current user: public

If you have questions about the server, please let us know.

Query: gi|30260203|ref|NP_842580.1|(removed signalp:1-28) D-alanyl-D-alanine carboxypeptidase (BA_0009) [Bacillus anthracis str. Ames], from B.anthracis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# E-value Template Links and tools%idFirst ETGSALNIEAGAAILVEANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKFKWDQKIKVSEYAYKVSQDASLSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELGLKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAISLPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVTTSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWFLast
1 0.000e+00UniRef50_A0A1I2QP43 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Desulfotomaculum arcticum TaxID=341036 RepID=A0A1I2Q  ali  24  46.AAPDPEPVGEAAILIDADNGQVLYDKNADQRMFPASTTKILTALLALE-----RAKPDDMVEISERAAKIGG----TRVGLQPGEKVKMEDLLYILMLSSANDAAIAIAEHVGGSVEHFADLMNARAKQAGATGTNFINPNGMP--------------DENHYTTARDLALISREAMKN-PAFRRIVGTTNYKVDRKKNQEDFYNHNKLISSSYYGYKGANGIKTGYTVDAGQCIVASADKDDRELIAVVLKTQGANL-WSDPAMLLDYGFNNFTPVQLIKPKQIITD---AAVLHGSRRAV-LETTSSFYYNFPVEESPEVTRKAVL-EENIRAPLEAGQKLAELVLESDGEELGRVQLVNIYPV........................................ 402
2 0.000e+00UniRef50_UPI0009EA11EB D-alanyl-D-alanine carboxypeptidase n=1 Tax=Numidum massiliense TaxID=1522315 RepID=UPI0009EA11EB  ali  26  104...AQPEVSAKAAVLVDVNSGRVLYEKNADEQLPIASITKIMTAIV---AIEHGN--LDDIVTVSPRATRKEG----SSVYLKKGERISLRHLLYGLMLRSGNDTAVAIAEFIGKSEEGFVTLMNEKAEYLGMTHSHFANPHGLDA--------------AGHYSSARDMATLTRYALAN-EEFQKIVATHAIQVPGEKWNRKWYNKNKMLSL----FPGADGVKTGYTSKARRTLVASATQSGQQLVTVTLNAPDD---WRDSSEMLAYGFRQYPLRAVVKRGEVVHMVPQAD--KG-EPTVNIVAAQDFQYPLTETERTAVAQQVHVD-ERLVAKVSAGAHVGTLSLSLHGKVIGSVPLT............................................. 429
3 0.000e+00UniRef50_A0A1J0A8C3 Uncharacterized protein n=3 Tax=Vagococcus TaxID=2737 RepID=A0A1J0A8C3_9ENTE  ali  36  28.ASNELDIPAKSAIAVDFDTGKILYEKNSSEVLPIASMTKLISAYLVYESVKTGKISWNDSVPFDDTLIKMTENPDLSNIPIKKELTYTVEDSLKAMLISSANVSTTGLARLISGTEQAFVDQMNLKVDEWGIKDAHFISASGLDTQDLKEDRYPNSKDDDANMMSAKSMVIVAKHLITDYPEVLDITKQSHYTFQGTKDEQTYWSSNLMLPDLYYYTKGVDGLKTGTTPNAGACFIGSTVQDGHRIITVVMNVDEKYSRFEVTKNILKHIETYWEYQEVNKAGSN-AIVEKADVPNGKVETVPLIIKNSSSLWVNK-QTSELKQVFNQKNDKLSAPLKKNVIVGQVTTDINDKLYLDQKDTGQATSDVMTKTDVLKANIFVRAWRSIKN................. 418
4 0.000e+00UniRef50_A0A0N0I496 D-alanyl-D-alanine carboxypeptidase DacA n=1 Tax=Geobacillus sp. BCO2 TaxID=1547578 RepID=A0A0N0I496_9BACI  ali  64  33...APLDIRADAAILVDAQTGRILYEKNIDTVLGIASMTKMMTEYLLLDAIKAKRVKWDQMYTPSDYVYRLSQDRALSNVPLRKDGKYTVRELYEAMAIYSANGATVAIAEIIAGSEKNFVKMMNDKAKELGLKDYKFVNATGLSNKDLKGFHPEGTSTNEENVMSARAMAMLAYRLLKDHPEVLKTASIPHKVFRGTKDEIKMDNWNWMLPGLVYGYEGVDGLKTGYTEFAGNCFTGTAKRNGVRLISVVMK.......................................................................................................................................................... 283
5 0.000e+00UniRef50_A0A257GFZ5 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Novosphingobium sp. PASSN1 TaxID=2015561 RepID=A0A257GFZ5_9SPHN  ali  29  2.....PEMTAPIALLIDVNGGKVLFERQSHRRFMPASLTKIMTSYVAFELIKAGKLRLDQRFRMSHEAFRQW-HRVGSTMFLADGSDTSVAELLEGIVTVSANDGCIVLAEGVAGNVPAFTALMNDAAKQLGMKDTHYNTPNGW-------------MDEGATYVSAADLAILSTALITRHPDLYRFYGHERLTFRG----VEQPNHNPL----YGHVAGADGVKTGFTNEAGYGLVGSAIRDGRRLMMVVGGYDNGKVRARESRDFLEWGFAAFEAHSLFGAGAKVGAAE---VQGGEARTVALVAPHPLALTLPRGAGARYSLSLRYKGP-LRAPIAKGQEVASLIVRVPG--------AGETRLPLVTEDAVPVAGTLARLRNGLLAMIG.............. 356
6 0.000e+00UniRef50_D5WQA8 Peptidase S11 D-alanyl-D-alanine carboxypeptidase 1 n=2 Tax=Kyrpidia TaxID=1129704 RepID=D5WQA8_KYRT2  ali  30  27.SPDLYGISAQGAAVVDVGSGRVLYEKNGDQMMPIASLTKIVTGWL---AVESGR--LDERVTISANAARKEG----SSVYLRAGETYTLRDLVYAMMLRSGNDAATAVAEHLAGSEARFAALMNAKAREMGLRHVHFANPHGLDA--------------PGHGASAVDLARMTAKALQN-PEFAAVVRTKYMPWPGEAWDRVMRNKNKML----WRYPGADGVKTGYTKRAGRCLASSATRDGHQVVVVVLKDPDD---WADTARLFDHVFQTYEWVPVQ------AGPASVPVRGGVVPTVPVRVQGPDRFPIRADEKFHMDWELK---PRLRAPVSRGEPVGLLRIQVGEE---------VHRYSIVAMQPVDPRPWWRRLW...................... 365
7 0.000e+00UniRef50_A0A1W9SBQ6 Uncharacterized protein n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SBQ6_9RICK  ali  29  18...ADFNLRAKYAVLIDANTGQILYKKESFKPVPPSSMSKLMTSYILLEDIQNQKIKPTTKFKVSEKSA-YDFDSGESAMYLKSGQNVSAIDLYKGMMIMSGGDACRTVAEGLEGSIEKFIERMNLTAKKLGLRNSSFTNPTGM--------------AEDGHLMSVYDVAKLSKIFMKSFPKYYKMLKEKYFDYDGKEYEFAMWNRNKLL----WTYRGADGIKTGHTEKGGYALVASAKKKDFRLIAVINGLSANRERAKEAGRLLDYGFENFQQQTFYKKNEKI---LEIPVWFGKKDTAKVGVNDNVSLIMPKENNDKIEIKAIYKTPIIS-PIKQGQKLGKIKIFVEKK--------EVLEYDLIALEDIKRISFGLRLFENLKILIK.............. 389
8 0.000e+00UniRef50_B2A3M5 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Natranaerobius TaxID=375928 RepID=B2A3M5_NATTJ  ali  32  37QEFETPEIEAETAVLMEFESGKVLYDQEMHRQMHPASTTKIMTALLLIE-----NASLREQVVVSENAFGT----DGSSMYLNLDEKITTRDLLYGLMVRSANDAAVAIAEYVAGSVENFADMMNSRAKELGAKNTNFKNPHGLT--------------EENHKTTAYDLGVIAREALKN-PKFRSVASTRRITLDEEDEDRLLVNRNELLAD----YPGALGVKTGYTRSANQTFVAAAERDGMTLIAVVL-STSRNRLFEDAKELLDFGFEAFEQVEIFEQNDVITSTE---VENSNQ-ELELIVEESLSLPIPK-MATEIEQRVDLEEQLLKAPIEEGEQVGS--------LDLLLEEEEIVSVPLYTKEDVEKA............................. 375
9 0.000e+00UniRef50_A0A1Z1FEZ8 Uncharacterized protein n=2 Tax=Croceicoccus marinus TaxID=450378 RepID=A0A1Z1FEZ8_9SPHN  ali  30  42.ALDPPLREVPIALIMDADGGVPFYAKDADRRFIPASLTKLMTVYTAFELLKQGRLSHDQRLPVSDRTAREW-SGKGSTMFSVANTSLSVDTLLKAILTVSANDGCVILAEGAAGSIEGWTALMNANAEKLGMDDSHFNTPNGW-------------MDEGRTYTSARDLATLTRALLTEHGDYRRYFALPKFSY----NKITQNNRNPIL----GYVEGADGLKTGFTNEAGYGFVGSAERDGRRLIMVLGGAESSAQRKQVARDFMEWGFASWDAQTIYGKGQPVG---TVAVQGGASRQVAVAASRAVNLSVPHGQKADANVTMRYQGP-VAAPIRKGQRVGELLVARDG--------AEPARFDLVAAEDVAEANMLQRLRNGLLGLFG.............. 400
10 0.000e+00UniRef50_B9KGV1 Serine-type D-Ala-D-Ala carboxypeptidase (DacA) n=25 Tax=Anaplasma TaxID=768 RepID=B9KGV1_ANAMF  ali  30  31......HTKAPHAIVYELGSRTVLFEHDADVAVAPSSMSKLMTLYLVFQHLHAGLIKMDDTFSVSESAWKRGG----SSAFLKVGQMVKVRDLIMGAAVSSGNDACIALAEGVSGSQEQFVEDINSLAKEMNLAHSSFTNVTGWP--------------DEGHLMSVRDILTLSVRIFEDFPEYYHVFGEKQFTYNG----VTQKNYNTLLNYNI----GVDGIKTGHTEKAGYGIAASAQKDNRRVFVVVNGLKTETERAYETKRLLLYAFNRFETKVVFPAGSVVG---EVKVWNGRKGTVQMHVRDDVVISYPRDLSKSVKAFISHKS-TIAAPVKKGQEIGTLAVQIPGMADKVF--------PVYAATEVEALGPVRGFFRSLKHAILG............. 380
11 0.000e+00UniRef50_UPI00038138BC D-alanyl-D-alanine carboxypeptidase n=1 Tax=Desulfurispora thermophila TaxID=265470 RepID=UPI00038138BC  ali  26  13....DLSIAARGAILVDLATGQVLYAKNENERLYPASTTKILTAWL---AIKHGR--LDDVVTIRPDDVGCEG----SSVGFQPGEQVKLENLLYALMLSSDNDAAQVIARHVAGSVPAFVDLMNREAAALGVRDSHFTNPNGLP--------------DVDHYVTAADLALIARQAMQER-RFRQIVSTYQYHFRRGVPQEHFVNHNKLLWPNSYYYPGATGVKTGYTNAAGNCLVAAARRGETELLTVVLK-DTAPDFYLDTKKMLDYGFDNFIRVRGLEKGQLL---DEVMLAGAGEKKWPVLAGEDFYYLQKKGDSGQISTRLV-IEPQIKAPLQANQPVGRADIYLHG--------SKIGQVPLLVGADVPAGGWIRQLLLALSILFCSLF........... 376
12 0.000e+00UniRef50_D5ASB8 D-alanyl-D-alanine carboxypeptidase-2 n=421 Tax=root TaxID=1 RepID=D5ASB8_RHOCB  ali  27  20..AAAFDTRARTAWVYDLTTQTVLLEKDADVAVPPASMSKLMTLNMLFEALSEGRVTLDTTFAVSTKAKQMGG----STMFLNEMDRPSVRELMQGVVINSGNDACVVVAEGLAGSEGAFAAGMTERAKMLGMTRSTFANASGWP--------------HPDQRMSMHDLGILAVRLITQFPQYYPLFSETQFNYKNRAPANA-HNRNPLLK-IPAADWHADGLKTGHTEEAGYGLVGSAVMGDRRIVFVISGLASEADRASEAEAVANWAFRQFVMKTVAQKGTRLA---EAPVWLGTEASVGLVPASDVAMLIPAGAAEGVKAEAVFDGP-VTAPVTAGTELGRLEITVPGLGLRP--------VPLVAETDVAEGGFLVRFTAAAGRLLA.............. 378
13 0.000e+00UniRef50_UPI0003613D18 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Fangia hongkongensis TaxID=270495 RepID=UPI0003613D18  ali  31  89....APILNVQSYVLMDEESGNILAEKDANQRIAPASLTKMMLLYIVFERLAKGSLKLDQEVTVPAIAWHTAG----SSMHLKSGQKVTVQTLIEGAIVASGNDASVALSMLIAGTQEGFVNIMNFEAKKLGMSNTHFSDVMGLPA--------------PNLYTSARDLAVLAQHLIKDYPQYYHYFKMQTVTMNG----FVTHNYNKLL----FIYPYADGIKTGSTDAAGYSLVSSAVKPDHRLISVVIGSTSLIQSARDSQTLLEYGFSNFKTQTFYPAEYKL---NSLRVYKGASDYVDIGVQSPITISYPSLDPKEIQFVLHKEQNKLTAPINAGTPAGKLDMTYKGKI--------VESFPVVTLKDDPTGSLWQRIKGTVSLWF............... 441
14 0.000e+00UniRef50_A0A0N0KEL8 Peptidase S11 n=3 Tax=Novosphingobium TaxID=165696 RepID=A0A0N0KEL8_9SPHN  ali  25  16QSGAMPAIDAPIALLLDVGSGRVLFERDANRRFVPASITKIMTSYVAFDLLTQGKIRLDQRMPMRPETFRQW-HSVGSTMFIPADAQPTVAELLEGIVTVSANDACVVLAEGATGSVPAFTRLMNDAAAKLGMRDSHFNTPNGW-------------MDEGQTYVSAADLATLSGALITRFPDYRQFYGHAEMTWNG----ITQPNHNPLYGVTV----GADGIKTGFTNEAGYGFVGSAQRNGRRLVMVLGGYDRPKDRERQSRDLIEWGFAAWTAQPLFEQGATLG---VAQVQGGQERTVPLIAPRPLSITSPNGTTPQYTLAVRYKGP-LKAPIAAGETVANLLVRVPGEPVRVL--------PLVAGASVPKGRLVSRMRDGALRMVG.............. 375
15 0.000e+00UniRef50_A0A1Q6Q2J4 Uncharacterized protein n=1 Tax=Faecalibacterium sp. CAG:74_58_120 TaxID=1897005 RepID=A0A1Q6Q2J4_9FIRM  ali  26  25..AEEVATSAKACIIIDEASGRVLLSHNAETPLPMASTTKVMTALLAIE-----RGNLGDPVTCSRNAFGVPG----TSIYLSQGETLSLREMLYGLMLASGNDAAVAIAEHIGGTAEEFCRMMTARAAELGCQNTVFLTPHGLPC--------------DGHYTTAHDLALISRQAMTQ-PLFREIVSTRRATWEGRPYSRVLSSKNKLLA----TYEGATGIKTGYTRKAGRCLVFGAERNGMRIIGVVLNCPDW---FDEAARLMDRAFQRYESVTMLNAGESL---RTLPVAHSGGASVHAVLAADLRGVVMQGAIPSI--EIDLGSEELDAPVIRGTPLGVARLISGGEV--------IAEVPLVADADVPRDDFWRRIWEN.................... 370
16 0.000e+00UniRef50_A0A0R2A9D5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2A9D5_9LACO  ali  38  42...TTVDLKAKAGLAIDAKTGQILYDKNSTKVLPAASMSKLLSLYIILENIHSGKLKWDQKIKIDNTVYKMSQDTNLSNVPLRKDKEYTVKELYQASIIYSANAAVTALGDAVAGSPHAFVSQMRSTAKKLGITDAKIYNASGLTNKQVSDAGYDNVANSAENEFSARDMGKLAVALLNKYPEILQTTSIKKMWFKGTDDQIKMENWNWMLPGLANSYSPVDGLKTGTSDAAGANFTGTVKKNGNRIITVVMGAETDSSRFVQTQHIMSYVFQNFKTTTYT--NSQIKGVKSISTSNGKEKTVKVQLKSPLKLWIRNNQTGSIKLKKSLNKDKLVAPVSKGKTIGAASISLKGDQLGFVDGKSATCVSVKTATKVEKANIFVRMWRGLVALF............... 441
17 0.000e+00UniRef50_UPI0006B541E5 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Inediibacterium massiliense TaxID=1658111 RepID=UPI0006B541E5  ali  32  23...QDIEIKGKAALLMEEETGKILYEKNIKEVFPPASITKLMTYLVTMDEIQKGKISLEDEVIISERASKERGA----SYHLVSFEKIKLKELIEVMMIVSANDAAFAISEHVGGSMENFVNMMNQKAKDIGLEDTHFDNPNGMPQK------------DGGNLMTAKDIASLGKYIIDHHKEILSLTDQEFYE--NPMRDFYKENTNKLLK----IIPQVDGLKTGYTDAAGYCLASSMQEKDFRLIAVVLGTDSEEARFRESKKLLEYGSEGFVKKRIVKKNEKIK---TIHLWGEKKLPITLLAKEDIWTLGPKEKIG--KNREILLVKKMPYPISKGQKIGELKVTYDGKMI---------KTDLVSDRDIRKLSFITNFFHIFASVFSNMW........... 390
