDAINPLALTTGVVERRQTLPILSNILLETIDGVLRLIGTDLEVETQIEIPVDMDGLIA------GKSTVSARKLLDICRALPEGSLLKISQQQSKVNIQCGNSRFSLQSLPAEDFPRLDDTEWEERVRLNQGALRALLDKTSFSMAHQDVRFFLNGVLLELSETELAAVATDGHRLARSAMLLSEPITS-SRQAIVPRKAAQELNRFLDNTDDPVTVEMNPSHLRFSRAGAVLTTKVIDGKFPDYRSVVEQNLTRTVLADRVELYEVLARTAVLTNE-KYRGIRMEV-ESGGLKVTAHNPDQEEASDQIAVD-YSGEKIEIGFNVAYLMDAIRAIHEEKIEILLEDENSGCLLRGPGVENTQYLIMPMR.. 369
326 0.000e+00UniRef50_A0A2M7ILD2 Beta sliding clamp n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7ILD2_9BACT  ali  25  1MKVICTQENLTKGLNITSHIAGKNITLPILNNILIKIEQGKFNLISTNLDIGIKTSV--------RGKVEEAGEITVPARLFSEYIALVSSGNIELTRKDNDLV-IGAGEQQSVIKGQGADEYPIVPEIEGVEYFSLETMEFKEVLSQVIFSASYEDIRPELSGVLFLSQDDKLVFVATDSYRLAEKIISLGKENEKIKIKKIVPLMVLQEILRILGDNQGKVEIGFNENQIIFKFDETVIISRLIEGNYPDYKEIIPSEYRIRAMVDRNSLIKIIRTASLFSKKGINDILLEFNSKEKILKVSAANMQLGENKATIGIES-EGENNSVVFNYKYLLDGLQNMPSKKIVFELSSSDSPVVLKPEGIKDYLYLIMPIR.. 368
327 0.000e+00UniRef50_C8VV98 Beta sliding clamp n=2 Tax=Desulfotomaculum TaxID=1562 RepID=C8VV98_DESAS  ali  36  1MKFISTKDNLLYAIQTVQKAVSPKSLLPILSGILFKAYDNTLIVRATDLELGIECFLPVK--------VIETGEIVLPSKYIIDIIRRLPDTVIEFESNDYNSITIKYKNSQANIHGFAADEFPMLPPLNDGFTFLISTSIFKKMLRQTIFATGTDENRPVFTGIHFQILEQEFKMVATDTHRLAMITEHLPLIKQELP-GIIVPGKTLSELLKILNSTDEEIKITVTENQIFFLLNEINIISRLIKGQYPNYHHVIPKDIIAKIKIKLSDFIQSVERASLLSS-SISQHIRIDCENSDFIVISSNN-EAGHIYEEIPV-FFEGEALQIYFNSKYLMDALKAVDSEEIYLELSGPINPCLLR-TEDRNYLSILLPVR.. 366
328 0.000e+00UniRef50_A0A0X8X6S0 Beta sliding clamp n=1 Tax=Halorhodospira halochloris TaxID=1052 RepID=A0A0X8X6S0_HALHR  ali  26  1MKLQAQRENLLPVLQHLVSIIDRKQTWALLNNILIKAEDNGLRFVATDMEVELVANIQAD--------VTDNGMVTLSSRKLMDICRNLPEESLDIELSGNKVL-LTSGKSRFNLGTMPPDEFPVLGSIEIAESVTVKQNELKDLIERTYFSMAQQDVRQTLNGLLLELTGTGARAVATDGHRLSLVDSS-SAIKVNNPYQVILPRKGVQELLRLLSNSEDIAELQLGKKHLRVELDGMCMTSNLIEGSYPDYNRVFPSEIDHSLVVCRDSLRQAISRVMVLSSE-KSRGVRLAA-EEDALRVFSHNQEQEEATDEIEAE-FGGELIEIGFNGSYILDALNAIEGEKVEILIGRNNSSGVFKGIGDESARYVIMPMR.. 367