18 0.000e+00UniRef50_C5WCX7 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Candidatus Ishikawaella capsulata TaxID=168169 RepID=C5WCX7_9ENTR  ali  29  82...TAPTFTSKAWILIDYNTGKILTKYHPDLRLNPASLTKMMTSYVIGQALKNGKINLHAIVNIPKDACATSKLKNSSLMFIKPLDRITVSDLNKGIIIQSGNDACIALADYIAGSQIDFIKKMNNYTKVLGLTSTHFMTVHGLDAI--------------NQYTTAKEIALIGQSLIRDLPEEYLLHKEKQFVFNH----ITQYNRNRLLWKNNL---NVDGIKTGHTSESGYNLVASATKDNMRLISVLLGSSNSDIRFTETEKLLHWGFKYFENIQLIKGYHPFISHT---IFFGNKKEVLLGVKKDANIVIPKGQRQFIKEKIKFFYPKFKAPLHKNKIVGIMIIQLNEQT--------VQEFPIISLENIRSGGVFKHLKDIFLSFF-NLFTKKV....... 447
19 0.000e+00UniRef50_UPI000B984D27 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B984D27  ali  30  27.....PQINSPSVILIDSATGRILYEKNSHEKMYPASITKIMTAILALE-----KGNLNDIVTASSEAV-LSVDAGGSNVGILPGEELSLENLLYALMISSANESANVIAEHIAGSIDEFVKLMNQRAAELGAKDTYFVNTNGL--------------HDDRHVTTAYDMALISRHAMT-IPKFREIANTSYYEIQPTNKKRYLSNTNHLINKYNYLYEPAIGIKTGYTSKANHTLVAAAKKNGLELITVVMGSKMKYQSYEDTINLFEYGFNNFGMQTIVKPGDII---DEVKVMDAKANEVILLAEQALTALLPNNVDKNTIQKEVYPLSNIKAPINKGDVLGFATYKYQDQVLG--------KVNLVADRNVEQEPI........................... 382
20 0.000e+00UniRef50_A0A0P7FW47 Uncharacterized protein n=2 Tax=Vibrio alginolyticus TaxID=663 RepID=A0A0P7FW47_VIBAL  ali  25  15...PPPSVEAKSYVVFDTNTNQYIASDNENERVQIASLTKVMTAYVVLKEIQNGTLSKTDIVTVSKKAHKMKG----SRMFLSIGEKITVEELLRGLMVVSGNDAAVALAEHISGSEGRFAQLMNSYAAKIGMEDSHFKNASGLP---------LPRRKIKEQYSTASDLAILADHLIDEFPEMLEVYSTKKLS----HNDIDQDNRNKLLSMDSNY----EGLKTGWTENAGYCIITSYHKGDRRVVSVVLGSKTADKRVQAANVLTNYGSRRFMNITPVSQEVALTDM---SVIYGTKATVKVYPAKSYSLTVPRDEAEHEKIRLLVDKEALIAPAISNLEVGEVKVEYDGEVLE--------TIPLITKEEINESGFANKLVDWIKY................. 376
21 0.000e+00UniRef50_A0A0B8ZZM8 Serine-type D-Ala-D-Ala carboxypeptidase n=6 Tax=Novosphingobium TaxID=165696 RepID=A0A0B8ZZM8_9SPHN  ali  24  20QAAAPPRIDAPIALMLDVGSGRVLFSRDPHRRFVPASITKIMTSYVAFDLISKGKLRLDQRIPIRPETFRKWRNV-GSTMFLPAEAQPTVAELIEGIVTVSANDACVVLAEGATGSVPAFTALMNQAADELGMRDSHFNTPNGW-------------MDEGQTYVTAADLATLSGALMTRFPDYRRFYGHSQMTWNG----ITQPNHNPL----YGHTEGADGVKTGFTNEAGYGFVGSAQRNGRRLVMVLGGYDRPIDRTNQSRAFIEWGFAAWDAKPIYRKGSALG---SAAVQGGEARQVSLVAPHDLSVTMPKGAASKYRLSVRYKGP-LKAPIRKGETVASLLVRVPGEPVHVL--------PLAAGEDVARGGVLARLRNGAMGLVG.............. 390
22 0.000e+00UniRef50_A0A1T4KT65 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Garciella TaxID=218204 RepID=A0A1T4KT65_9FIRM  ali  30  32.....PNIKSPAAILIDAKTGQILYGKNINEPLYPASITKIMTALILLEE-----GDLNKVVKIHENVPSL-IEPGSSQIYLLPGEKLTRKQLLYALLIESANDAAVAIAQDVAGSIENFADRMNEKAKELGATHSHFVNPHGL--------------HDENHYTTAKDMAIITREAMKN-PIFRNAVSTVRYIIPATEKQRYLYNANRLIKKSDYYYQGATGIKTGYTTQAQNTLVGGAKKGNLELISVVLNAKGTDI-YEDTRTLLNYGFEHFTTKIIVRKGQVIK---KLPLKNANEL-LPVSAKNTFQYASFKNSNEEITSIIKLDKD-LSLPIKKGQIVGSIEYSLKGQP--------INTVPLVAEKTIEPSNRIIAFLYHIK.................. 385
23 0.000e+00UniRef50_R5B9I4 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Clostridia TaxID=186801 RepID=R5B9I4_9CLOT  ali  29  25.AENAPDIAAGGAALIEQYTGAVICAKEAHKKLPMASTTKIMTALIVIENC-----SLGDTVKVSPKAYGVEG----SSMYLNAGEEVSVEDMLYGLMLLSGNDAAVALAIHTAGSVEAFAALMNARAEEIGAHNTNFVTPNGL--------------HDPEHYTTAYDLALIAAEAMKNS-DFRKIVGSTYHKTTTGSVIRYMKNKNKIL----WQYEGGCGVKTGFTKAAGRCLVFAAERDGMTLIGAVLSCPDM---FNAAKAMLDYGFASFRTEKIISAGQSIT---RIRVSGGTKTALAAEAKDDIIIPVRIGESADIRTEVETRS-GMNAPVEKGEDVGSVRVLMDGKLVGETR--------LLAAED----SLSLKFGQYLRKLLSGW............ 371
24 0.000e+00UniRef50_A0A1G7V637 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=10 Tax=Selenomonas TaxID=970 RepID=A0A1G7V637_SELRU  ali  28  66.....PNLMARSAILIEAKTGNILYARNKDERRFPASTTKIMTLIIALE-----KGNLDDMVTVGANAVGLEG----SSLYLEKGDKMPLRELLTGMMMQSGNDATVAVAEHIAGSVPAFAKMMTDKAREIGAVGTNFVNAHGLP--------------DDNHYTTAHDLARITAYGYS-LPEFESIVSVQDADYNWRDPSKHITSENKLL----WQYRGGNGVKTGYTERAGRCVVSAAKRDGVQLIAVVL---DDPVMWTDAYAMLDYGFAHTRPSSFCKAGEEVAKT---KVADARIDEMTLVAARDSVIGILQDENPKLEKKIE-VPDEISAPIKKGDVVGKAICYADGIV--------VDRVDLLASQDVAYHTFWSDFTGWITKLMKGLF........... 414
25 0.000e+00UniRef50_A0A2D8UBT4 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D8UBT4_9BACT  ali  31  31...........SAILIEAQTGKVLFSYKPNLQRSPASTQKMLLSLVAMDQVKKGNYSLEDSVTVSARAAGMGG----SQVFLAHNEIFTLEQLMEAIIIPSANDACVAIAEHMSGTVEXFVVQMNEYAQKLGLKNTHCVNVHGLDD----------TPNNKRNLTTASDLSEIARYLIK-FPKIIEWSSIRYKPFRDG--QFMLYNTNNLL----GKYEGLDGIKTGYTQRAGSCLVATALQKDFRLISVILGANSEKQRELETVKLLXWGFNKFSRVVLAEQDELIPN--KIIVDWGVTHIVETRISKSIXTILDSQDQNALKREIS-MPERIEAPIQRGDQLGELHISIKD--------STIAKLPIVAGTSIERMGILEKFLSFF................... 375
26 0.000e+00UniRef50_UPI0008819717 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Pelagirhabdus alkalitolerans TaxID=1612202 RepID=UPI0008819717  ali  30  28...PSLSHDTRSVVLMEYESGRILYADNEEASYSPASMTKMMTLLLIAEAIETNQLSLTDQVTVTDHAASMGG----TQIFLEENEQMTVQDLLKAIAIASANDATVALAEHIFGNETNAVEAMNEKAKDLELTDTQFQNTTGLPA--------------DDHYASAQDIAKIANELL-NYEWITDYTSIYEDYLRDTDDAFWLVNTNKLVK----HDSTIDGLKTGYTADAKYCLTASAIREDMRLIAVVMGADSVKERNKTIQELFDYGYAKFDRHVLVKKDEVLT---TADVFQSEKSHYELVGERDLAIILPKNEALENVQYNIYIDDHLKAPINQEQVVGTVEVLIDKEVY--------ASVNLRSTIPIKKANWTESLFDVVRRF................ 382
27 0.000e+00UniRef50_A0A2S6SRS2 D-alanyl-D-alanine carboxypeptidase DacC n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6SRS2_9PROT  ali  29  26....AIDTKAEQAIVMDFDSNEVLFEKNSKIKIIPASMTKIMTVYVAFDRIKNTNLSITDKCRVSAKAYKMGG----SRTFLEIDDYVTLDDLLRGIIIQSGNDASVALAECLAGTENDFSKLMNVYSKKLNMHNTNFINSSGWPAN--------------NHYSTVYDIAILSNALIKDFPELYIYFSEKDFTYNG----IKQPNRNQLLDNL----DGTDGLKTGYTKKSGWGIAATSLRNQRRITTVINGTNSTRSRMNEASNLINWAFNQTTQKVLLEKNQFVK---EVDVWLGNQTKIKLISSEKIISKLSFDQLQFLSSKIHYTKP-IAAPINKGQEYGKLIINIDGKPDLN--------ISLVAEKNVGKINPLFKIFAAIKYLIFG............. 377
28 0.000e+00UniRef50_UPI0009FE3570 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Desulfotomaculum alkaliphilum TaxID=105483 RepID=UPI0009FE3570  ali  30  7.AAASPKVTADAAVLMDAKTGQVYYAKNPDKQRSPASLTKVMTIILALELGDA-----NEIVTVSKRAENIS---VGSQINLRAEEKISLGDLTKAAALFSANDSTIAIAEHLGGNHDNFVKLMNQKALAIGAVNTRFVNTNGYSV--------------PNHYSTAYDLALITRYALKN-DAFAELVSTKEATIHWAENGRKMRNTNRLLRSD---YPGIDGVKTGTTARAGNCLIASATRNGQQLIAVVLHSRN---RYEDAAALLEYGFNEFEEQRAVEKGEVLGA---VQVESGVHSDVAVEAGDDIVVDAPKD-GGKVELKV-YMPGSVPAPVEKGQQLGHAAVLYNGKVLK--------QVPLLATERVKEQGLWFKLRQGMAN................. 355
29 0.000e+00UniRef50_G4KXQ5 D-alanyl-D-alanine carboxypeptidase n=13 Tax=Firmicutes TaxID=1239 RepID=G4KXQ5_OSCVS  ali  30  33...PDPNIQTKAALLVDKETGTVLYAKNEHDELYPASLTKIMTALLTLEAVDQGKLALDQEITASATALN-GLADDGSSAGIQVGETMSVENYLKCMLVVSANEACDVLAEAVSGSVDAFVDAMNAKAKELGCEDTHFANPNGL--------------HDSQHYTSAWDLYLITLAALK-YPEFMTICDMGVAEIPATNDIRRLHTTNYLLSNNGYLYSDAHGIKTGSTSEAGHCLVSSATQGSRSLISVVLGAQRDVQSFSETKRLFQWGFANFSTQKVLSDLDMLAD---VPVTLSKIDSVAVHPASEVDLVLPNDVKPEDLDRKLVLPENVDAPISAGQELGSVELSYNGTVYT--------SVPLVALNDVE-ASKLLTFWNNVQQFFS.............. 407
30 0.000e+00UniRef50_A0A2D7TVX2 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Candidatus Pelagibacter sp. TaxID=2024849 RepID=A0A2D7TVX2_9PROT  ali  31  19...SAFETTAKQAYLIDVLSGKVLLKKNENERISPASITKIMTTIVAFELIKKGELKLDEKFKISKKAWRMS-SKGYSSMFIMPGDKVSVENLLKGIIIVSGNDACVALAQGIAGTEEEFVNMMNTMAIKIGLNNTKFSNSSGL--------------YNENNFSTAKDIATMSIYLINNFPRLYEYYKIKKFTWRTGGAPITQGNRNPIL----YKDMGGDGLKTGHLVDSGYSLAATTKTNERRILSVISGLNSKSERSRETIRLLSFAKNRFDLLRISKADKNF----VIKTWNLRPKIVQLELSNDVFLTIPKRQKNKLKLEIVHNNEILKTVVNKGVPISKLNIYYDDKLIKSEILYSSIKT--------EKENFLIRFINSISYFIWG............. 379
31 0.000e+00UniRef50_A0A2W4QQK0 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4QQK0_9FIRM  ali  28  41...SPPSLWAHGAILMDATTGDVLWEKNAHMRLHPASTTKVLTALIALE-----RGDLDARVTISKRAAQTPG----SSMHLREGEVHTLYDLVHGLLMLSGNDAAVAIAEAIAGSVEAFADLMNERAWRLGARNSHFVNPHGLT--------------HPDHLSTAYDLAVITRAALQN-PLLAEIVATPEKTYEELGREVVLYNTNRLLRGGL---PGADGVKTGTTAAAGACLIASATRDGQKLIAVVLNASN---RWRESTALLEWGFRNFALARLGGSGEVLLH---LPVRGGKRRAVPVALRDPLAVVVPRKGGALPAVQVDLLG-SLRAPLREGQVVGTAWVPLPG--------GAQRRVDLVAAEAMPKATWLDRVYRGLVALV............... 389
32 0.000e+00UniRef50_A0A1E3A5N4 D-alanyl-D-alanine carboxypeptidase DacF n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1E3A5N4_9FIRM  ali  29  33QEGAPVSISAPSAILMEASTGTVIYEQNADASCSPASITKIMTMLLIFEALDRGDIKLEDEVMTSAHAQSMGG----SQVFLEEGEMQTVDTMIKCIAVASGNDAAVAMAEFIAGSEEEFVSRMNERAEQLGMQGTHFEDCCGLTDS-------------DNHYTTARDVAAMSRELITKHPAVFNYTMIWMEDITHGSSTFTLSSTNKLLK----QYQWTTGLKTGSTSKAKYCLSATARKDDIDLIAVVMTAPDYKVRFSDAATLLNYGYS----VSALYKDENKDALPRLIVDGGVAEDVGLVYKEGFSYLDVKGNDLSAVEKILNLPGAARAPIEAGEKAGEAVYRLNGETIG--------TVPVLFAESVAEAVYKDYVLKVLGYFL............... 395
33 0.000e+00UniRef50_UPI00096A3574 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Merdibacter massiliensis TaxID=1871030 RepID=UPI00096A3574  ali  34  31.SDTSLAAQAKSAYLMEMSSGKMIFAKQESEKMYPASMTKMMGLLLIYEQIHAGKLKLSDRVTTSETAASMGG----SQVYLKVGETMSVEDLLKSICIASANDAMVAMAEKVGGTQESFVEMMNAKAKELHLVNTHFVNATGLHA--------------DDHYSCAKDMALIAQALIQEGDDLLEITSTYDAYIREDSERFWLVNTNKLIKQL----DGTDGLKTGYTSQAGSCISVTTKRNDLRLIAVVMGEPDGKTRNQEASALIEYGFSRFEQRQLYKKGEKITSIVN---EKGNPSTIDLVTQEDANYVVEKGKQSAVKKKIQWLQPD--PPYVPGKTCARLMVTMSD--------GYRFSIDLSVKKEISSANFVDLWIRSFRQMFA.............. 389
34 0.000e+00UniRef50_A0A1X6WTL5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Enterococcaceae TaxID=81852 RepID=A0A1X6WTL5_9ENTE  ali  34  27.SNDDFYVSANAALAVDYDTGKILYNQNGDEPLGIASMTKLITAYIVFDEVDKGNISWDDTIKISDNLKKMSKNPDLSNIPIEDKHIYTVEDALYGSLISSANSLTSALAEHISGTELKFVDRMYDQLKTWGINDATLVTASGLGNEDMGKNIYPGSKKEDENMMSARSIVIVGQHLIADFPEVLEITSLPSATINSTKDGIVIWNSNGMLEGFDYYTEGVDGLKTGTTPLAGDCFIGTATRNEHRIITVVMGVEDGFNRFDETAKLMDYIYTNWSYEVIKKKGDP-ANTPTIDVHHGKKSKANIVLTEDLAVWTNKENKDKPTKKQLTRKEKVAAPEESGYIVGK-EYGYNTKDNLGYLRNEDEKVDVVLKETIQKENVFMQIWHLV................... 421
35 0.000e+00UniRef50_UPI0007C395BF D-alanyl-D-alanine carboxypeptidase n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI0007C395BF  ali  35  12....................................................KGELTENEQVRMNESAWCK-GSSSESCMYVPLNGTATVLEMLRGIIIQSGNDASKAMAEHIAGNEGTFAHMMNQEAKRIGMTNTQFINSTGMPA--------------EGHYSTAKDMAVLAQHIIKDSSKYYPIYSEKEFTFNG----IKQGNRNALL----YTDPSVDGLKTGHTDEAGYCLTTSSKRGPMRLISVIFGTPSMSERADQTRALLAWGFANFETANVQPANQVLA---KAKVWFGKENEVQVGLAENFNVTMPKGKADGIKTQLV-VQPNLSAPLQKGQVVGKLVASLDGKV--------IAEKPLVALKPVEEAGFFARLIDHIKQFFSNLF........... 320
36 0.000e+00UniRef50_R7DNH6 D-alanyl-D-alanine carboxypeptidase (Penicilin binding protein) n=3 Tax=Firmicutes TaxID=1239 RepID=R7DNH6_9FIRM  ali  34  25EAPKEVSLHTDAAILIEAQSGRVLFEKNADEKHYPASMTKMMGMYLILDAIEKEKLSFDDEVICSSYASSMGG----TQIFLEPNEKMSVKDLFKAVAINSANDAITALGEHLCGSTEGFVKKMNDTAKEMEMKNTHFKNPTGFD--------------DEEHVTTPRDMSIVAQALVKFQEKLFQFTRLKEAYVRNTSSPFWLVNTNKML----GHYEGMDGLKTGYTRLAGYNLTATAMRNHIRLISVVMHEDSIEHRAQDTTALLNAGFSNLENIKLFPMHEELLTYTFL---KAKKKDTPIVTKSEINLVVDKGEDLKIKARI----EEMNAPLKAGDIVGYLDV--------EDPYQNVTSYPLTILEDVEMMHFIDYFKDMFLRFLA.............. 385
37 0.000e+00UniRef50_C0EFM0 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Ruminococcaceae TaxID=541000 RepID=C0EFM0_9FIRM  ali  30  25..QAEPGVSAKAAILIEANSGKILYQKNAQQKLPMASTTKIMTSLIALES-----GNLDEWFTVDENAIKVEG----SSMGLQAGDQVTMRTLAYGMLLQSGNDAANAVAVKLAGSAEAFAEKMNERAQQIGMANSHFVTPSGLDN--------------EEHYSTAEDMAKLARTALQN-DGFREICSTTKLEYGNPPYTRWMTNHNRLLK----EYEGTIGVKTGFTKKSGRCLVSAAERDGVRLIAVTLNAPSD---WSDHKAMFDYGFSVVQPVKL----DCDFSAISIDVVGGTQEKLGVVPLEQPQAGVLSEDVGSIEKRIHLNS-FYYAPIKAGDVVGKAEYWLGDECL--------ATVTLLANGDSER--YITEIKLGFGDRCKLFFKGIGDQIAGW. 384
38 0.000e+00UniRef50_A0A140L8G3 D-alanyl-D-alanine carboxypeptidase DacB n=15 Tax=Clostridiales TaxID=186802 RepID=A0A140L8G3_9CLOT  ali  26  26..ADDFNISAFSAIVMDVKTGRILYKKNIHAKKPMASTTKIMTALLALE-----KSSLDSVVKVPRQAVGVEG----SSIYLQYDEKIKMEDLLYGLMLRSGNDAAVAIATHIAGSVDGFSQLMNRKAKEIGANNTNFMNPHGL--------------HHDQHYTTAYDLALITRQALLN-ENFKKIVSTKLWT-AQREGHRYFYNKNKTLTQL----EGGDGVKTGYTKAAGRCLVTSATRNGMQLVAVVLDAPNW---FEDSYLLLNYAFKRYQPYHVIHRDTYLK---SISVFNGEKSHTGIVAKEDVIIPVSEEEKNKI-LSVLEANETIHAPIARGMKIGKAKIYLDGRLL--------YTTDLFTREDIDQKHLKDKIIDFIQR................. 369
39 0.000e+00UniRef50_A0A1S6IS24 D-alanyl-D-alanine carboxypeptidase DacA n=19 Tax=Firmicutes TaxID=1239 RepID=A0A1S6IS24_9LACT  ali  37  29.AVEPISVSAEAAFVMDNGTNKVLLDQNGNEPLYIASMTKLLPIYLINQAVEEETISWDTAVPISDYAKAISQNYELSNVPLRQDFDYTVKDLYEAMVIYSANGATIAVSELLAGSEPAFVDLMKKQLDEWGIEGYSLYNVTGLPNNYASGNLYPDAPVNEENKLSARGVATVADHLLDDYPEVLETAKIQEKIFEGSGDEVRMTTYNLMLPDQLYARPAVDGLKTGTTDASGASFTGTALENDMRVITVIIGAEDNLMRFGETGRLMNYAFTNFEKVQVGEKGMAVETEKPLTVDKGKQEEVDLIYSEDAYVVTATEEAERITTELSLDTELLEAPIEKDTKVGEISISVEGEE-SDYIGDSSNQASVAVGSTIEKANAFVLAGRWITNTVSNGWNNMTEFISGFF 443
40 0.000e+00UniRef50_A0A1Y6JYU4 D-alanyl-D-alanine carboxypeptidase n=38 Tax=Lactobacillus TaxID=1578 RepID=A0A1Y6JYU4_9LACO  ali  41  40.TSSTVNLKAKAGIAVDATTGQILYEKNGDQSLPVASMSKLLSIYLVLQAVHAGKLKWDQKITISKPIAKVAENTDLSNVPLRAGHSYTVKALYQASLIYSANGAIEALGSAVAGSPHAFVTQMKAQAKKLGMTNVKIYNACGLTNKQVGDLGYSNVAGKAENEWSAADQAKLAVALLDKYPEVLQTTKITKMWFKGTKDATKMENWNWMLKGLTASYTHVDGLKTGTSDAAGANFTGTAHNNGNRIITVVLHAETDPSRFQQTQKMMSYVYNNFKTVT-YHAGQSITGAKSVTTHDAKTKTAKTALASDVKLWIRNDQKPQLKASLTKDN-ALEAPVAKNQQIGTANLSLKGDQLGFLGNTKTVKVPLKVTQSVEKANVFVRMWRWVVALF............... 442
41 0.000e+00UniRef50_A0A0H1KM02 D-alanyl-D-alanine carboxypeptidase DacA n=42 Tax=Streptococcus TaxID=1301 RepID=A0A0H1KM02_STRAG  ali  31  21.SAESFNASAKHALAVDLDSGKILYEKDANKPAAIASLTKIMTVYMVYKEIDNGNLKWNTKVNISDYPYQLTRESDASNVPLEK-RRYTVKQLVDAAMISSANSAAIALAEHISGTESKFVDKMTAQLEKWGIHDSHLVNASGLNNSMLGNHIYPKSSQNDENKMSARDIAIVAYHLVNEYPSILKITSKSVAKF----DKDIMHSYNYMLPDMPVFRPGITGLKTGTTELAGQSFIATSTESGMRLLTVIMHAKDKYARFTATNSLLNYITNTYEPNLVLAKGAAYKG-KEASVRDGKEQSVIAVAKNDLKVVQKRNITKQNQLKINF-KKELTAPITKKENLGKA-YYVDLNKVGKGYLIKEPSVHLVAKDSIERSFFLKVWWNHFVRYVN.............. 408
42 0.000e+00UniRef50_A0A1E8F1W7 D-alanyl-D-alanine carboxypeptidase DacF n=134 Tax=root TaxID=1 RepID=A0A1E8F1W7_9CLOT  ali  31  56.........AKSALLVEPITGKIVYEKNPHEKLAPASVTKIMTMLIAMEKINAGKMKLSDKITASENAKKMGG----STMLLDTGEIRNVEEILKGIAIASGNDAAVAMAEYIAGSEEAFVEIMNKRAKELGMKNTTFKNCTGLP--------------EDGHITTAYDVSIMSRELLK-HPKILKYTGTYMETIEGRKTPIGLVNHNKL----VRFFKGCDGLKTGFTNEAKYCISATAIRNNVRMLAVVMGSSTYKIRNKEASMLLNYGFSKFENKKVAFKDKPIEKITLDK--KGKKEFI-AKSKEDVNIVIEKGNENNIVKKPVLKMDKKQY--KKGDIVGHCEFYINGE--------CVGKVKIYCDRDLKKPGVFENLKSNFKNIL............... 403
43 0.000e+00UniRef50_UPI000BE9923A D-alanyl-D-alanine carboxypeptidase n=1 Tax=Anaerosalibacter sp. Marseille-P3206 TaxID=1871005 RepID=UPI000BE9923A  ali  29  23...TEPDISAQSAILMDTISGRVLFDYNSQEKLPMASTTKIMTALI---GIENGN--MDDIVKINKDSVGIEG----SSIYLYEDEEISKKDLLYGLMLRSGNDSAVAIAKHIGGDVGSFIEMMNMRSKEIGALNTNFVNPHGL--------------EDKNHYTTAYDLALITKEALKS-KEFREIVSAKTWVANRDKNN-YFYNKNKTL----WQYDGGDGVKIGYTKSAGRCLVSSATRKGMQLIAVVLNDGNW---FNDCYKLFDYGFDNYESIIVYDKGQFIKN---LKIKDGNEEYLPVITEDICTLPLKEDEKEKIKVVIHL-PDELEAPIIKNTKVGRIEVYLDGEMM--------YTTNLISKYEVKKINFFEKLLRSL................... 363
44 0.000e+00UniRef50_UPI000684BC88 D-alanyl-D-alanine carboxypeptidase n=1 Tax=[Clostridium] viride TaxID=47246 RepID=UPI000684BC88  ali  28  34......EVQAAAAILVDTSYNTVLYEKNSDERRPPASITKVMTALMVLEAIDRGELKGSDLITASANAPS-DITEDSSTQNIQPGEQMTVENLLYCLLIPSANEAANILAERVSGSIPAFVDAMNARAAELGMSNTHFMNPHGL--------------HNDDHYSTAHDVYLMVKQAMT-HPLFQKIVSTPSYTVPATNPERKFFNTNALLSANKYTYSAANGVKTGHTPEAGYCLASSARKNERALIAVVLGAPNDRKQFSESRRLLKWGFENFKPQTILSKDALLA---EVNVKNGKVSHVLAVPSSAIEAMMPTTEASKLQKDIELKHDSVYAPVKQGEVLGSVTVSYEGKEYG--------TVDLVAANAVD............................... 391
45 0.000e+00UniRef50_UPI000BA249C9 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Altererythrobacter mangrovi TaxID=1982042 RepID=UPI000BA249C9  ali  28  1.............MLVDVSSGQTLYSREADRRFVPASMTKVMTVMVAFDLIDSGKVSPNRVLTMSDAAYKEWHGV-GSTMFLEHRQQVTVDQLLHGITTVSANDGAIVLAEGLAGSVDKWVAMMNATARRIGMHDSHYGRPNGW-------------MDDGQTFVTAHDLALLASAMIRQHPELYHYFGHREFDFNG----LHQYNHDP----VTGIVKGADGIKTGFTNQAGYGFLGSAERDGQRLVMVVANAPTGRARNRASRELLEWGFDAFDHRKFFANGAQVG---SARVQNGSASSVGLAVQGPVTVALPKGSDPKVRLAIRYQGP-LRAPIDKGEEVAELTIKVDGMPISA--------VPLIATRTVGKAGIFRRLVNGVAGLF............... 346
46 0.000e+00UniRef50_A0A2S6T2G9 D-alanyl-D-alanine carboxypeptidase DacC n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6T2G9_9PROT  ali  25  15KSSFAIDTKAEQAVVIDFLTNEIIFEKNADQKIIPASMTKILTVYVAFDMLNNTDLTIDSVCNISPKAYRMGG----SRTFLEIDDKVSINDLLNGIIVQSGNDASLALAECLAGTEEDFAKLMNIYANKIGMNNSNFMNSSGWP--------------EDNHYSTVKDIAILSNSLIKNFPTMYTLFSKKTFTY----NEIKQPNRNKLLNNVL----GADGLKTGFTRASGWAISASAMRNERRITVSISGTNSSRSRLNESTSLLNWAFTQTSQKTLVNKNQIIKN---VDVWLGNKSTVNMIANEDLISILSYDQIKSIESKIEYQKP-LDAPIKAGQKIGSLIINISGKPEIIL--------PLVAEKNINKINPFKRIFAAIKYLIFG............. 370
47 0.000e+00UniRef50_C9RAU3 Peptidase S11 D-alanyl-D-alanine carboxypeptidase 1 n=1 Tax=Ammonifex degensii (strain DSM 10501 / KC4) TaxID=429009 RepID=C9RAU3_AMM  ali  25  27......EVKAEAAVLMEAETGQILYAKNPEERMYPASTTKILTALVVLQ-----HARLNDQIVASPEAVGTEG----SSIWLKEGEKLSVKDALYALLLNSANDVAVALAQKVSGSIPAFAQLMNETARACGATSSHFTNPHGLP--------------DPEHYTTALDLARITRVALGNR-LFREIVATKTYTFHRPPEPFVLVNHNKLL----WRYEGAIGVKTGYTTAAGQCLVAAAQRNGRELIAVILKSEGTEV-WNDAVKLLDYGFNAFKPVELFKKGETLGQAE---IPGGNQPLL-LIAGESFIYYVPTEERSLPRWQVHLNP--LRLPVRAGERVGEVLVTTG--------KGEGMKIPVVAGNAISPLPFWQRTSGKVTLGVLGL............ 376
48 0.000e+00UniRef50_R6WCZ1 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Clostridium sp. CAG:349 TaxID=1262797 RepID=R6WCZ1_9CLOT  ali  33  33EQSDEISCAAKSAYVLDFDTGTVVYAKNENEKLPIASMTKIMTASIILDDVKAGKLNLSDEITVSEKAAGMGG----SQVFLDANSTHTIKNLLKAVVIASANDAAVALSEAASGSEEAFVKRMNDKAEKLGLSNTNFVNATGLPALNA--------------YSSAKDVSYMLKNLLS-HDEYLEFSKIWEDYVHPDGRKTTMTNTNKLVK----FYQGCDGGKTGYTTEALFCLSATAKRGDTRIIATVIGEQNGKQRFKDVSDLFNYSFKAYENEVVVRKGENIG--KTVKVEKGKQAEVEVFADENVSVFKKRAGDDNVEIVYEL-SDSVKAPVKRGDVVGNARIVKNGVVIK--------TIELKAADNVGKENFFDAIRRILSNW................ 390
49 0.000e+00UniRef50_J9W1Z2 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=Lactobacillus buchneri TaxID=1581 RepID=J9W1Z2_LACBU  ali  33  32...PEPAIYAKSAIAVDADSGQILYQKNANQPRAIASISKLMTVYIVHQQIKANKLAWDDKVKISSELAKLSTASGLTNVPLTAGKAYSVRQLINATLVESANAAALALGQKVAGTATKFAALMNKTARKIGISDGHFYNASGLTNKLTGKLALPHVSANAENRLSAKDVALLAQKLLQKFPKVTNITKQTTSTFYGT----TMTGHNQLIDDNLGQGVRVDGLKTGTSDKAGACFVGSATTNGHRIITVVLGAASDPARFIQTAKLMKWVYATHQPIKLA-AGATIAGVGKAKIPDGKQTTILPVTKTTHWVWADKGSAKQISGQYVNQPAKLTSPTKKGTEVGHARLSIDGKRLQYIGHSAGKLV-MVTNQSVKKANFFVRLWRAILRLF............... 421
50 0.000e+00UniRef50_A0A2E9GHZ8 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E9GHZ8_9RICK  ali  28  32.....INTSAKYVYLMDYDTGRVLLEKASNIPXAPASMSKLMTIYMAFEALKQERISLXTELVVXENAWRISLPASGSTMFLXPLTKVSFEDLLRGIIVQSGNDACIVISEALSGSEEGFANDMNQKAKLLNLNNSNFTNSTGWPHKD--------------HKMSSRDLAILSQKLYQDFPEYMHYFSETKFTYNG----ITQSNRNPIL----YQDIGGDGLKTGYTKASGHGVVASAVQNNRRLILVLNGIEGTKLRAAESERILNWGFREFENKVIFEENEIV---DSANVWLGNKPNVPLIVKEKVYLSISKADKNDLKAIIKYIAP-LMPPLEPNVAVGKLIIKKND-------GTKINEYNLYPESKVNKAGPLGRLFGSLSYLIWG............. 394
51 0.000e+00UniRef50_UPI000D0932F6 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Enterococcus timonensis TaxID=1852364 RepID=UPI000D0932F6  ali  37  18.SADDLNLDVKSAIAIDADSGKIFYEQDADEVLGIASMTKLVSIYVLLDAVAAGTVTWDDPVEIPAYLIPLSQNFDLSNVPLYDHVTYTVKDLYEASLIASANAAVIALGVHVAGSEAEFVPLMQNKLTKIGITDATIVNASGLNNSYLGENIVPGTAADAENYMSARDMAILARHLLKDYPEILETTSITNKVFENTSMPFEMTSWNYMLPGFVNEKAGVDGLKTGTTDIAGACFTGTMTYNGTRMITVVMHANDPSARFNETSKLMDYVTAHWSQTVIDPATFQLPQT-SLPVETGEEETVALTMEDSQTLWIKDGIAPEVTSNITAENGKMPAPVSQNVKVGNFTITPSDDLGYIESADAPKTIAIVTKTAVEKAGIWQRMTSAVKNFFA----SIGNFFSNLF 430
52 0.000e+00UniRef50_R5VQD2 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Firmicutes bacterium CAG:631 TaxID=1262996 RepID=R5VQD2_9FIRM  ali  34  39..AIDLNLNCGASYLIEEKTGKVLYAQNETERLKPASMTKMMGLLLICEQIDQKKISLDDIVTISASAAAMGG----SQVFLEVNEQMSVHDLLKSVCISSANDAMYALGEFVATTNDRFVELMNQKAKELNLENTHFVNVTGFD--------------DDNHYTCAKDMAIIAQNLLQ-YPDILPYTSMYDGYIRNSEQPFWLVNTNKLI----RFYEGMDGLKTGYTSQSGFCLTATAKRNNVRLISVIMKADTSANRNEMTKTLLDYGFSKLEAKTLYQANDKVA---TIEIKKAKQPKVDVYTPQDIQVILDKEENVNIKQQIQL-KDSLKAPLKKDSVIGQLVVTVDEDVY---------TFDLIIKEDIDLLTYKEIFGDFLKSILA.............. 396