329 0.000e+00UniRef50_A0A2E9A2N7 Beta sliding clamp n=12 Tax=Bacteria TaxID=2 RepID=A0A2E9A2N7_9RICK  ali  29  1MKFIVQKSVIFKAMSHVQSIVEKKNALPILSNILIEAKDNNIILSSTDMDISITEKIEC--------SIIENGSTTVNASTLYDIIRKLPENEIELISNDGKILSIRSGSSRFSLGCLPKEEFPIIEYENEGVKINIDSQVFLQLIEKTKFAISNEETRYFLNGLYFNLKNKFITIVGTDGHRLSKIDYE-NQNLSDETMGVIIPKKTINELSKLLSESTGQIEINLTSTKIIFYINNSVLLSKLIDGNFPDYKRVIPLENNNILKVKRINFVEAVDRVSTI-NIDKLPVVKFKLL-NNLMNISTSNNDNNTATEDIETD-YSGDEIEIGFNSKYVLDMLNNLDDDEIILSFKDNSSPITATEKSNPNLVYVLMPMR.. 370
330 0.000e+00UniRef50_A0A2H6HVA1 Beta sliding clamp n=1 Tax=bacterium BMS3Bbin04 TaxID=2005727 RepID=A0A2H6HVA1_9BACT  ali  28  1MRFRVAQDRILEALNRVAPTVPTKSTLPILSNMLFNLEGNMLRIVATDLEVSVVTELEVDG--------ERDGSVTAPAKKIQDIVRELEGLVLTCDVDENNHLHLETEIGQYQLLGSSAQEFPALPEFEGATTISFGAEKFLSIITRTVFAVSRDELRPALTGVFFQIRSHELRAVATDGHRL--VRIIDQKFESESEHELIIPVKALDIIRRNLPEA-GDVEFAIGENQIQVKLPDTILYSRLIEGRYPHYESVIPSENNNRMFVSTDQLVRSLKRAQIFAN-PINRQVVLN-LETDKVEITAEDIELGKGREQIAA-KYEGEPQTIGYNASYLLDLLKHITTEDVRFDLGGSKQAGIVKPTEGEDFLMLIMPVR.. 367
331 0.000e+00UniRef50_A0A2D6DQY4 Beta sliding clamp n=11 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2D6DQY4_9BACT  ali  27  1MHLFCLQKNLKQVLNITGRIIGRNLTLPILNNLLLSVENNKLKISSTNLEIGINSWV--------SGKIQKQGSITVPAKLISDFVNNLPNEKIELKTKAQ-QLEIKCKKFKAILKGLSADDFPIIPKIKDQSPIIIKGSILKNSFSQVVEMASVSESRPEISGIYMKLNKNTIKLAATDSFRLAEKNIEINSKSLNKEYSVIIPQRTIQEIIRILGEKEQEVKIILSGSQILFNFNDTQVISRLIEGQYPDYQQIIPSNLQTQVIINKQELISNIKIASLFS--GKINDIKMSVPKKSLVEILSKDADIGENKSKIEA-KIQGKEIETFFNHRYLLDGLNNIFSDKVMIGLNDTAKPVVIRPVGDTSYTYVVMPIK.. 380
332 0.000e+00UniRef50_K9R516 Beta sliding clamp n=10 Tax=Cyanobacteria TaxID=1117 RepID=K9R516_9CYAN  ali  29  1MKLVCNQSDLNTHLSLTSRAVPSRPTHPILANVLLQADNGQVSLTAFDLSLGIRTTFKAE--------VLEAGTITLPAKLLNDIVSRLPEGEITLDLGEGLTVTLKPKSGRYEVRAMGAEEFPELPVTENEKAIHLPASALIEGLGGSLFATSADETKQVLTGVHLTVKQDALEFAATDGHRLAVVETTNENLNDDEEVQVTLPSKALRELERMLSAEDEPVAMYFDQGQVVFEWQNQRLTSRTLEGQYPAYRQLIPSGFERELTLDRKQLISALERIAVLA-DQKNNIAKLSIDSESQITLSVETQEIGSGMESMPAQIL-GDDIDIAFNIKYLMEGLKALPSAEIQMQLNNNLAPVIFSPVGGIKMTYLAMPV... 386