53 0.000e+00UniRef50_R6SNT9 D-alanyl-D-alanine carboxypeptidase (Penicilin binding protein) n=1 Tax=Clostridium sp. CAG:417 TaxID=1262804 RepID=R6SNT9_9CLOT  ali  33  53........NAVSGLLMEESTGEIIFEKDKDKQVAVASMTKMVAQIIILENIESGNIKWSDVVTASKNAADMGG----SQIYLAANEKMTVRDLFKGISMASANDAVVAMAEYIAGSEDKFVKKMNDKVKKLGLKNTVFKNATGLD--------------EDGHFSSAYDMAIIARTLLS-HQEILEFSGVYEDYLRNTPNKFWLVNTNKL----VRTYNGADGLKTGHTDNAKYCLAVTAKRDGMRLIAIVLGEDNAKVRNSEAAQLLDYGFNN-KQIQLIKKST--DEIKKIKLDKATEKSITIVPKYDVSILKDKG-ISNTKYKTSVKVDKIVLPLKKGDVVGKISVLDNNKV--------VATQDLVATKNVDKLNFFQLFMKNITKISSGIL........... 406
54 0.000e+00UniRef50_A0A0J1FJ38 D-alanyl-D-alanine carboxypeptidase DacB n=31 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1FJ38_9FIRM  ali  27  74QPADSLRLSADAAVLMDAETGDVLYAKNTHKRRAPASTTKIMTAILGLEL-----GKPDEIVTVSAKAAQVGEA----TLHLDPGEKLTLDELITGALVKSGNDACVAIAEQIAGSEAEFVRLMNEKALLLGATDTHFTNPNGLP--------------DKNHYSSAYDLALMARYGLR-IPAFAAITRLKETEIHFLQPDVIMRNTNKLL----WNYPYADGVKTGTTNAAGKCLVASATKEGRRLVAVVLNAPD---RFGDARKLLEWGFDRTETTTLAQAGQIMGDY---PVPG--TTAVPAFAAHAVRVSLSREAVSGLSAKVVWDRPP-RLPLQAGEVVGRYEVWLGKQKLR--------SVPLLSERAVSK-DWLGRI....................... 413
55 0.000e+00UniRef50_UPI000DCAD945 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Pseudomonadaceae TaxID=135621 RepID=UPI000DCAD945  ali  25  37......NVSAKAYVLIDPDAKQVLAQKDGNLRFEPASTTKLMTALLVFKALRAQHIDLQQKVFIGGSAWKQSG----TTMYLHAGMEVTVDDLIKGLLVQSGNDAAYVLAEVVGGTVDQFVIMMNAEAQRLGMLDTHFMNPAGLP--------------EEGHLSSAVDLGALALTLVNGFPEYAHYFAIKEYHYPGTPTANR-KNRNPLL----FSDPSVTGMKTGYTAAAGYCLVATAQRHERGMLLVLLGAENEKRRAEEAAGLISWGYRAFEQVQ---AEQAVTSFDPIKVWKGMTSHVEIGLQAPVTLSVPTGQQAGLRSEVEYFEP-IIAPVEQGQQVGVVRWSLLGGLIRAE--------PIIAQHAVPEGGWLSRAWGSLCLWLHGLLE.......... 397
56 0.000e+00UniRef50_A0A2C6LI62 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6LI62_9FIRM  ali  28  32....PPKIKASAACLMDVATGRIYYEKDGDKRREPASLTKVMTAIL---AIENGNLK--DIVTVGKRAAAVSMGQD---IGLKTGDRLYLEDLLKAALMYSANDSTVAIAEHIGGSHDMFVKMMNDKARVLGMKNTRFANTNG--------------YHHPNHYTTANDLAILTSYALKN-KTFAKFVKTEEATIDEHPKQRVLHNTNRLLRSD---FEGIDGVKTGTTPRAGNCLIASATREGRQLVAVILHSNN---RWNDATRLLEYGFNEIKPVVLTEKDEVIT---ELPVLDGLDKKVSLVAAQRIEVYLPRIDVDKVERKATLNPTP-TAPVKQGTKLGTATYFLNGK--------EIASVDLVANRNIERVSWFNRLFD..................... 388
57 0.000e+00UniRef50_A0A2C8ESR9 D-alanyl-D-alanine carboxypeptidase DacA n=9 Tax=Lactobacillus TaxID=1578 RepID=A0A2C8ESR9_9LACO  ali  39  41.SSSAINLTAKAALAIDADTGQVIYEKNADAVLPIASMTKLISIDVILDQIKSGKLTWDQKVTVDDDSYKISQDTSLSNVPLSKTKKYTVKELYDASLIYSANGAIMALAHQVSGSQKDFVTLMRAKVKSWGINDAKIDNVSGLTNSDISDDRYPGSSAADENELTAKDMGLIAKNLLKKYPEVLKTTSIKRQAFKGTSDETLMENWNWMLPGLAKAYTPVDGLKTGTSDKAGECFTGTVKKDGHRIITVVLGSETDVSRFTDTQKIMSYVFDSFDVKTI-KAGTTFKNADSLPVFHGKELTTKVALKSDQKVWLKKGETVKVSATVAKNKTGLEAPIKANSDIGTLKLTGKDGALTYVDGAKALSVTGTNEKAIEKANIFVIMWRAVANFFKNLF........... 449
58 0.000e+00UniRef50_A0A238LK03 D-alanyl-D-alanine carboxypeptidase DacC n=37 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A238LK03_9RHOB  ali  28  21.SAQGFDTRATAAWVYDQSTETVLLAKNADQPLPPASMSKLMTLYMAFEAVANGTLEIDQELPVSQHAMDYGG----SSMFLRAGERVRVEDLLRGVIVLSGNDASAVLAEALSGTEATFARQMTQKARSMGMNNSTFLNSNGWPA--------------AGHEMSMHDLGILANRIILDFPTFYPLFAETEFLFDNRVPSNTQ-NRNPILGLGI----GADGLKTGHTQEAGYGLVGSAKQGDRRIIFVITGLDTAQARRDESERIVNWAFRQFVEAEVTAEGTQVA---EADVWMGELPSVGLRMAHDISLLLPLDESESLNAEAVYNSP-VEAPVAEGQVLGEVVITRTGLP--------EIRVPLIAMTDIAPGGFGIRLQTAASVLIS.............. 379
59 0.000e+00UniRef50_A0A2N2EIK2 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A2N2EIK2_9FIRM  ali  31  39.....LKLTSQSAVLMEPLTKTVIYEKNSHERLKPASVTKIMTLLLIYDAVEAGKIGWDDEVVISETASGMGG----SQVYLETNEVQTVATLTKCIAVASANDGSVAMAEYIGGSEIGFVQMMNDKAEALGMVDTNFENASGLDS--------------DNHYTSAYDIALMARELTVKYPEIFDISTIWMDTIKRGAEEFGLTNTNKLLQ----WYDGATGLKTGSTSLAKYCLAGTATRNDLDLIAVVMAAPDFKVRFKEVMSMFDYGFALCRK---YKDNVVNQDMGSLKVRRGILEEIKVFAKEDFNYVMTKYDESKIKKQVIL-PEYIEAPVVKSQKVGDLIYTYDGK--------EIGRVDIVVLDDVNKAKFSDYLKNVFEKYVN.............. 398
60 0.000e+00UniRef50_A0A1E3WBT3 Uncharacterized protein (Fragment) n=1 Tax=Methyloceanibacter marginalis TaxID=1774971 RepID=A0A1E3WBT3_9RHIZ  ali  33  26QKPDGFDTKAQYAILLDSGADLVLYEKNADTRMIPASMSKLMTLALVFRELKTGRLKLDDSFIVSEHAWRTGGAPSGTAMFAPLGDPIPIGDLIQGVTVQSGNDATIILAEGIAGTEEAFVKMMNDYAKELGMTQSTFVNTNGLPA--------------EGHLTSARDLAILAKHLIEVYPEYYHYFGQKEFRYR---DKFTFRNRNPL----VWADIGVDGLKTGHLKESGYGLVASAQRGDQRLILVVNGLESPEDRESESRRMLEWGYKSFKPFRLFDADEKVSD---ALVWGGEKHYVPLVA.................................................................................................... 309
61 0.000e+00UniRef50_H6P841 Penicillin-binding protein5, D-alanyl-D-alanine carboxy peptidase n=34 Tax=Streptococcus TaxID=1301 RepID=H6P841_STRIC  ali  38  21.ADDTFNVAAKHAIAVEASTGKVLYEKDATTPDGIASMTKILTVYLTYKEIDKGNLSWDTKVPISDYAYDLTANSDASNVPMEARE-YTVEQLVNAAMVASANSAAIALAEKIGGTESKFVDMMQTQLQEWGINDAKLFNASGLNNSYLGDNIYPGSSSTDENTLSARDVAIIAQHLITEYPDVLKISNQTTADFEGS----TMNTYNYMLKGMPYERDGVDGLKTGTTELAGASFVATSTENGMRIISVVMNADNEFARFEATNALLDYVKSNYEMTTLVDAGES-TKNSKAKVIDGKEKTVPAVASQELKVVHRIGTDASVKFSTKI--KGYEATINKGDKVGSF-IYDDKQIVGTGYLESKPSAPALAKKEVKKAFFLK......................... 396
62 0.000e+00UniRef50_A0A259UWS1 D-alanyl-D-alanine carboxypeptidase DacB n=8 Tax=Negativicutes TaxID=909932 RepID=A0A259UWS1_9FIRM  ali  28  26...APPVMSAQGAILMDAKTGQVLYDRNMNKKLAPASTTKIMTAII---AIESGR--LDETTRVSAHAAATGG----SSLNLYPGQSITLRELVTGLLLRSGNDAAVAIAEHLAGSVDAFVEIMNKKALSIGAIHTQFRNPHGLSA--------------PNHLSTAFDLASIARYALLN-PTFSQIVSTKETNIKGQNHNRNLRNTNKLLWMLA----DADGVKTGTTNMAGPCLVSSATRDNQRLIAVVLH---DHARWYDSMQLLKYGFEQYDLYEYAEDGAVFSA---LPIENGLTDMVDALVAGPGSLVVTATDYPAVTVEVDL-PEKIKAPVYQGQKIGEIVFYVQDK--------AVKTVDLVAGSTVEEYTINKILLRH--------WLSTIQRLSGW. 382
63 0.000e+00UniRef50_A0A2E9KZR4 D-alanyl-D-alanine carboxypeptidase n=2 Tax=unclassified Deltaproteobacteria TaxID=45456 RepID=A0A2E9KZR4_9DELT  ali  29  34QTLKKFRPNYKAVLMADANTGRVLFAEQEHRRVYPASLVKLMSVLLTFEAIEAGKTSLDEIVVTSTKASKIGG----TQVFLKEGEEFSVREILKAMIVRSANDATLAMAEHISGNEDSFVRLMNQRAKELGMAHTEFHSPHGLPPSRGEKH----------NVSTAYDLLLLARFILHNHPQYLEWSAIEIDSFRAGT--FQLVNTNR---KLMRAYKGMDGMKTGYYRAAGFNLVSTAKRGERRLISVVMGSPNVKWRSRITSYLLDKGFNEYQTTQLVEAEKIISQ--TVLVDDGQHKEVTIKPQMSASLLLGPGEEDKVKLFYQL-PEKVGAPVEKGSMLGTLELRMGGKTMR--------QIPLVAAEEVPTQSFFASVAESIFNW................ 394
64 0.000e+00UniRef50_A0A0R2B8B2 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Lactobacillus brantae DSM 23927 TaxID=1423727 RepID=A0A0R2B8B2_9LACO  ali  38  26.AASTIDVNARAALAIDAKTGQVLYAKNADQALPIASMTKMVGIYLVLDAVKSGKLSWDQEVAVDALSYRISQNTNLSNVPLRSDGKYTVKALYQAALISSANAAMMLLGDALSGNQAQFITAMQNQLHKWGIQDATIVNSTGLNNSELGQDIVAGTGANAENSMSARSVAIVAQHLITDFPEVLQTTKIPKLKFSGNSDNTMMENFNHMLPGLSSYDASVDGLKTGTTDLAGANFTGTVEKNGLRLITVVMHAPDHEVRFSQTAQLMKYVYGEYVPVAVFKAGTSAGPSKQIAVKRGTQEHVAIAPAKSMTIYLPK-SATQVQYQYTAAKKQLSAPETAGTRVGTLSL-AGNASYLTNVSGQRLSVPMATQKTVKKTNVFVLIWRGIVEFFSNLF........... 423
65 0.000e+00UniRef50_A0A0F2PKF6 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PKF6_9FIRM  ali  27  24.ACAQPEIAAETGLVMDVDNGQVLFAKGADQKMYPASTTKILTALVALKNC-----SLNETVTVSEKAV----LPGGSAVGLQPGERLSVRDILYAMMLSSANDGADALAEHVGGSEEGFVAMMNQEALNLGATNSHFTNPHGLP--------------DPEHYTTARDLAIIARAAMQN-PTFRKIVGTYHYRMEDGIPQVDFVNHNRMIPSSMFSYEGATGIKTGYTVEAGQCLVVSARRGERELLSVVMKCQGYDV-YKDSKTLLDYGFSAFTPAELVKSGVRMAN---VQVDGGKDDQVAVVTGKSFYYNFPAAGKVNVTRKVEL-KKDLHAPVYREDRVGALVFYEDNREIGRVSLLAYKTV........................................ 368
66 0.000e+00UniRef50_D2BP17 D-alanyl-D-alanine serine-type carboxypeptidase n=67 Tax=Lactobacillales TaxID=186826 RepID=D2BP17_LACLK  ali  36  30.TTNDFTVAAKSAIAIDASSGKILYAQNADDATRIASITKLLTAYLVYKNVAENKLTWNTKVPISDYAYELTQNSNASNIPLAQNGQYTVKDLLNALLLPSANSAAVALAEKIAGSEPKFVDMMTKQMKDWGITDSHLVNASGLPNDDLNGHIYPGSGASATNIMSAKAVATLSYHLIQDFPEILQITKKTEIPFDGNEAKMTLTNTNQMLSGFSTSRTGVDGLKTGSTSFQIDCFAGTTNQNGFRIITVVLEATDPAADFTLTNQLMNYVYGHWRTTSLVQKNQSLDDFKEITVTDGKEKSVQLVAPQNITPVVPDGSADTKSLTVKFSKEKVEATVTKNQKLVTLSTTVKD-SLGYLPNCTAEQIPLVAKKTVPRSSAPKVFWNHFVNFVN.............. 432
67 0.000e+00UniRef50_A0A1V6BEM0 D-alanyl-D-alanine carboxypeptidase DacF n=1 Tax=Tenericutes bacterium ADurb.Bin140 TaxID=1852919 RepID=A0A1V6BEM0_9BACT  ali  32  46.........SKSAILIEAETGQVLYAKDPDLKLAPASMTKIMTLKLIFDALKQKRINLDDVVTASEYAAGMGG----SQIYLGVGEQMSVRDLLKSVGIASANDAAVALSEKISGSEANFVQMMNNEAKKMGLKNTVFQNATGLPEH--------------NHYSTCRDMAIMSQKLLAEHPEVLALTSQYEDYIRGTDKQFWLVNTNKLVK----HVPGVDGLKTGWTEEAGYCLTATMSKDGMRVISVVMAAPSVNERTQDTMALLNYAFANFEKETVLPKGTVVETIDNVLL---EPHRINVVTGEDLVRIRNKNQEANIDYKAVNDLKNLN--------IGSAKAYSGETV--------VDEVPLHLEIESSRASFFSIFREILKKIFA.............. 397
68 0.000e+00UniRef50_A0A2N0EDV5 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=Pseudomonas tolaasii TaxID=29442 RepID=A0A2N0EDV5_PS  ali  28  31.SIAPPRLAASSWILMEYASGKVLAQSNADEKTDPASLAKIMTSYVVGQAIKADSLRASDEVTINRDAWAAGNPRGSALMFLEPGSRVTVDALNKGMVVQSGNDACIALADYITGGQAAFVAVMNDYADKLGLSNTRFKTVHGLEAQ--------------GQFTTARDLALLSQALIRDVPEEYALYRQREFTYKG----IRQYNRNRLLWNTGLA---VDGLKTGYSKASGFGLVSSAVVGDMRLIAVVLGAPDERSQFQASEKLLKWGARAFERRVAVKPDEVYASK---RVWMGETSVVRLNAGTQGAVVLPYGLADDVQTTAVLSEPVLTAPLQKGQVVGVIDVQVRGK--------SVAQTPLVVMDAVEEGGFLRRAWDFLLL................. 389
69 0.000e+00UniRef50_E6SLU7 Serine-type D-Ala-D-Ala carboxypeptidase n=4 Tax=Firmicutes TaxID=1239 RepID=E6SLU7_THEM7  ali  30  179....PPPQDARAAILVDAATGQVLYERNADATMPMASTTKIMTALLAIE-----RGDLRQVITTSERAFGVEG----SSLYLALGEQRTLEELLYGLMLQSGNDAAVAIAEGLAGSVETFVDWMNRRAQELGLEHTRFADPHGLASRD--------------HYTSARDLATLARVAMAN-PTFRRIVGTREYPWPEKQSERVLYNHNRFL----WRYEGATGVKNGYTSAARGALVASAQRDGVELIGVLLGA-HPTGMYRDMAALMDWGFARFAPVELVRAGETVG---EVAVTGGRQDRVAVVAAYGLRWLVPRDEPAPPVRRTVEPEGALPAPVARGARAGTLVIRVGDQV--------VDRIPLVTARAVEPLPAWE......................... 518
70 0.000e+00UniRef50_E0TIF3 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Parvularcula TaxID=208215 RepID=E0TIF3_PARBH  ali  26  27.SAQSVTTDAPTALIMDGETGDVLFEKNARTPIPPASMSKLMTVAVALDMIATGELSADTPFSVSERAWRTGG----SKMFVLVGTEIPLKELLKGIITVSGNDAAIVVAENIAGSDAAFADIMNRKAARWGLTGSHFANPHGIP--------------DPEQRMTALDIAKLARHIWDSYPDYRYLFSLPEMTWS----DITQRNRNPLLGL-----EGADGMKTGHTEEAGFGVVGSASRDGVRRYIVVAGLPTSEARASTARRLLDTAFNDYSTVTFFTDGDRVG---EAEVFGGLSETVPLEVSTAIRMTRHVSAIRGASAKLLYESPVL-APVEEGDRLGVLQIALPGEPPQD--------YPIFAAERVRERGMASKMAIGLRTLFT.............. 379
71 0.000e+00UniRef50_A0A0G7I9Y8 D-alanyl-D-alanine carboxypeptidase n=18 Tax=Streptococcus equi TaxID=1336 RepID=A0A0G7I9Y8_9STRE  ali  31  21..AENFSVNSRQAIAVEMTTGKILYAKEAQQKAPIASLTKLLTVYLVLKEIKAGRLQWDSQVTLSEYALQLATDPDISN-PAFEQRPYTIKELVESSLIISANSSAVALAEHIAGSEPTFVDMMKKQLEAWGIRDYLLVNASGLNNSMLKGHLYPGSQPDDENQMTARDLALIAQQLIQDFPELLTISSQPQLKWGEKA----LPSSNLLLAGREMGRAGVDGLKTGTTSQAGQTMIATAVQDNMRVISVILHADDERARFVETNRLLDYCFNSYALEKLVAQNQVLP--ERLIVKQAAKQRLRVKASQTLTVVRPKDQT-ELSYSLRIKDKALKAPIRQNKKVGTL-IYQDPKLIDSGYLAAPPAVAIVSAKSIPEKGKLSKLFDFFQKVIGILIN.......... 410
72 0.000e+00UniRef50_A0A174CN68 D-alanyl-D-alanine carboxypeptidase dacC n=94 Tax=Bacteria TaxID=2 RepID=A0A174CN68_9FIRM  ali  30  74......QIGAPSALLMEASTGTVLFEQDADTKRPPASVTKIMTMLLIFDAVESKKISLEDKVPVSEFAASMGG----SQVFLETGETQTVDTMLKCISIASANDACVAMAEYISGSEEAFVQEMNKRAKALGMHNTNFVNCNGLDAQ--------------GHVTTARDIALMSRELITKYPQIHEYAMTWMENIKKGTSEFGLTNTNKL----VRQYEYATGLKTGSTGEAKFCVSATGKKDDVELIAVVMAADTSKERFADAVKMMNYGFGKCQ---VYSDEKPMKTKYAV-VKNGVEENIEVERGEKFTYLDVKGKDMKKIKKIEKINKKILAPVRKGDVVGSIVYTLDG--------NEIGRSDIIAKRGVQKAGFSDYLIKVSAKFLIG............. 431
73 0.000e+00UniRef50_A0A0S4PGV8 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A  ali  29  19...QNLTLQAKSAVLLEARTGQVLYAKNAHLRLPPASLTKMMTALVVME-----HAALDDIVTASKRAVETP----ASSMHLKEGEQVSVRDLLYALLLRSANDAAVALAEHVGGSVEQFARMMNEKAQALGAKNTHFTNPHGL--------------HEPNHYSTAYDLALIARAFMEN-ETLRTIVQQRYHIVQRSLNDLWMVNKARFLQM----YPYAEGIKTGYTRPAGFCFAGSASKEGRRLIAIVLNSP---QREQDTIALMEYGFNAWVPLEYGTVDMVVGH---APVAHGRQTNAPVGLAQPAYWVVPTSQRHHYQWALTFSP--LQAPVAQNQPAGWLLLKQGERI--------VYRVPLRTLSAVEARS............................ 352
74 0.000e+00UniRef50_A0A2A5RWE2 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Streptococcaceae TaxID=1300 RepID=A0A2A5RWE2_9LACT  ali  35  10.ADQTFDVKAKAAIAVDADSGKILYSKNADTPMGIASITKIMTIYMTLDAIKKGTLHWDDKVKMSDYAFNLTQNPEASNIAVKKNEAFTVKDLFNAALIQSANSAAITLAEKIGGTEPKFVDQMKTQLAYWGIKDAKLVNASGLNNSVLDENIYPGSSKTDENELSAKDVAIISKHLINDFPDVLDTSKKATETFDHGDSEQPLTSYNYMLPGLSAGRPGVDGLKTGTTAFAGACFVATTVQNNFRIITVVLNADDSNARFQATGELMNHIYGTWQLQTLATKGVKIDDPSKLTVLDGQSKQVTLLPDTDLSAVVPMAANDTIT-SLTYNKKTVTAPIKKNQKLVQATFQIRDK-LGYLPGLDGKKFYLTATKEVPKSNAVKVMWNHFVRFVN.............. 411
75 0.000e+00UniRef50_A0A2V2GQX3 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Ruminococcaceae bacterium TaxID=1898205 RepID=A0A2V2GQX3_9FIRM  ali  32  29.ALDPGELDAKSALLMEAETGEVLYEMNADESLPPASVTKIMTLLLVMEAVDGGSISLEDNVSVSEKAAGMGG----SQVFLSSGEQMSVETLIKCTVISSANDAAVALAEYVCGSEEAFVARMNERAAELEMNSTHFENATGLDDTTV------------NHVTSARDIAIMSAQLMR-HDKILEFSSTWMDSIRDGA--FTLTNTNRL----VRFYDGATGLKTGSTSKAGFCMSATAKRGELHLIAVIMGASSRDARNTSAKKLLDIGFAS---KALFRSEST--QLDPIPVHGSLGGSVTPLAQQ-FIRVIEKGQDGRITTEYEL-PEYLDAPVETGQVIGRAIYSAEGNIIG--------ESDITASGSIVAASFFDVFTQIMLKFLMN............. 383
76 0.000e+00UniRef50_A0A1Z9IG16 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhodobacteraceae bacterium TMED160 TaxID=1986860 RepID=A0A1Z9IG16_9RHOB  ali  28  24..AYSFDTKARAAYVIDHTSGTILLSKNSDLPLPPASMSKLMTLYMTFEFIKAGXLSLXEKLPVSXNAAKYTG----STMFLNPTDRVTVLDLIRGIIVLSGNDACAVIAEALSGTEAGFAKLMTQRGKQIGLENSTFKNSNGWPA--------------DDHKMSVRDLGILAEKLFTDFPEXYPMFAEQTYEFDGRAPANT-RNRNPLLGLGI----GADGLKTGHTKEAGYGLVGSAKQDGRRIIFVLSGLNTLEDRAQEAETIVNWAFRQFMMEKFATGGSEIG---KAKVWNGKSRNVGLVLENDLNVMLPVLSSGGPSFSVEYIGP-IKAPIKKGDKIAELVIKSSDLPETRHS--------LLAGNSISAGGFFVQVRTAGQYLLNMLFTN......... 386
77 0.000e+00UniRef50_B8CW10 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Halothermothrix orenii TaxID=31909 RepID=B8CW10_HALOH  ali  26  45...................TGQVLYNHRMNHKLPPASTTKILTTII---AIEEGE--LNEMVTVSRRAAYQEG----SSIWLQEGEKLPLEDLLYGVMLASGNDAAVAVAEHISGSVKKFSELMNKRAKEIGATNSNFLNPSGLPQS--------------GHYSTAHDLAMIMRYALKN-DIFARITSTKYKTWPGKEWDRGLRNHNKLL----WKYPDITGGKTGYTRAAGRCLVASAKRDNRHVVAVVLNCPND---WVEIRKLLDYGLNNFKKIRYIKKGQVLRTLEWTR---SREKTFKLVTGEDLDIVVPEGGSIKIKKEIVLNPD-ITLPINKGDVVGELILYSGQRIIG--------KADVISGNDLNFNSIFLRFWHKISS................. 374
78 0.000e+00UniRef50_A0A059ZX79 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Acidithiobacillus caldus TaxID=33059 RepID=A0A059ZX79_ACICK  ali  32  46...........SYVLMDYDSGQIIAAKEENLHRAPASLTKLMTAYLTYQAMANGSLRPDETVNVSNTAWKTGG----SRMFIQPGLPVTVDQLLHGLLIDSGNDAAVALAETVGGSQAGFVTLMNDAARQLHLDNTHYSNVNGLPDSNL--------------YTTALDVAKLSRALIQQYPQVIAITRQKSYTY----NKITQRSWNPVL----FRDPSVDGLKTGLTDESGYCIDATAQRNGRRLIAVVLGGPSWSGSTNAVESLLNYGYRFFEDHELYKPMTEVG---EIRDPNLSPMRVPVAVATEVIVTVPRGRLDELDRRIVWKPAG-SLPIAKGGVVGEMILSLHGQTLQ--------TVPLVSLVPVDRAGWLARQWYRIQS................. 386
79 0.000e+00UniRef50_A4WRX4 Serine-type D-Ala-D-Ala carboxypeptidase n=28 Tax=Rhodobacteraceae TaxID=31989 RepID=A4WRX4_RHOS5  ali  28  22....AFDTRARAAWVYDVTTRTVLLDKNAHEPLPPASMSKLMTLNMLFEALRDGRVTMNTTFAVSTKAKQMGG----SKMFVEERDRPTVEDLIHGIVVNSGNDACVVVAEGLNGTESDFSRAMNVRAKALGMNDSTFTNSSGWP--------------EPGHRMSVHDLGILAVRLIEEFPEYYPYFAHTEFNYKDRVPSNA-NNRNPLLRLGPDGDWTADGLKTGHTQEAGYGLVGSAQKDGRRIVFVLTGLATEADRAQEGEQIVNWAFRQFVQKTLVKKGQRVA---EADVWLGNASRVGLVPAEDVTLLLPALVQEGVTAEVSYTSP-LRAPIAAGQELAELVIHVPDLPD--------ARVPLVAEGSVGSGGLQVRLMTAAKVL................ 378
80 0.000e+00UniRef50_A0A1C5MMA1 D-alanyl-D-alanine carboxypeptidase dacB n=52 Tax=Firmicutes TaxID=1239 RepID=A0A1C5MMA1_9FIRM  ali  29  99..QEDILIQAPAGILIEADTGTVLYKKSEEEKRSPASITKIMTLLLIFDSLADGNLKLTDTVTTSAYAKSMGG----SQVFLEEGETQDVETMIKCIVIASGNDASVAMAEHIAGSEQEFVKRMNQRAEQLGMQDTHFEDCCGLTDS-------------ENHYTTAKDVAIMSRELITRYPKILTYSSIWMENIKQGSKEFTLTNTNKLL----RSYEGCTGLKTGSTGKAKYCVSAVAKKNDITLIAVVMGAPDYKVRFRDGAALFNYGFSKCSRYI----DDHPMKLPRLKVGNGKEEYVALKYEKTFVWIGTDGKNIGEVTRKLSLPEQVTAPVKRGKLAGKMEYYAGKE--------QIGSVNILYDQSVPRSTWIWSLGKLVRKL................ 458
81 0.000e+00UniRef50_A0A174R5M9 D-alanyl-D-alanine carboxypeptidase n=11 Tax=Clostridiales TaxID=186802 RepID=A0A174R5M9_9FIRM  ali  28  35...DEMDVNAKAAVLVDPDTGEILYEKNAHAHNYPASITKVMTCLLTLEAVDRGELSLEQTVTASS-ALHTGIGEGASTADIKEGEQIRIIDLLYAALIPSANEACNVMAEAVSGDVASFVELMNTRAAELGMEDTHFSNTHG--------------YHDDDHYTSAYDIYLMCREAMK-HETFRTIVGSKNYTMPATNEPRIIRSTNALISNFRYIYEYATGIKTGSTPEAGYCLAASATRENRNLISVVMGCEREPIYFDETIRLFKWGFANFSTQTIL--DNTKRDIPEVEVTLGKAASVTLMPDGKLTALLPNDSAENFTYDYTLETRSVEAPVEQGQVLGTITAYFNGKSYG--------TLDLVATCSVERDPWLYRL-DRIQKFF............... 412
82 0.000e+00UniRef50_UPI000A07B3C1 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Hellea balneolensis TaxID=287478 RepID=UPI000A07B3C1  ali  28  1...............MDFETGEVLYEKDAREPMAPASMTKIMTANMIFEALKNETITMDTEFRVSEEAWRRGGAASGSSMYLDVKSSARVEDLIKGIIIQSGNDACIVMAEGLAGSETAFADKMTARAREMGLTSATFRNSTGWP--------------HPEHEISAYDLAQLAQYMITNHPEYYPIYNERSFTW----NNIRQGNRNPLL----GKFTGADGLKTGSTSVSGYGLVGSAKRGDDRRIIVINGLENKQERSDVANRLMGAAFDQFKVYDLYAKGDIIG---KIDIFMGKADNVGVKVDETVIAGLYRGDRSKIRSKMIF--KTVSAPVMAGDHIADMVISIPGKEDRV--------IPLKAIDDVKGKSAIGKAWSVLIRKIRG............. 345
83 0.000e+00UniRef50_A0A2K4ZIF6 D-alanyl-D-alanine carboxypeptidase DacF n=1 Tax=Acetatifactor muris TaxID=879566 RepID=A0A2K4ZIF6_9FIRM  ali  29  29......TVSSPSVILIESSTGEVIYELNSTERRSPASITKIMTLLLTFEAIDSGKISLTDQVTTSEYASSMGG----SQVYLAAGEVQSLDTMIKCIAVSSGNDASVAVAEHIAGSEEAFVALMNEKAAELGMVDTHFEDCCGLSDS-------------DNHYTSAKDVAIMSRELTTKYPDIFQYTTIWMEDIRQGTANFTLSSTNKLLK----QYQWTTGLKTGSTSKAKYCFSATASKDGIDLIAVVMGAPDYKTRFGDAQILLTYGFSVCDIY--VDENQDV--LLPLTVEGGVEEEVAVRYEGEFRYLDTGGSDLSAVEKVVELPEKVQAPVKEGMEAGCARYLLNG--------VEIGSVPVLFAEDIDRAGYTDYFRRVLGFFL............... 385
84 0.000e+00UniRef50_A0A1H6HB21 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1H6HB21_S  ali  29  1...............MDAATGTVIYSRDMDTRRYPASTTKIMTLIVALE-----QGTLDDIVTVSKNAEGMEG----STLWLEQGDKVPLKELLYGMMMASGNDATIAVAEHIAGSVPAFARMMNEKAREIGASDTHFVNPNGLP--------------DENHYTTARDMALIAAYGYR-LPEFEEIVGTREITFPWVKDDTRLRNENQML----WLYKGGNGVKTGYTDAAGRCLVSGAREDGLQLVSVVF---DSVYMWNDSIALLDYGFDQVEPEKIISKGQVVGSV-SVGLFQG---ELEVKAAKDLAIALKDGSRVKYDQKLE-VPDSLTAPVKEGERVGRLVLMQEGREVGA--------VEVLAAASLEEQGFFSRLMAWFQSLWKGLF........... 341
85 0.000e+00UniRef50_A0A1Y0GAT9 Uncharacterized protein n=1 Tax=Sulfuriferula sp. AH1 TaxID=1985873 RepID=A0A1Y0GAT9_9PROT  ali  31  32..PDAPDVDARNYVLVDPASGQVLAAREAEQKVPPASLTKLMTAYLTLQALQQGRLKLDQVVPVSVAAWKAGG----STMFLQPGLPATVEQMIQGMVVVSGNDAAVALAEAIAGNTDSFVQMMNMTAAQLGMTHSHFDNVDGLPT--------------PTHRVSARDIAILTEDIIRQFPQYLHYFGEKSFTY----NKVTQANWNPL----VFSDATVTGMKTGHTEEAGYCLDATATRNGRHLLAVVLGSASRTGSAKAAEALLNYGYSFFETRRAYSAGQVIS---TVRNNQASPATITIGSLGDVWVTVPRGRYAQLKSSVSLFQ-QMPLPLKRGQHVGSLILSADGK--------EVARVPLVSLQAVEKAGWFGHMWNIIRAMF............... 383
86 0.000e+00UniRef50_A0A1C6GZA4 D-alanyl-D-alanine carboxypeptidase dacA n=10 Tax=Clostridiales TaxID=186802 RepID=A0A1C6GZA4_9CLOT  ali  31  17QAAALPELYAKSAALY-AANGQELYVYNADEQLQPASVTKIMTMLLAMEALERGEVTLDTMITGSEYACSMGG----TQIWLEPGEQLTLDEMLKAIAVGSANDCAVAVAEHLAGTEAAFVERMNTRARELGCTNTTFINANGLDGEGQKT------------LTSARDLALISCELLR-HPKILEYTGIWMDTVRGG--KFGLANTNKMLK----SYQGLTGLKTGYIREAGFCISASAERDGLSLVAVVMAAPTKENRTADATALLNYGFANFTAYTPAAED-----LEPIPVTLGTAETVQPVLEGSDTVVIEKARAEDMQTTFDL-PETLAAPIQAGQQLGEMTVSAGGET--------VLTVPIIAQAGVDALGLPELLISFVRGLAGNV............ 376
87 0.000e+00UniRef50_A0A267MMN7 Uncharacterized protein n=1 Tax=Anaeromicrobium sediminis TaxID=1478221 RepID=A0A267MMN7_9CLOT  ali  30  31.AVSKPTISAPSGILIDFETGDVLYDKNGNTPMYPASTTKVMTALLTLENCK-----LDEVVTID----SKSPFTNGSRIYLNEGEKVTIEQLLYALLVESANDAAVALAIHISGDVKSFAGLMNERAKELGAKNTNFTNPNGLP--------------DPKHITTAYDLALIGKKAM-EIEKFREIVKTTRYQIPPTNKQRYLKNSNRLLWGNKMEYKGVDGMKTGYTVAAQQCLVATAQKDGHRVISVVLKATGKNI-YSDTRTLLDYGFGNFKTIKLTSGNQKIK---SIYINNDKSLNVNLLTKDTLYKTVPKDNSYDIEKKVEIFDE-IKLPIEKGQVLGEIVYTNND--------VEFGKVDLISDRSVEEKKLFSNF....................... 392