333 0.000e+00UniRef50_A0A2M7ASH0 Beta sliding clamp n=8 Tax=Candidatus Shapirobacteria TaxID=1752721 RepID=A0A2M7ASH0_9BACT  ali  29  1MKFSLLEENLNPALTHVSRFVSAKAQLPILNHILFSTDSGRLKLSATNLEMGINFWVGAK--------IETEGSLCLPAKDITEFVSYLPTGKIDFNLSDKELLSVKSAKATSTFTTLPPSDFPVIPSLDSKTAFDFDLPVLDQSVSQVAFSAATDDTRPVLTSVLCRFSATSLTLVATDGFRLSVKDIKLVNPVENNEITLLIPAKSLMEVLKLSASSPKKIGLTLDRHQVVFVLEDLELVSRLIEGDYPNYERIIPESSLTKIFVNKNELAQAIRLASVFARQSA-NIVRFSV-KKTSLELSANAPQIGQNQISLDA-RIEGGPLDIAFNYKFISDFLAVTKGDEIVIELNEPLTPGAFRDQSDPHFLHIIMPVR.. 371
334 0.000e+00UniRef50_A0A136Q472 Beta sliding clamp n=6 Tax=Clostridiales TaxID=186802 RepID=A0A136Q472_9FIRM  ali  33  6MQFTCAKEDLLTAIGTVNRAASKKT---ILECILFSCAEDVITLRATDIALSIKTEMNAQ--------IEKTGDAAIPAKLLYEIIGRFPESDVTFRSVGENSVEISCLNSKVVLQQMNADEFPVFPELENKEQIKLPQCALRTMINQTLFAAAVNEDKPILTGLLFDIEKDSLTIVALDGYRMAVRKQP---AISDISKKCVIPARTLREVSRIISETEENVKISISGNMALFEAGNTEIYTRLLEGEYINYRNLLPADCATSVKVETNMLKDSLERASILAREGNNNVVKFE-ISEKNLEITSNS-EMGNIDEQIPVLT-EGKDLKIAFNAKYVLDVLKNVEESEVLMQYNTGVSPCVVKQENSDAYEYLILPV... 366
335 0.000e+00UniRef50_C8NI23 Beta sliding clamp n=5 Tax=Bacilli TaxID=91061 RepID=C8NI23_9LACT  ali  45  1MKFSVNRQGFLKNLVDVQRAIPSKTTIPILTGIKLVASEEGLTLTGSDSEVSIEVFLPIE-DEELQLTVQEPGSIVLPARFFGEIVKKLPLNLFSIETNDQLQATITAGSASFTLNGLSAVDYPQLPEIEKNHVITIPVPLFRQVIVQTAVAVSTAESRPILTGIHMVIKDNKLKAVATDSHRLSQRIIPLPAGSDALTFEMTLPGKTLLELSRII-DGLETIDFAITDNQILFQTETLSFYSRLLEGMYPDTDRLINDGANTSITVVASELVAAVERASLMSHTDKNNIATL-TLSPERILLTGKSPEVGTVEEEIAVENFEGAPLEISFNPDYLKEALKLFGSSEAVINFLEANRPFTLKLKEDHSFIQLVTPVRTF 383
336 0.000e+00UniRef50_A0A1M6AM81 Beta sliding clamp n=2 Tax=Dethiosulfatibacter TaxID=448125 RepID=A0A1M6AM81_9FIRM  ali  32  1MKCNVNQSDLSKAIGIVQKAVSVRTTTPILTGILMEVENNKLSLTATDLDLGIKTTIDCQSS--------EDGAIVANARLISDFVRKLPSKSIEITTDEYNKMDIKCMKSDFVILCNSADEYPSNTFYNEGMSINMKSQALKRLIKYTTFAAAQDNMKPVLTGCLMELEQNVCTFAAIDGYRLSVKKEEVEF---DGECNIIIPSKSLLEVSRILEDEDQDVEMLVSETHVSFVFDDTVIISNLLEGEFIKYKDIIKDGYQTKINIKTIDLKNSIERVSLLAREDKNNLI-IITIEDDNLKIESTS-EYGNAEENIEVQ-MEGDDIKIGFNSKYILDLLRVVEDDELSAIFQGSLNPCIFKLPENEEFIYLVLPVR.. 364
337 0.000e+00UniRef50_A0A1J5IKJ7 Beta sliding clamp n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IKJ7_9BACT  ali  26  1MKFSCLKSNLNPIVQLASKIISTRPTLPVLNNVLLKTDRGGVLVSSTNLELSMSAFVGAK--------VETEGGITVPAKLLAEFINSIPDEKISLEFKD-SRLEVTGANYSAAFNTIDMDEFPEPPAMKGEDKVLIPVPVLRDNILQVALAAAADESRPVITGVLMVIDGKKFTLAAADGYRLAEQKVTLSEDSGKSNLRLIVPARGLHELHRLLFDAGEKVEVSFDENQALFKYKDIQLTSRLLAGQFPDYQQIIPKKFASTVTVERAEFSQAVKTAAIFAKDSASVIFLSADPAKKTLELKASTSQVGENNISVAAE-ITGPGGSIAFNARYVSDMLAVTTSAKVSLNINDALSPGVLIPDTGAGYTYVIMPIRT. 372