88 0.000e+00UniRef50_D5WQB8 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Kyrpidia TaxID=1129704 RepID=D5WQB8_KYRT2  ali  24  31QADGPPDLAVRSAVLMDMKTGQVLYAKNPDEPHYPASITKILTAIVALE-----RGQLNDRITTS----RLATLQDGNRIYLVEGEEHSLEELLYGMMLNSGNDAAVAIAEHYGGSVAGFAAMMNATAKEIGALHTHFTNPNGL--------------HDPNHVTTAYDMCLIGRYAMQN-PIFRQIVATKTYPWHGKEWESELVNINRML----WTYPGATGIKTGYTDQAQQTMVVSATRGNESLIATLMDIPGQEAMREEASKLLDWGFQHFATQRLASAGEA---AETVQLPG--HQTANALLSRSVWYTFAQGTAPQVTRNIELDKPKL--PLQKGAVVGQAVFSVDGRT--------IATVPLVSDRAV................................ 362
89 0.000e+00UniRef50_A0A1M6L0D8 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Anaerobranca TaxID=42447 RepID=A0A1M6L0D8_9FIRM  ali  34  25.TAQEFNL--RSYIVMDAQTGYVMYEKNADIPLPPASITKAMTMYLIFEALEKGQITLDEKVTAGPR-VKTAQTPGAQTLFLEPGHQVSVRELLTTIAVPSANDAAVAMAERIAGSEMQFVAMMNDKARELGLTNTLFQNSHGLDT--------------PNHYMSARDIAILSQRLINDFPQVLEFSSIETY------RTQEQTNH----WGETLFYESIDGLKTGYTEEAGRCITATAIINGRRVIIVLMGAESVSQRDNYIEQFMTKIVTDFRSVNVAQKGNPI---EEIPIPRAKNKLVQVGTLNDVNLMVP-NVNPDVIQQIVIN-EGVRAPLNKGDEVGKVIYYIGEQL--------VYETAIYTLEDVPQANIIVRFFRGIGNLFSKLFNLI........ 394
90 0.000e+00UniRef50_A0A1M3DW46 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium 43-37 TaxID=1895707 RepID=A0A1M3DW46_9PROT  ali  29  25....TIETTAKQAILIDATTGVVLLDKASKELLYPSSMTKIMTAYTTFKRLKEGKLSLSSQFVVSDNAYRKEG----TRMFLEVGQIVTIEELLKGVIIQSGNDASTVLAEGISGNERAFADEMTRLAHEMGAAQTNFINSSGLP--------------DPRHTTTAYDLAVISMRLIKDFPEFYSLFSEKEYAYNG----INQGNKNPLLYKNI----GADGVKTGYTEGGGYGMVASVIQNGRRLILVVNGHTSMNDRASEAEKILRWGFNEFDLVTLTKAGQVV---DVLDVAEGTTHSVHAKVANDVYITIPRDHKKHLKAQVHYLSP-LVAPIKEGDEVGKLVISIPGEP--------EKTFPLYANESVDRAGFVKRISNSIRRLIFG............. 376
91 0.000e+00UniRef50_A0A1Z5HU90 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Calderihabitans maritimus TaxID=1246530 RepID=A0A1Z5HU90_9THEO  ali  28  30......EITGSTGLLVDMETGKVLYEKNARKRVAPASTTKILTALIALE-----KGYLNDLVTVSERATQVEGTI----VWLQPGEKQPLENLLYAMMLNSANDAALAIAEHIGGTVEEFVQMMNEKAKELGATASHFANPHGLPA--------------PDHYTTAYDMALIARAAMEN-PKFREIVGTKTRPWRGQSWESQLL----NLNKLLNYYEGANGIKTGYTSEAGWCLVASAKREDQEFLTLVFNSTSDKV-WKDAEELLDYGFENFRKFQLIEAGDIIAE-----VNVGRGDTVKVVAKNSFHYLLPKDSKLVPQQKIELS--QVLRPVQAGQEVGKIIYFLGEE--------KIGEVPLIAQNRVKKLVWFRVTFVMLVLWVLNLLRR......... 382
92 0.000e+00UniRef50_A0A0U5MUS5 D-alanyl-D-alanine carboxypeptidase n=48 Tax=Brucellaceae TaxID=118882 RepID=A0A0U5MUS5_9RHIZ  ali  28  33...SSIVTKAPQALLIDDRSGTVLLSKGADKPVPPASLAKLMTAEVVFEALEKGRTTVETAYPVSEYAWRTGGAPSGSTMFARIKSTPTVADLLQGMIVQSANDGAIVLAEGLACSEQTFAGAMNQRAKELGLSSSKFVNSTGLPA--------------AGQVVTLEDLLNLARHIHAAHPEYYRYYAQPAYTW----NNITQRNSNPLLRLEV----GADGMGTGFTEASGYALVGSAEQDGRRLFLAMSGLASVKEREEEARKLIQWGMTGFDDMRIFAANDKVGD---AQVFGGQSSTLPLVVKKDVELLLPKEAREKLKARIIYEGP-LQAPIAAGTEVGRLQFELNGSVLQ--------QVPVFAAQSVAQDSLPQRALGSVVEFSTGWLRK......... 394
93 0.000e+00UniRef50_UPI00041EF897 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Shimazuella kribbensis TaxID=139808 RepID=UPI00041EF897  ali  34  26.AASKPTITSKAFYVMDYSSGAILMSGNGNTSLPIASLSKLMTALIVMEKIKQGKLHWSDKVIVSKKA----QAINESEIKLVAGEKISIKELVTGMMVASANDAAYALAEKVSGSEEKFASLMNQKAKELGLGKTQFYTSSGLVYKSSSGKVYT-------NTMSANDMAILTRYILAKHSEIYSFSTILRHTFPGTSRQMKVTNTNSMLPTLSYGYKGVDGLKTGFTTPAKYCYVGTVTRNNFRLISVLLGSSTLDKRYKETKQLYDYIYQNYTPSLILQAGRAISSYKTIRVS-GHNGPVSIVSLRNLTIPLLKGKEKDYSYHIVIY-PNLRAPMKKGTAVGYVQIYYKGKVVLGTP-----RMSLVTATAVTK.............................. 384
94 0.000e+00UniRef50_A0A2S6Q3U8 D-alanyl-D-alanine carboxypeptidase DacC n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2S6Q3U8_9PROT  ali  31  16.SAFAINVKAKAYILKDINTGKILLEKNAYLTLPPASTTKLMTLYILFEEIKNKNIKLSDKITISKTAWRKGG----SKMFLDPGSKIRVVDLIKGIAVSSGNDASTAVAEYIAGSEKEFVKLMNKKANELGMKRTNFVNATGWDNK--------------GHVSTASDLALLGERIIKDFPEFYKVFRLKSFK----HNGIRQYNKNTLLGKL-----GVDGLKTGHVGSIGYNIVSSAKQNQLRYIVVILGAKSKALRESEAKKLYEYAYKKYKNIKLASSSETIAQ---AQVYLGKNKFIDAGLKEDLYMNLTQKEFDTLKAEVEY-KPLINAPVYYGDVIGKLKITHSGQKV-------PLTYDLIAKTPSAKLQMFEKLDAMLDYKFN.............. 369
95 0.000e+00UniRef50_A0A1M6DB59 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1M6DB59_9CLOT :_  ali  26  23...AEPNITSPSAILMDAKTGRILYEKESEVQRFPASTTKIMTAILCIE-----QGNLNDIVTIGTNPPLIE--KGSSQIYLIPGEQLTLEQLLYAMMLESANDAAVAIAEHISGSVEEFAKLMNKRARELGALNTNFVNPNGL--------------HDDTHVTTAKDMALIAKHAMT-LPKFREVVSTLKYTIPATNKQNYITNTNKLLWQTKYSYEYAIGIKTGYTTKAKHNLVAGALKDGMELISVVMNTNSDANMYTNTIALFEYGFNNFTSRKLLTKDQIVT---TITIPDSDEK-LNLLAAEDFYFTMSENETSKIESNITLL-DNISKPISKGQVLGYISYSIDGEEIYKVNLLSAEELLLPEKKSVPVLKWFFRLF...................... 385
96 0.000e+00UniRef50_A0A2E3C1F8 Uncharacterized protein n=1 Tax=Magnetococcales bacterium TaxID=2026759 RepID=A0A2E3C1F8_9PROT  ali  31  20.AANAFELKAEAYAVGDPASGRLLLKHNSETILQPASLTKMMALYMLFSALDRGELTMDSEILVSEKAWRKGG----SKMFIEVGKMVKVEDLIKGIAVSSGNDACIVVAERLGGTEEAFAQMMTAKAHELGMNDTNFLNASGWPM--------------EGHVTSAHDMFRLASALINDFPEYYHFFGVRSFTYSG----ITQPNRNGLLRRNV----GVDGIKTGHTEESGYHLVASGERDGERFVSVILGTDSMKARESEALKGLSWAWGRYKTYDVTTEGERVTDAE---VQYGAKESVAAVAAETGKWLLSFDQKQEMQQEIKLN-ETIEAPLKKGDKIGVVVFTTKD--------LAPKTVDLVAGEDIAEKDFFAKMLEKAKR---SLFN.......... 374
97 0.000e+00UniRef50_A0A2V2ERH7 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2ERH7_9FIRM  ali  31  25.AEESLELESKSVVLLEASSGEVLYEKNTTERRIPASVTKLMTLLLLFEAVDKGEASLSDTVTASAYAASMGG----TQIFLAQGEKMSLKELAIALAVGSANDAAVAISEYLAGSEEAFVRKMNDKAQELGMNDTHFANPNGLPA--------------EEHYTTAADLGVLARTIVNDYPEILEYTSLKNYTLRENTKPFVLDNKNKLL----WWYEGADGLKTGWIGASGYNVAATAARNGMRLIAIALGAEKTYGNFRDSIKLFDYGFNNYRYERLYHKNEPLANC---SIEKGELLSVNAVSPIEIGLVLAQNQTD-FSSEIVFHD--LCAPIETGEEIGEIEVYINGEINQ--------KYPLYAAENVEKYGFFQALTRAFYYLLT.............. 381
98 0.000e+00UniRef50_A0A1Y3PQT5 Uncharacterized protein n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3PQT5_9BACI  ali  28  35.AHAEPEVQAQNAILMDVDSKRVLYQKRAEEERPIASITKIMTAILAIEY-----GKLDDQVVVSPNACRMEG----SSIYLRPGEKVRLETLLYGLILRSGNDAAVAIAEHLAGSEEAFTDLMNAKAWELGMNHTHFANSHGLDQ--------------DGHYSSARDMAILAAYALKN-PVFQEIVKTKRVSWLGEEWQRSWRNKNKML----HLYEGADGVKTGFTRKAGRTLVSSATRNGQQLVVVTLNDPDD---WRDHASLLDYGFAHYPQRVLLEEGQEVPAPPQWR-----QLNRRLEVGKTFKYPLAEDEIQDIQVRVILTNRLQEAP--KGTQVGKVIVTFQGKQLAALPIQISGR......................................... 367
99 0.000e+00UniRef50_A0A259MW90 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Rhodospirillales TaxID=204441 RepID=A0A259MW90_9PROT  ali  29  1..............MVDPQTSTVLLFKDAETPMPPSSMSKMMTIYIIFDELAAGRLKLDTRFRVSEKARNMGG----SRMFLELGSEPTVEDLIKGIIILSGNDACVVVAEGLAGTEEAFAERMNKRAREIGMTKTVFKNASGWPA--------------EGQYTTARDLAVLGWHTIDDYPKYYKYYAETNWTY----NNIRQENRNRLLKIT----PGTDGLKTGHTEEGGYGQTTSAVRDGRRLILVVNGLSSMAERASETARLMEWGYRESTNITVFRAGDML---VEAPVWLGAQETVPLVIPKTVQLTVPTGQGAAPRAVARFDGP-IAAPIVKGTKIGTAVVTLPD--------NRTIEYPLEAGADVPRMGVFSRVATMLRHYMFGWMS.......... 345
100 0.000e+00UniRef50_A0A1C0AAU0 D-alanyl-D-alanine carboxypeptidase n=8 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1C0AAU0_9FIRM  ali  28  26.....PQVSAQAAILIDVETGQILYKKNIHERRAPASTTKIMTGIL---AIENGNLS--DKVTASKRAAYEGG----SSIYLVPDETLTLEEMVYGLLLKSGNDAAVAIAEHIGGSVENFANLMNLKAREVGALHTTFKNPNGLPQ--------------EGHLTTAYDLAQIARYALQN-PLFAKIVSTKRIEWPGHSWDRILTNTNKLLTRSDI----VNGVKTGYTRAAGRCLVSSATKDGQQLVSVVLKSG---AMWNESLALLNYGFNHYRKVEVIAKGEEIHQISI------DEQDVKLKSAKEFNYVLPKGTSTKIK-KVINVKDDITLPIKKGEKLGNIALYDEDDNLLD-------RIDLISDRYVEDSNFWKKLSARIQIYF............... 372
101 0.000e+00UniRef50_R5FRX6 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Coprobacillus TaxID=100883 RepID=R5FRX6_9FIRM  ali  34  41....EFDIYAPSAILMEASTGKIIYQKNSTESKTPASMTKIMTMILVMEAVRSNKLKMDDYLKASENASKMGG----TTIYLDTGEEMTVEDLLKGLAITSANDAAIVFAESIGGSVDEFVKMMNNKAREIGCVNTHFVNPNGLAA--------------EGHHSCSYDMALMGRYLVVNYPEILKYTNIYEDYLRGTEKEFWLVNTNKL----VRFYEEVDGLKTGWTSESGYCLTATMKKNDIRFISVVMGAESTGKRNHDTMTMLNYGVNTYELKKIASEGDIIETIQNIHYKPG---NFNCVVGSDVEYLTKKGEVKDIRKDVKIYDNIVDG------KIGEMTIYINNEVYT--------KVDLIPSENVKEANYFDIFKSIFERVF............... 391
102 0.000e+00UniRef50_A0A1D7XB15 D-alanyl-D-alanine carboxypeptidase DacB n=8 Tax=Moorella TaxID=44260 RepID=A0A1D7XB15_MOOTH  ali  27  28..AAAPDIQAESYVLMDFRTGQVLMAKNPHERRPQASTTKITTAILALE-----RGNLNDQVIASKNAAETP----ESSIYLQEGETLTLEELLYALLLRSANDAAVAIAEHIGGSVENFARMMNAKVQEIGARDTHYVNPHGLTA--------------PDHYSSAYDLALIGRYAMMN-PKFREIVATRQIPWAGKPWPRLLINENRLLWGY-YAYPGADGVKNGYTTPAGQVLVASATRDNWRLIAVVMKSPNM---YRETSAILDYGFNNFHQVKLMPAGQQVAL---AGVRGGIAANIPAVTADDVLVVEPKNETWTWQQRVELNPD-LNAPVKKGDRIGRIIFTSHDQEV---------SVDLIAAGDVAPRPWWMGFLEAFLTVFNLPWLRF........ 385
103 0.000e+00UniRef50_A0A1X6X471 D-alanyl-D-alanine carboxypeptidase n=15 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1X6X471_9MICO  ali  40  29KTKAPLDIQANAAFMIEASTGKVLYNKNGDKQLGIASMTKMVTEYLLMEAIKEGKIKWDDQLPISKSAYNVSQDNTLSNVPLRQDKTYSVRELTEAMSIYSANGATIAIAEKLAGDENKYINMMDKLAEKLELGPHNFVNSTGLSYEDIRGKTTQ--KDKGENELTARGVAKLSRALILDYPEILDFAKVEEKSFQGTSDEIKMENWNWMLPGLINSDKNVDGLKTGTTDHAGMTFAGTAEKNGMRLITVIMNAKDKKIRFVETAKMMNYGFNNYD---LISKG--LGNQFKVNVYKGDKLTETLTTQKEPKFVVPKNAKVETAAKMTLKEDKLVAPVAKGTVVGKAVVAANDPNYGYLDNSEGVTIDVITDHDIEKAGFFLRSWRVTKDGLNVAKNYVVDGAKGWF 447
104 0.000e+00UniRef50_A0A2M7YU21 D-alanyl-D-alanine carboxypeptidase n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YU21_9BACT  ali  32  61..........KSAYVVDADAGWPLVAYHERDRRQPASMLKMMTELLVLERIAEGDLRFEDPVTVSAKASKMGG----SQVYLKQGETFTVRELLMALAIHSANDAAVALAEHLAGSVEAFIDLMNSRAERMGMADSEFHSVHGLPPGWRQEPD----------LTTARDLALLARELIK-HPEALEWASMAHAPFRDG--KFILTNPNKL----VGHYRGLDGLKTGYTGPAGFCVTATAVQKGKRLISVVMGCPTDKARATESTRLLSYGFNAYVQVILVEEGGTALPALK-PVKGGKRTEVPLAYASSLKVSVLRDLKDQVTLRYAL-PEKIEAPQPAGAVVGRAEAVLDGRVLG--------SVPVVTGEEIVKGSWLDRLFH..................... 405
105 0.000e+00UniRef50_A0A1S6IU13 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1S6IU13_9FIRM  ali  29  16.AAEEPQVVGETAALIDAQSGMLLYGKEPHKKMYPASTTKVLTALVALE-----KAKMTDLVTIGAN----PIHAGGTSIWLAEGEKLSLEELLYALMLNSANDAGVAIAEHVAGSVEEFTKLLNQKALQLGAKNTHFVNPHGMPN--------------ENHYSTAYDLALIGREALKNQ-ELRKIVTTVHHEIPDPEAQKYLFNHNKLLWSKTFGYEGATGLKTGYTVEAGQCIIASAKRDGRELIAVVLRTEGNNL-WYDASKLLDYGFNNFQNRQLVQRGKVMAN---VPVKYGKSN-VNLVASEDYIHTFPKESIKDLQI-ITEPATEIEAPVTKGQVLGKVIIKDG--------VKQVAMVNLVAAEDIPK.............................. 355