338 0.000e+00UniRef50_F0HQC7 Beta sliding clamp n=33 Tax=Terrabacteria group TaxID=1783272 RepID=F0HQC7_9ACTN  ali  29  1MKFSINQSELQNALSVVLKGIATRSTLPILSGIYLDAHDDTLTLQATDLELSIQYSVSA--------LIEETGKAVVPGKLFSEIVKNLPDAAVHVAAEDDSAV-ITCDTASFSIKTLDAEDFPGFPHVDVQQEVSIPFTQFASMVKRVARVVSKDESRAILTGVLITLEDTTLKMVATDSYRLAITEAELPESSAE-EFQAVIAGSFLQEISS-LPRSEDDLKLALAENQIVVTYHDTVFINRRLEGNFPNYRQLLPDSYATRVSMDVGHLVAGVKRTSLL--GQTSSPVRFDIMASQTVQLSAVAQDVGSAQETLSCEG-EGEDVEIAFNYAYVLDGLSSVNTDNVFLEVQSSMKPGIFKADEGENFLYLVMPVR.. 364
339 0.000e+00UniRef50_A0A2M6WXI8 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_41_12 TaxID=1974513 RepID=A0A2M6WXI8  ali  30  1MKIRCKKSNLQRGLSVVSRIVSTRTTLPVLGNVLLRAQDGRLDMTSTDLEAAMNVEVSAK--------IEQDGSITVPLKTFMDFVLTVSDEEMAIDTSGADVL-VKSSHYSVNIKGIDASEFPIIPKIENPKIFKMKSLALKKSLPKIIFAAALDETRPVLAGVYMKMSGNKLVLAATDSYRLA--EQKLETQANIPESTVIVPSRTLAELERILPESDEAVEIKMGENQIEFATGSILFMTRLIEGAFPDYEQIMPKKFESEIEINKNEFGEALKVAGIFARESSNN-IKIAV-AADAITLKAASANLGQTEARVKAQ-VKGAGLEVAFNGKYILDAIANISGETVALGLSGKLSPGMLTSGSEKDYRYVIMPLR.. 363
340 0.000e+00UniRef50_A0A1C2G1Y9 Beta sliding clamp n=2 Tax=Acidiferrobacter TaxID=986106 RepID=A0A1C2G1Y9_9GAMM  ali  24  1MRMSVTRDDLLKALNVVGSVVERRQTKPILTHVLVAAGDGEIVFTGTDLELEVVARCPAD--------VQEPGKVTVSGRKFLDIVRTLPSDSVLRCQTEEGRFRVAMGKSRFQLATLPVEDFPNLMDIQWDTTLSVARGDLRRAIEKTQFCMAQQDVRYYLNGVMLEMSGQALRAVAADGHRLALCAVEMGSAVAG-ERQVIVPRKAVVEMARFLGDGSLPIEVSLSGNHMRVAQDHLVFVSKLVDGRFPDYHRVIPQAVKNEVVLPRAAILEMLGRVGVVSTE-KFRGIRLR-FQGNRLAASATNTDRDEAWEELE---LTGPELEIGFNVTYLVEAIGALEDEEFLFGWNDSNGGVRLKAKKGDDQVYVVMPVR.. 366
341 0.000e+00UniRef50_A0A1V5YC04 Beta sliding clamp n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V5YC04_9FIRM  ali  37  1MRFYLNNQDLNAGITTVIKALPPRSTNAAREGIYIEASKDGIRLKCSDLSLQIETVVPA--------TVEEEGSVVLPGRIFSELVRKLQGEMTEINC-ENETAVIKNGRVQTTIQGTPADEFSSMSVLTGDIRFSLKQCVLKDMIKQSIFATASDESKPILTGVLFEIDNEELTMVALDGYRLALRKEEISKPLD--PGSVVVPARSLAEISRTLLDSEESTDIEITKTHVVLDMGQTRIITRLLEGEFIKYKQILPTEHKTRVRLNRQELSDSIERASLMAREGKSNLVKMS-FSMDTLTITANN-ELGKINEEISIELI-GSELDIAFNGRYFIDVLKALDDEEIYLDMNSNISPCVVRPVQGDKFYYLILPVRLF 365
342 0.000e+00UniRef50_A0A1Q3QWG1 Beta sliding clamp n=6 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q3QWG1_9BACT  ali  26  15.EITVSRAELLRELTAAQSVVERKTTIPILSNFLFEAADDKLTITATDLDQSLRTSCAAK--------VKKPGACTIPARKLYDYIKLLPEGDISIKLMDNHWVQIRAGRSNTKMVGMARANFPQVPEFPASSAVKISVSSLKNMVSKTIFAISNEESRYTLNGALLVLKAESMAMVATDGHRLAHIEKLGETLEGSGEKKTLIPRKALSELSGLLGNTEEALEFADDDQTLFFKVGGRVLTSRKLTGQFPNYEAVLPRDNTKFVIVRSEDLMGSIQRVAQFA-DERSGAIKIR-LEQNELKLSSSSTDAGESEDTIE-TPYNYDPLVVGFNSQYLIDFLKAINTGEVRLEFKDAQSAGQMRPEDDVKYRYILMPMR.. 385
343 0.000e+00UniRef50_A0A2H5ZGI8 Beta sliding clamp n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZGI8_9BACT  ali  24  1MECRMTKDDLLGALYLAQGIVDRRVTLPVLAHVLIQVGNRDATILATDQEIGLRRRCGA--------AVTKRGAATANARVLYEIIRSLSDGEIELRSDERHHLEVKQGKSQFRIVGIEPSEFPAMPDVKSKAQLSVDAEVLRRMLELTLFAASSDEARPALCGVCFERRDGLLHVVASDGHRLSLVSRALKGVRP--EPGVILPRKAVTEMMKVLDGLSGEVQLTFGSGVVFLTAGDVELAMRTVQADFPSYEAVIPRETAHLLTIANGPWSQALRRVAVLAAEQ-THPVRL-TFDAGKVELSARNPELGEAHEEVEA-NYSGETFTIGFNARYLLDVLSLFPGDTVEVGLQDDESPTVFRVPEEPEFLYVLMPMR.. 368
344 0.000e+00UniRef50_A0A2E8GE81 Beta sliding clamp n=1 Tax=Nitrospiraceae bacterium TaxID=2026770 RepID=A0A2E8GE81_9BACT  ali  30  1MNVVISRKELLRGLHRVQGVVEKRNAMPMLSNVLVETKEGGLEIFATDLEIGIRGFYRAE--------VKQPGGVAVSARKLLEILKELPDTDVAMTVEDSSFLSILCGSSQFKIMALSPGDFPKMPMTIGKELPEIPAELLSLMLSKTTYAVGEHDTRYMLNGVNIMVTKHVLKCIGTDGHRLAVTELDIGDASGAGDLNVIIPKKAAHEIKRLLSDKNEKPRLGITDTQLVLRMNGLLLSARLIEGSYPDYEQVIPVGNDKKVTVEKTSFETAIRRVALLAPD-RVNTIHL-TFETNRVVLHSSTSDLGEATDELAAHS-EGEGFEAVFNARYLLDALASMDGDQVVLELKGSSSPCLIHENGPVRTLCVVMPMK.. 378
345 0.000e+00UniRef50_A0A1F2YCB5 Beta sliding clamp n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2YCB5_9ACTN  ali  28  1MKFRCDRDALSEALQTVQRGVSSRPGIPALTGVLMEAAGDGLTLTTTDLEVSARLTIDVQ--------VTEDGIALVPARLLGDTVKSLSDAPVEFEA-DQTQARIRCAAYEGALRLLPAEDFPTL-QPPAGTRIAVSASAFAEAVGQVARAASKDEARPVLTGVLLEVSREGVTLVSTDSYRLAVRDLV---ATAATEGKAIVPERALSEGGRAAQTVEGDIEIFIDESQASFQIAGFTLTSRLIEGEFPNYRQLLPEAYESRLTVSRQQLMDAVRRVGLIARD--TSPVRMEFNALG-VKLSSQSPDLGQAVEAVEA-RYEGEDITAAFNPHYLADGLAAASGETVRLEIRDGLKPGIVRGESD-DFTYLVMPVR.. 361