106 0.000e+00UniRef50_A0A1Z9TWA6 Uncharacterized protein n=3 Tax=Rhodobacterales TaxID=204455 RepID=A0A1Z9TWA6_9RHOB  ali  28  20...QGFSTTAKTAFVIDNTTGEVLLSKDIDRPIPPASMSKLMTLWMVFESLDEGKLAMDDTFKVSRKAWKKGG----SKMFLREGESVKIEDLIKGVIIQSGNDACIVLAEGLAGTEENFAELMTIRAKEIGLTNSNFKNSTGWP--------------DPDHKMSSSDLVTLATKIREEYPSYYSIFNDLEFTWDG----ISQRNRNPLLSMNL----GADGLKTGYTDEAGYGLIASAKQNERRITFVITGLKSVGQRAREAKGITTWAFKKFRLRTYFKKNVTI---LEVPVWRGKKEXVKISAANHVQLLIANDSKNDPKMHVVLKEP-LIAPLEKGQKIGHLVVETT-SLIKENNDKKQLFFPIIVSEDLGRGGVVNKVLRTLKSNFFSLFGS......... 387
107 0.000e+00UniRef50_A0A0A2VY31 D-alanyl-D-alanine carboxypeptidase dacA n=1 Tax=Beauveria bassiana D1-5 TaxID=1245745 RepID=A0A0A2VY31_BEABA  ali  28  42.....PQIDAEAYILIDYNSGKVLAESNADARRDPASLTKMMTSYVIGQAMKAGKFDDNAMVTIGKDAWATGNPKGSSLMFLQPGMQVPVNKLVRGINLQSGNDACVAMADFVAGSQDAFVSLMNGYVSALGLKNTHFQTVHGLDA--------------EGQYSSARDMALIGQALIRDVPNEYAIYKEKEFTF----NNIRQTNRNGLLWDTSL---NVDGIKTGHTDAAGYNLVASATEGQMRLISAVLGGHTYKGRETESKKLLTWGFRFFETVSPLKAGKEFASE---PAWFGDNDRASLGVDKDVYLTIPRGRMKDLKASYVLTTSELHAPLQKNQVVGTINFQLDGKTIEQRPVE............................................. 376
108 0.000e+00UniRef50_A0A1M6BQ91 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Geosporobacter TaxID=390805 RepID=A0A1M6BQ91_9CLOT :  ali  30  28..ARPPDITAPSGILIDAATGDVLYEKNAHEKMYPASTTKIMTAILVLE-----NTNLQDTVIIDKD----TPFTDGSRIYALEDEIFTVEQLLYALLVQSANDAAVALAKHVSGSVEAFAALMNQRARELGAKNTNFVNPNGLPN--------------EAHISSAYDLAMIAKHGMT-IPAFREIVGTVRYEIPPTNKQRYLRSSNRFLWGTGGRYDIVDGIKTGYTIQAQQCLVASAVQGEHRLISVILKAQSTNV-YLDSRTLIDYGFENFQFKKIIGSHEPI---EAVSIKGGIEKKVNLVTADAFYKAIPKGDSEDLTKDIVLRED-LSAPIEKGEILGRMIYKSGDLVLG--------EVDLIAEETVAKK............................. 383
109 0.000e+00UniRef50_R6GXL9 D-alanyl-D-alanine carboxypeptidase n=2 Tax=environmental samples TaxID=2231195 RepID=R6GXL9_9FIRM  ali  28  24..ARALGLSAEHAILMDAGSGRVLYEKNADSRSLIASTTKIMTALVICEQCNVL-----DRVQIMPEAVGIEG----SSMYLQAGEVLTVQELLYGLMLQSGNDAAVALAIYCGGTVEGFAQLMNDEARRIGLTGTHFENPNGLD--------------HENHYSTARDLAKLTAYAMEN-EIFAKTVSTKSIQVGG----RSLTNHNKLL----WRYEGADGVKTGYTKAAGRILVSSATRDGRQLIAVTINAPDD---WNDHARLLDYGFDQFETKRLVQAGQCLG---TVEVLSGEGGSVDLVAGEDFYYPVARGETLEVQF---PGPGFVYAPVTAGQEAGTAHVLLEGVPVGKVPVVWGETIA--APTEPEKPNWLERIW...................... 363
110 0.000e+00UniRef50_A0A1C5VNY8 D-alanyl-D-alanine carboxypeptidase dacC n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VNY8_9CLOT  ali  30  38.........AKSAILMELETGTVLFEKNADEKLEPASVTKIMTMGLVLEQVAAGKLSMDDMVTASENARSMGGTE----INLDKGEQMSVYDLMMSVAVASANDAAVALGEHIGGSEDAFVDMMNRKAEELGMNNTHFENTNGLPA--------------DGHLTTARDVALMTRFLLS-FEQATEFTATNRYPIRSDTNEYMMRNSNAL----VREYEGCIGVKTGYTKTAGHCLSSAATKNGMTLIAVVLGESDSKTRFQESKDLLDYGFAKYE---LYRPEVTFEQTESIPVKKGVVSRVEVVSPSTAPVLIAKGTQPEVEVHTQL-EQSVTAPVEQGSVVGTTTLILDGKEVDRYEYT--------AKTAVEQRTFIESMKIVFYKMMT.............. 389
111 0.000e+00UniRef50_A0A2N2A3G5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2A3G5_9F  ali  25  32...NKVSVSAAAAILVDAKTGQVLFAKNPFQQRPPASTTKVITALL---AIESGRLM--EPVTVSRRAAYTEG----SSMYLSAGEVLTMSDLLYGALLNSGNDACAAIAEHVAGSLENFAVLMNMKALALGAVNTNFTNPHGLP--------------DKDHYTCAYDLALIARSALENQ-TFSEIVKTKDKNLPGQGWDRRLQNTNQLL----WRYFWADGIKTGTTNAAGQCLISSATKGSRQLVAVVLRSGD---RWNDSIKMFEYGFNHYEYYQAAVTGAEFGQY---KVQNGVREVLPVVYGGNLGILVPVRDPGALEKRVRLNPYP-AAPVKKGQIIGEVSYYL--------HKNFVGKVNLTAAVDVREIGFWDILTDWWKQKLSGLFGYI........ 386
112 0.000e+00UniRef50_A0A0F3NNW9 D-alanyl-D-alanine carboxypeptidase family protein n=8 Tax=Anaplasmataceae TaxID=942 RepID=A0A0F3NNW9_9RICK  ali  30  21..AFQLYTKAPNAIVFELNSNSILFARNAEEKIVPSSMSKLMTLYIAFQYLKAGIIKMDDKFVVSKSAWQRGG----SSIFLREGQQVKVRDLINGIVVASGNDACITLAEGISGSQQNFVDEMNNMAQKLGLTKSHFSNVTGWP--------------DENHLMSAKDIVFLSVRIFKDFPEYYHLFSQKDFTY----NNIYQKNNNILLQYNI----GVDGIKTGHTNKGGYGLIASAEQNSRRIFVVVSGLKHETERVSEAKKLISYSFNNFNTKTIFHKNSQIDQ---ATVWYGKDKVVPLTIHDDVTVTYHNNSYDKIKAFISRNN-IIPAPIRKGQKVGELHIQIPE--------LGEKVVPVYAMKNVRSLNYFEKILHMLLY................. 370
113 0.000e+00UniRef50_E6LDK2 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Enterococcus italicus DSM 15952 TaxID=888064 RepID=E6LDK2_9ENTE  ali  34  43................DSDTGKIFYEQDATTPLHIASTTKLLSMYIIYDQIRTGKLSMTDQVTISAETSALSQNWQLSNVLLYEGQSYSVKNLIEAGFLESANAAVMALAEKVAGSEATFVDLMRAQLTTWGITDGTIVTSTGLNNAFLGDNRYPGSGAEEENQLSAKDLAIVARHLLQDFPEVLQITSQSQLTFEPTGENLELENTNQMLAGMAVATDGVDGLKTGTTDLAGACFVGTVKRGDTRLITVVLDVTDATARFTESARMMEWVYSQWQQQTINGETLTIPKRQTISVKDGEQLKVAVGLDNEVTVWVKKGDATNITVTPTFTKTSVTAPVKRGKQVGTAVIRLTEDTLGYLDQTQQPKTTIVVQKSVSKANPFELGWRKVKNFFS.............. 423
114 0.000e+00UniRef50_B2A1Z0 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Natranaerobius TaxID=375928 RepID=B2A1Z0_NATTJ  ali  30  27.SAEEFDFDAESVILIEAETGRTIYENNAEKSWPPASLTKVMTLVIGLEALNEGELELEETTRVSAKANQTGG----SQMFLRENQEVTIEDLLTGIAVVSANDGCVALAEHMEGSVNNFVNRMNEKAEEIGLENTNFKDPHGL--------------ASDGQYMNARDVARLSQYAVNETPKILELESITGFQFNIES---TQYNRNLMLPDHPYSYEGTDGLKTGQIEEAGYNFVGTAQRDDMRLIAVVLGAEEQTERFNITRQLFDHGFSEYQKIKLFDEGDEL---EQVDVKDGSERQTMAISETEANVTTKFDNDQELEFVFQPKDEELRAPIQKGEYLGELLVIEDGK--------EIASIPGIAQDEVEELGFFGRIARTISDAISNTFESIKDSI.... 400
115 0.000e+00UniRef50_UPI0009311FF3 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Hyphomicrobium TaxID=81 RepID=UPI0009311FF3  ali  27  25QQSGGFSTTARNAILMDFDSGSIIYQKAADQLVSPASMSKLMTLAVLFKALKDGKLKPEDEFQTSEHAWRTGGAPSGTAMFIPIHNKTPVSELIQGIAVQSGNDAAITVAEGMAGSVDAFAKIMEAEARSIGLEKSTFRNPTGLP--------------HPEHLMTARELAMLARHIIKNYPDQYKVFSQREFQYRRH----KFYNRNPLLSADI----GVDGMKTGHTREAGYGMVVSAIADGRRLIGVVMGFENEKERQNETRRMLQWGAKSVATAKLFDAGEAVGY---ARIWGGQDLYVPLTGDGDLEVILPKPVNQKIRGEIVYEGP-IKPPVKKGDQIAMFRVTS--TAPGSNEPIAVSETPLYAENDVDEATFYWQGVDSLLHL................ 389
116 0.000e+00UniRef50_A0A1H3BRS9 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Tissierellia TaxID=1737404 RepID=A0A1H3BRS9_9FIRM :_  ali  29  21..ADELNLSGEAAILIDSDTGQILYEKNPHKKLHPASTTKIMTGILAIEL-----GNMEDIVTVDEEVVRL---TDGSHIALEPDEQLKFEDLLNALLIESANDSALAIAKHISGSIENFVNLMNTKAKELGALNTNFVNPNGLTN--------------ENHLTTAYDLSLIAQYAMKN-PQFREIVSNYTYTIPKTNKKRYLKSNNRLLYSTIKKYEGVNGIKTGYTLAAQNCLVASASRNNQNLIAVVLKSNGREV-FADVHKLFNYGFDNFMKAGIATKNYFIDN---IEVENGTIPIVAGIINENLTVTIPKDSMDKIEQRIILD-ENIAAPVKKGQVLGKVEYYLDGKLLGN--------VDIVSTLDVDKISIKDILLNNWYFFVIGILVFIRISI.... 401
117 0.000e+00UniRef50_A0A2V2GA36 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2GA36_9FIRM  ali  31  30.AAPAESLSAEAAYLTDFNSGTVIYAKNETERLPIASMCKIMTLLLTFESIDSGSLSLDDTVTVSAEAAGMGG----SQIFLDANKPYEVRELVKGIVVASANDASYALAEQISGSEELFVAEMNAKCKELGMNDTHFSNCTGLP--------------KAQQYSCAKDVSKMFSELLT-HKDYFTFSRIWMDEIHDGGRVTEISNTNKLI----RFYEGCDGGKTGYTSEAGHCLAASAQRKGMRLVSVVIKAPDGKTRFNDVSTMFNYGFANYENKLILDCEKPLEIP--VTVTGGKQDSVLGVPAESYYLFSARNEKIALNIDFTPDEK-VKAPVEKGQRIGSLTVEKDG--------ILVKEIPVLAYETVEKQTYFDIVKNIIDNW................ 388
118 0.000e+00UniRef50_A0A2S6RGS5 D-alanyl-D-alanine carboxypeptidase DacC n=1 Tax=Alphaproteobacteria bacterium MarineAlpha9_Bin1 TaxID=2013096 RepID=A0A2S6RGS5_9  ali  30  28KAERIINTSAKQALLIDFNTDRILLNNNADMSMAPASMSKLMTVYLAFEALAQRRVKLNTNFVVSEKAWRRSLPPSGSSMFLEPNTRVEFEDLLRGIIVQSGNDACIVIAEGLSGSESSFVKEMNKKSEALGLTNSKFMNSTGWPEN--------------NHYMSSLDLATLTKRLYIDFPQYMYFFSEKKFEYNG----ISQPNRNSLLFAGI----GADGLKTGYTKNSGYGVVASAFQDGRRLILVLNGLKSKKNRAMESENIMNWGFMEFENIELFSQHDVV---ERAPVWLGDIPYVDLIVREKVLLTIAKGKGKDLKAVIKYSSP-IIAPINIDKIVGKLII-------RNSRGKKIKEYNLYPLEEVKKAGPIGRLFSSLSYLIWG............. 395
119 0.000e+00UniRef50_A0A2A5H6W5 Uncharacterized protein n=3 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5H6W5_9FLAO  ali  30  22.AVSGYDTVARAAYMVDLTTGTVLLEKNADVPLPPASMSKLMTLNMLFEALQDGRVSLDTRFGVSSRAKNMGG----STMFLNETDRPTVEELLQGIIVLSGNDACVVVAEGLAGSEDAFARLMNDRAKALGMANSTFANASGWPN--------------PNQRMSMRDLGILASRLITEFPEYYGYFGQKEFGFDGRAPDNRF-NRNPLLNLGI----GADGLKTGHTSEAGYGLVGSATQGTRRIVFVISGMTSEKQRAEESERMVNWAFRQFVQKTVARKGTEVA---RAKIWMGDRDEIGLVTAEDVSLLLPALERDVLSGEVVYRTP-LEAPITKGQEVAELIITLKELPDARIDDHLI........................................... 357
120 0.000e+00UniRef50_UPI00047CA466 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Caldanaerobius polysaccharolyticus TaxID=44256 RepID=UPI00047CA466  ali  28  28.....PNIKAKSGIIMDYETGQVLYDKNGDVRVYPASTTKVLTAIIALES-----GKLDDVVTAGKDAVGVEG----SSIYLSEGEQLTLKQLVHAMLIGSANDAAVAVAQYIGGSVEGFADMMNKKAQEIGAKNSHFVTPNGL--------------HDPNHYTTAYDMALIARYAMKN-PLFREIVDTAVYTIPPTNKKRVLLNTNMLIRPTAYYYKWADGIKTGYTSQANRCLLTTGLLNGRRVIVSIYG-DDPAAVWKDAIGMLNYGLNNFVNRTLVHKGDYV---EKVPVNRGKA-YVNLVASSGFTYTLPLDKANYVKEDVKYTGD-VKAPVRKGEKLGYISYELSGKSIG--------KVDLIADRTVKKSPMLSRFGKWVGAFILGLW........... 394
121 0.000e+00UniRef50_A0A1V4SR41 D-alanyl-D-alanine carboxypeptidase DacB n=10 Tax=Clostridiales TaxID=186802 RepID=A0A1V4SR41_CLOHU  ali  31  52.....PKISAGAAIVLDTESGRILYEKNAYTRHSIASTTKIMTAIVALE-----NGNDDDEVVISKRAAAIGG----STVNLKAGKTYKFKDLMYAMMLRSGNDAAIAIAEHIGGSVELFAEMMNRKAAEIGATNTNFVTPHGLD--------------DPQHYSTPYDLALITQYALKN-EKFKKIVGTKNSVFEGNN----ISNTNEML----GLYPGADGVKTGYTGQAGRCLVTSVTKNNWRIISVVLGCSTRTVRAQNSKTLLDYAYGNYKNYELLKKGMPI---QEINIHKGRINKIALYPDADITLPLKQEEADKVRA-VYNVPDAIEAPVQMDSKIGTVDFILDGKIL--------ATTDLKSSGTIERKDFYFYFDAIFKTW................ 393
122 0.000e+00UniRef50_A0A1Y2QQ12 D-alanyl-D-alanine carboxypeptidase n=9 Tax=cellular organisms TaxID=131567 RepID=A0A1Y2QQ12_9SPHN  ali  28  23......DTAAPIAFMKDLQTGRILFAKDADKRMPPASMAKMMSVYVAFKLIKAGEANLDQMVMVREDTWKKWNNQ-GSTMFLDVNSQVSVENLLHGIVTLSGNDACVVLAEGLGGTEANYVALMNREAQRLGLKGSHFANTNGWP--------------DPGEYVTARDLAMIAEATIRDFPDLYARFYQKEFTWGGSGQAITQGNRNPLL----GKVPGADGLKTGHTEEAGYGFTGSAVQNGRRIVMVVAGLKSFGERVSASVDFMNWGFAAWQNIPLGRRGQVMG---KVAIDGAADAQIDAVAGKDLFVTLPRGFAMERKTSVQPL-AGLKAPLKAGQQVGWLVVTMPGQ--------QPARAPLVTPVAIEEAGMFRRTINWLMGLFG.............. 382