346 0.000e+00UniRef50_F6DB38 Beta sliding clamp n=13 Tax=Piscirickettsiaceae TaxID=135616 RepID=F6DB38_THICA  ali  24  1MKLTLNREQFLKGLQTVAGVVEKRQTMPVLGNFLLQINGQHLTLTGSDLEIESRAQVVIDQLEGDAFD------ITLPAQKLLTIVRSLPEG-VSVNLTEAQRCTLTAGRSSFKLSTLPAADYPHLDLSRVELALQMSQAQLKQMLAQTSFAMASQDVRFYLNGMLFDVSPQALRLVATDGHRLSTTALEAD-FASLTPMQVIVPRKGIVELGKLLQASDDLVELAFAKNYLTVKLADIVFTCKLIEGRYPDFRRVIPQNNEVAVQTDRELLRAILQRAAILSNE-RFKGVRM-VIDNNLLTVHAQNTEQDESNEDMAID-YLGDKIEIGFNVSYLLDVIQAVKDDHIVLSLKDNSSSCLISTADGITAQHVVMPMR.. 368
347 0.000e+00UniRef50_A0A2I8AFL0 Beta sliding clamp n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A2I8AFL0_9NOSO  ali  30  1MKLVCSQSDLSANLSLVSRAVPSRPTHPILANVLLQADNNQVSLTAFDLSLGIRTSFNAE--------VWQEGAIALPAKLLVDITSRLPEGEITLTTGEGLVVTLTPKTGQYQLRAMGAEEFPELPLIENTEAIYISATALIEGLRGSLFATSADETKQVLTGVHLTVKQDTLEFAATDGHRLAVVETTNERPADEQQLEVTVPARALRELERMLAASDEPIALYLDQGQVVFAWANQRLTSRTLEGQYPAYRQLIPRQFERQVTVERRQFLSTLERIAVLA-DQKNNIVKLSIDNEQKLTLSCEAQEMGSGRESMPAQ-ISGTDIDIAFNVKYLMEGLKALSASEIQMHLNQELTPVIFTPLGGFKMTYLAMPI... 382
348 0.000e+00UniRef50_A0A0G1X8U6 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1X8U6_9BACT  ali  28  15..VSVVLDKIKGALQGVERVVSSRSTLPILNNVLIRTSKNGVEVMATDLEIGLRFFL--------GGKVEREGVITVPGRTLVSLVNSLHGDTLSLESKGN-ILQVSCGETRASINGMPADDFPVIPEVEGGKVVKVKSEQFKNLLSQVDFAASGEDSRPVLTGVYLIYDGGTLTAVATDSYRLSEA---MAKDKLGEDFNVIIPARTLQEVRRLVGEAAE-FELRIGENQIMVITDSATLVSRIIEGEYPNYKQIIPPTSETTIEMDVQEFSDAIKTAAIFSMEG-SNTVRLNVAASGLVEVVSESSQVGNFTSKLKAE-VKGPGGEISFNAKYLLDGMNSFDTPRFTLGMTGKTAAGVFRPSGVEDRLYLVMPLRS. 375
349 0.000e+00UniRef50_A0A0M0G4E6 Beta sliding clamp n=6 Tax=Bacillus TaxID=55087 RepID=A0A0M0G4E6_9BACI  ali  36  1MKITIMSEVFHQALGDVVRAVSTRTPMPVLTGVHLVATDEGLTLVGSDSDLIITRELPAEAG---RLDVEQPGAIVLPARYLAEIVKKL-SGPIHLQLIDDTTADIRCGEIKTKLKGSPSDDYPKLPVMEESETLQLDASRWMEMLKQTVFAVSKSEAKPVLTGVHISMGEGRLKSVATDSHRLAYRETMIDQHI---DRSCIVPYQAIGELIKLWDGKTDAVEVAMNEHHIHCRLGETSLYSRLIDGKYPNVSGLIPEGSETLVKMETKQLLKGVDRACLFAGEWKNHNVYI-TIHDGRMKLSSAATQLGNIEESQRIMEIEGEEMKMTLDGKYLMEALRSVKEETVTLQFGGIMKPVVIRPEGNATHLQLISPVRAY 372
350 0.000e+00UniRef50_K7ZCX4 Beta sliding clamp n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=K7ZCX4_9PROT  ali  25  1MKITIDRSSFLKPMAHIQSVVERRNTIPILANVLLQAKAGRLSMTATDMDM--------DLVNSTVCIVDQPGSITVSAFTLYDIIRKLPNGEVKLNMDKDSVLSISAGRSKFLLPTLKADEFPSLPNDQITINFMLSAVNAKSLIDRTRFAISTEESRYYLNGMYLHETQSVLRAVTTDGHRLALMEIPLPESASGIPP-VIVPRKAIIEIRKLIDESEGSVHVAFSKNKLRFNFVDTAITTKLIDGNFPDYERVIPTSNDKIMRLECRSLKKAVERIAIIST-AKSRSVKLE-INKGNLILSAKNPDNAWATEDMNVD-YDSDPIEIGFNSRYLLEIANQFDSATVLFHIADKTSPAIVTNEKNDGALYVIMPMR.. 372
351 0.000e+00UniRef50_A0A2N6A2J5 Beta sliding clamp n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2N6A2J5_9BACT  ali  28  1MKIVCTQENLNKGLGLVSHIANKNSNLPILNNVLLKAKKDGLTLITTDLEIGIKVFVRAK--------IEEEGEFTADAKLLNNFVSLLPKENINMDLDEDN-LKIKSVNQETNIKGLEAEDFPLIPEVEKENEIELSAIEFKKSLNQVLFAASLDTSRVEINAVNFEFKQGKLILAATDSYRLSEKRIKIENNTK--EAALIIPLKTLQELSRILNETDKNIKIYFNENQIMFVFDGVELISRVIDGKYPDYSQIIPKEFTTDAKVDINKLVPAIKSVALFCKTGINDIKISFDSKKNEIVIATASSTVGTSVAKVEAD-ISGGDNDIVFNYRYLLDGLNSLSNTQVLMKINNNSSPGLLKPTSDEKFIYLVMPIR.. 366
352 0.000e+00UniRef50_A0A2E6CFV5 Beta sliding clamp n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E6CFV5_9BACT  ali  28  1MKXSVNRNELWQGIXTVLDXVPSKPALPVLANILLVAEDNTLALSATDLDLSIRTEVPA--------TVEQKGRITVPARTFGEIAREWPEAELSLVVEED-RLRLSSGEGAYSLSGMAADEXPNMPTSLEGVSIELXAKLLLDMIXXTSFAVSKDDTRPVLNGVLWXIDSEGMEMVATDGSRLACYRRSLDQVQSDQEAGVIVPPQAXAQMGKLLSGHDGAVEVTLGETQLFLSTGTTHLLSRLIEGPYVEYSQVIPKENDKNLRVDVDRLLPTVRRVSILSS-SYTRQVRLK-LDSSSIELSAASPEIGEAREQIPA-SFDGEEMEIGYNAQFLMEILRKMDSQTVRFELNDNVTAALLKPEEGEDYFCLLMPLR.. 383
353 0.000e+00UniRef50_G4E489 Beta sliding clamp n=2 Tax=Thiorhodospira sibirica TaxID=154347 RepID=G4E489_9GAMM  ali  25  20MKLAISRETLLGPLTQVFGAIEAKQTLQVLSNVLIKAEADHIQLTGTDLEVELVASF--------AHPVDTPGMATLPARKLLDICKSLPNTEIRLTV-EGNKATIIGGKSRFSLATLPVDDFPVLDEIEANDHWQMNEKEFKHLLQGTAFAMANQDVRYYLNGILLETRKNLIRCVATDGHRLSLCDLP-KEIETEEVRQAIIPRKGVQELLRLLSPNEESIEVHLGSNHLRLHFPGLRFTCKLIDGRFPDYERVIPRKYDQILNVDKTALIKALKRMLILYTD-KTRGIRL-VISENLLKLKTHGLDE-DEGEEELEARYPGDGLEIGFNVNYFLDALNALESDSVDIFFRDPESSGLLKPPGDDNVAYVIMPIR.. 387