123 0.000e+00UniRef50_A6X0N8 Serine-type D-Ala-D-Ala carboxypeptidase n=79 Tax=Alphaproteobacteria TaxID=28211 RepID=A6X0N8_OCHA4  ali  29  35...AAFVTKAPQVLLVDDRSGTVLLSKNANVPIPPASLVKLMTAEVVFEALEQGATTLGTPYTVSENAWRTGGAPSGSTMFARIKSTPTVADLLQGMIVQSANDGAIVLAEGLAGSEQAFADRMNDRAKELGLIGSKFVNSTGLPA--------------EGQVVSLQDLVRLARHIRTAHPEYYKYYAQPAFTW----NNIMQRNRNPLLRLDV----GADGMGTGFTEASGFALVGSAEQNGRRLYLAMSGLASIKEREEEAKRLLQWGMTAFDDVQLYPADEIVG---EAQVFGGALTHVPLKVKDRVELLLPKDGRNKLKARIVYKGP-LDAPVADNQQVGVLRLELNGSILRD--------VPVFTAQSVEEGSLSKRALGAAMELSTGWLRK......... 396
124 0.000e+00UniRef50_A0A174B1Z3 D-alanyl-D-alanine carboxypeptidase dacB n=26 Tax=Negativicutes TaxID=909932 RepID=A0A174B1Z3_9FIRM  ali  28  51.SPDDPNLTARSAVVIDAASGQVIYERNKDERRFPASTTKIMTLILALE-----HSNMDDMVTVSSNAAGTEG----STLWLEAGEKIRMGDLLYGMMMHSGNDATVAVAEHIAGSVDKFAVMMTEKAHEIGAVNTNFANANGLPR--------------DDHYTTAYDLAKITAYGYR-VPGFEKIVSTKEIDFDWKDSSHHLRNENQML----WLYRGANGVKTGYTDAAGRCLVSGAKKDGLQLVAVVL---DSVYMWNDSIKLLDYGFAHVEPDTIVHEGDVAGY---ASVAGGTGRKLPLMAAETLTLAKLKGEGEAYKTRIEADG--LRAPIKEGDTVGRLVVELDGK--------EVASTDLLAGADVTRRSFFLTVWNFLRSLVKG............. 402
125 0.000e+00UniRef50_A8SP57 Serine-type D-Ala-D-Ala carboxypeptidase n=13 Tax=Clostridiales TaxID=186802 RepID=A8SP57_9FIRM  ali  29  56.ANFDVDIKSPSAILMEAESGQVIYEKNCDTAMAPASVTKVMTLLLTFEAIDDGKFSLDDTVVVSDHAASMGG----SQCFFESGEEQTVQDMIKCIIIASGNDAAVAMAEKIAGSEPAFVNMMNERAKELGMENASFKNACGLDTS--------------GHEMSARDIALMSRELITKHSEIFDYSGIWMDHITHGDSRFDLVNTNKFLNM----YTGATGLKTGYTSTAKYCMSATAERDGIDLIAVIMGGETKEMRNNDACHLLDYGYSKCHKYT----DKEIIKEKKLSVDKGTSDYVTIKTIPQFEAILLGSENADSVSKKIDIPEKITAPVKKGDELGEVSYYAGKRFIG--------KVMIYADDSVDEINISYAVRKVFRRLV............... 416
126 0.000e+00UniRef50_UPI000CFB2F00 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Vallitalea sp. S15 TaxID=2078660 RepID=UPI000CFB2F00  ali  29  33.ADNAVTIGSKSALLMEAETGKVLYEHNADEQLRPASVTKVMTLLLAYEALAAGKVSEDDVVTISEHAASFGG----STIFLDTNEQITLGLLLKGVAVASGNDAAVAVGEYIGGSEEGFVAMMNAKAKELGMVNTNFVNPCGLDA--------------DGHLTTSRDIALMSRELITKYPQVLELSSIYHDTLKDGTQETDLANRNRLIK----FYDGCNGLKTGWTSKAMYSISATAERNGLSIIAVIMGAEDKKTRTKDVVTLFDYGFGHYQMVIEEDANKLVGQ---IDIKQGVKDKVDCYIKEDFKTLLDKSAGSPEITKEYMMEEKIAAPVEKGQKIGEVKYYLGEKEIGTG--------DIIIQEDIEKATFKGMIEHLIDMWL............... 394
127 0.000e+00UniRef50_A0A1C6GDE3 D-alanyl-D-alanine carboxypeptidase dacC n=64 Tax=Bacteria TaxID=2 RepID=A0A1C6GDE3_9CLOT  ali  29  55......EISAPSAILMEASTGTVIYEKDADTQRPPASVTKIMTLLLIFDALEEGKIGLEDEVTTSEHAASMGG----SQVFLEAGETQTVETMIKCIAVASANDACVAMAEYVWGSEEEFVNHMNERAAGLGMEHTHFVNCCGLDT--------------EGHLTTARDIALMSQEMVTKYPQIENYSMIWTHTTNKGSSEFGLANTNKL----VRQYEYTTGLKTGSTGEAKFCVSATARKNDIDLIAVIMAAPDSKMRFQDARTLLDYGFGKCMKYI----DDGSGRLDPVPVASGEEKEVPVKQAEPFQYIVEGADLSKIEKKIITQGD-VAAPVKEGDKVGEVVYSINGT--------KIGSVAIVATVGVKKMSYKKAVENALEVLF............... 410
128 0.000e+00UniRef50_Q3AAB4 D-alanyl-D-alanine carboxypeptidase n=5 Tax=Carboxydothermus TaxID=129957 RepID=Q3AAB4_CARHZ  ali  30  22..AEEPQIIGRAAAVINVNSGKFVYLKNADQKMYPASTTKIMTTLIALE-----KGNLSDRVYIDKEACYVEG----SAIWLNPGEQLSLEDLLYSIMLNSANDSAIAVAKYIGGDVATFVQEMNDKARELGAKNTHFVNPNGLPN--------------DDHYTTARDLALIARAAMQN-PKFREIAATKTKVIRDPKYLRFLQNHNKLL----WRYEGANGIKTGYTVKARQCLVASAARDGEEFIAVVLGSEGRNV-YDDATKLLDYAFNNFKTVKLVSKGQEFG---KVEVAGGKEP-VKLIAAEDLYDTVNRRQEPQFDYQKKI--EKLQAPVKAGQRVGKIVVKENENV--------VGEVKLVAFNSVEP-TLIYSSRKLIVLFLAGLFLTF........ 378
129 0.000e+00UniRef50_A0A2D6YE06 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Bacteria TaxID=2 RepID=A0A2D6YE06_9GAMM  ali  29  29...QTPTISAPNFVLMDADTGLILAERCAHCKVPPASITKLIPLYILSEALHKGNVKNEDLVTVSQKAAKAPG----SRMFVNPSSKVSIENLMNGMIVSSGNDATFAISEYLGGNEQSFVQMMNELAEKFQMKDTHFANSTGLP--------------DKEQFSSAYDLAHLTRRLIQDFPEFYPKYSQKYFSF----NKIKQHNRNALL----WADDRIDGVKTGFTNDAGYCLVSSAKQNDLRLIAVILGSKTEKSRKIDSLNLLNYGFRFFKVKEVESK-----ALSTAHVWYGRKP-VEIGLKDNINVITPRFNDEEIKIKLE-VKSSLKAPIHKGDTLGKMTFMYRNQIINQKE--------LVALNEVKEKFILFRFFDNLQIGWHNLLHK......... 382
130 0.000e+00UniRef50_A0A173S795 D-alanyl-D-alanine carboxypeptidase dacC n=10 Tax=Clostridiales TaxID=186802 RepID=A0A173S795_ANAHA  ali  30  33.AAPVLDLSAKSAVVMEQESKEILFAKDKDKELAPASVTKIMSLLLIFEDLKQGKIKLTDTVTVSEHAASMGG----SQVFLETGEKQQVQTLIKCVVISSANDAVVALAEHVCGSEEAFVSRMNKKARELGMKHTTFQNACGLDAK--------------GHVTSAYDIALMTRELAQRYPEVFKYTKIWMDTIKKGEKEFGLSNTNKLI----RHYNGCTGMKTGSTGKAGFCLSATATRNKIHMIAVVMGCESSKARIKDARTLLDYGFSNCQR---IHSETTRKEIGRIPVQKGQRSEVS--CQEKVTADLIDIKTQKGKIVKKIKIDSVKAPVKKGQKIGEIQYSKGN--------IMIHKEKILAQETINKADFLTQIKKISTQYF............... 392
131 0.000e+00UniRef50_A0A1M4XB84 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Desulfotomaculum putei DSM 12395 TaxID=1121429 RepID  ali  26  24..AGEPEIVGETAALMDARTGQLLYGKEEHKRMFPASTTKVLTALVALE-----RARLDDVVTIGAN----PITAGGTSMWFVEGERLTMEELLYALMLNSANDAGVAIAEHIAGSVENFAELCNKRAKEIGARDTHFTNPHGMP--------------DENHYSTAYDLALIGREAMKN-KDFRKIVSTVHHEVPRTDPEKYLFNHNKLLWSKIYGYKGATGIKTGYTVQAGQCIIASAEREGRELIAVVLRSEGSNL-WSDAARLLDYGFANFTNRQLVYHGKVMDN---LPVKYGKSN-VDLVADQDFFYTFPRQGANEVQISTETVKE-ITAPVTKGQVLGAVVIGSGNKELG--------RVNLVAAADVQR.............................. 362
132 0.000e+00UniRef50_A0A1M6F7B4 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Clostridia TaxID=186801 RepID=A0A1M6F7B4_9CLOT  ali  27  27......DIEAKAYVLMDVSTGRVLYAHNSSQKLPMASTTKIMTVLL---AIESGR--LDEVVKISRNASIQEG----SSVYLRVGEKIKLEDLLYAIMLRSGNDASVAVAEHLCGSVDKFAELMNEKARAIGAYNTNFTNPHGLP--------------DDNHYTTAYDLGLITCYALRN-KKFAEIVSTKKKTIPGENWNRVLINKNKML----WQFTGGDGVKTGFTKKAGRCLVASATRNDWQLVSVVLNCGDM---WNASSELLEYGFNNYKKVQIVNKDEPYK---EISIIKGKKEKTEIYPKDNLYAPLKID-KEKVENVIIKDTDKVKAPITENSKAGELEIYIGD--------FFIGKTDLIYKENIESTSILHHIKKILKWF................ 373
133 0.000e+00UniRef50_A0A140L906 D-alanyl-D-alanine carboxypeptidase DacB n=6 Tax=Clostridiaceae TaxID=31979 RepID=A0A140L906_9CLOT  ali  30  28...PPPEISAPSGILIDAETGDVLYEKNAHERMYPASTTKIMTAILTLE-----NAKLQDTVVIDKDTPFTEGN----RIYAIEGEIFTVEQLLYALMVESANDAAVALAKHISGSVEEFAKLMNQRAKELGAKNTHFVNPNGLP--------------DPEHVTTAYDLAMIAKYAMT-LPKFPEIAKTVRYQIPPTNKQRYLKSSNRFLWGVGGRYDIVEGIKTGYTVQAQQCLVTSAQKDGHRLISVILKAQGTNI-YADSRTLIDYGFENFQFVKLADAGVNVK---TVAIKGGQEKVLNLITQKALYKAVPIHEKISPVDQMIKVEKDLRAPIHQGDVIGKIIYTSGEKILG--------EVNLIAETSVK............................... 380
134 0.000e+00UniRef50_R6W066 Uncharacterized protein n=1 Tax=Ruminococcus sp. CAG:382 TaxID=1262957 RepID=R6W066_9FIRM  ali  35  51......TLPCKAALLMEADSGRVLFAQNETAKLPIASVTKIMSTLLVMEAIDSGKIRLTDIVTVGEEAAHMGG----SQVYLEVGEQMPVSDMLKALVVVSANDATVAMAEHLAGSQSSFVSQMNARAAELGMSETHFANCHGLN--------------EEGHYSCARDVAIMTRELLK-HPLVLEYTQIWMDTIRNGA--FGLANTNKLI----RFYNGANGMKTGFTDTAKYCLSGTAKRDGMQLIAVIIGADTSEIRFASAKKLLDFGFANY-AVKIPER----IELEPVTVNGGKAPQLAVTYDPPAILTEKGGKAPTQRAEL---PESVDAPVKKGDTVGRVVFYIGET--------EVAQVPVCAAEDAERNSF........................... 383
135 0.000e+00UniRef50_A0A1Y3Q016 Uncharacterized protein n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3Q016_9BACI  ali  29  45...EPPDLTSAAAILIDANTGQVLYEKQADQRFYPASITKILTAIVAIE-----NGNLDEPVSVSEAATRV----DGTRVYLVPGELKSLRELLYAMMLNSGNDAAVAIAEHIGGSVEAFARMMNQKAKELGATHSHFVNPSGL--------------HDENHYTTARDMAKIAQYAMRS-PIFREIVATKTMPWNGKEWESQLVNHNKLL----WQYEGATGIKNGYTSIAKQTFVATAKKGESELIAVCLSAPSQPQMYRDLKLLMDYGFEAFEPIPVVSEKERFFERDR-------SREIALRTSREIHVQRPVAKEEPITRQVILEP--LRYPIHKGQQVGLLKIQWGNQP--------AIQVPLYAAEAVP............................... 376
136 0.000e+00UniRef50_E7G8W2 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Erysipelotrichaceae TaxID=128827 RepID=E7G8W2_9FIRM  ali  34  23..AEDLKLNAASSVLMEASTKQVLYSSHETDKLFPASTTKIMTMILMFEAINKGTLKWDDVLTCSAYAASMGG----SQIYLEEGEQMSVSDLFKGISIASANDACVMVGERIAGTNDGFVKMMNEKAKELNLTNTHFMNPTGL--------------HDDNHYTCALDLGLMASYLIQGGDRLFATTSLYDSYIRENSQKFWLVNTNKLLK----SYEGADGLKTGYTKEAGYCIVSTAKRNGLRLIAVVMKESEPKVRNQEVSQLLDYGFSLYENVILFKKDDII---EKIPIENARQKSVEVVCKEDVVYVKDKSAQDEVTYEMNYTN--LVPPIKKGETIGHILLMRSD--------VNIASFEVVSKDDIEALTLPEKMYNYFKAFV............... 381
137 0.000e+00UniRef50_R5L1H1 Serine-type D-Ala-D-Ala carboxypeptidase n=5 Tax=Firmicutes TaxID=1239 RepID=R5L1H1_9CLOT  ali  33  30.SNAPFEDLSKSSILMCADTGDILYEKNAYEHLSPASVTKVMSMLLILEAIESGKISLDDEVVTSKNAVAMGG----SQIWLEEGEKMTVDELLKAVAVASANDACTALAEHIAGSTTSFVTMMNERAKELGLENTNFENCTGLDDTAV------------NHYSCAYDIAVMAREVMQ-HDLIKNYTTIWLDYLRDG--ETELNNTNKL----VNSYSGITGLKTGTTSKAGFCVCATAERDGMNLISVVLGAQTSEGRFNSASNMLDYGFANYQ---VVAPQVDASQITAVKIKNGIEKSIVPVYDETNKLLVKKGSEVSYEYKI---EPSVAAPIAEGDVLGEITIKSGSETIK--------TIKLYAGKSVGKISFSYIFKEIM................... 380
138 0.000e+00UniRef50_A0A2E2Q805 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Micavibrio sp. TaxID=2024841 RepID=A0A2E2Q805_9PROT  ali  28  32.......LSAKQIYVKDLQSGQLLYLKDAQRRMPTSSMSKVMTAYMVFDALKKGEVSLNDEFPVSEKAWRKGG----SKMFVEVGKKVAVEDLLKGVIVQSGNDATIVLAEGLAGAETVFARKMTAKAHEIGMENSNFMNASGWP--------------DPNHYSTAEDLGILAEHIITDFPEYYGFYSIQSFEYNG----IKQRNRNPLLFRDDLR---VDGIKTGHTEIGGYGLMASGVNAERRVVVVMNGMKSEQARAQETGRVMAWALNNFENKLLVEKDKSVKN---VRVVYGRQDTVAATVNEDLIVTLPYLDKDMVKIEVVTKEP-MQAPVKKGDQIGELRV--------ITPELEPMSYPLYAAQDVKKSNIVSRFFESLSYKLFG............. 384
139 0.000e+00UniRef50_A0A2E4QEY8 Uncharacterized protein n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E4QEY8_9GAMM  ali  29  44.....PAIISESAIVIDADTGAVLFDKNSQKKMPPASLTKMMTMYIASEAYTSNVFNFDTDIAVSPYAANM----DGSKMFISNNQTIKGHDAVQGIIVSSGNDVAVAMAEFISGTSDNFTKLMNSKSEQLGMFDTHFSNPTGLHTDDM--------------LSTAYDLALLSRSLIQDFPDLYDWYKQKSFTY----NDIKQSNRNRLLYMT----PDADGIKTGFTSQAGYCLASSTLRDGRRLIIVTLNAPNEKARYDDHLKLINYAYREFDNIELFGEDEVLEQT---RVWFGQETMLAVSPKQPIVATIPKSATQQVRVDLVVNPK-LTAPIEKNQPVGTMTVSLDQIPLTSSQ--------IVAKDNVELGGWLTRQKEQAKYWAHQL............ 395
140 0.000e+00UniRef50_F8LGH2 Putative D-alanyl-D-alanine carboxypeptidase penicillin-binding protein n=71 Tax=Bacteria TaxID=2 RepID=F8LGH2_STREH  ali  35  25EQTDNFNVSAKHAIAIEATTGKVLYEKDATTPDGVASMTKILTAYMVYKAVDQGKITWDTEVDISDYPFNLTVDSEVSNVPLDS-RKYTVKQLLDATLISSANSAAIALAEKISGSESAFVDTMTAQLKEWGITDAKLFNASGLNNKYLGDNRYPGSKPDDENTMSALDVAIIADHLIKDYPQVLEITKQTETDFEGDN---KLTTHNYMLEGQDNYREGVDGLKTGTTELAGASFVAHANENGMSLITVVMNADDEAARFTATNELLDYVTQNWKIKTLNTKGQIVKKND-IKVADGDSQTISAKLESDLTVVQKINSKNDA---VKIKAKTITAPIKKGDTIGTATF-DDKDLVGTGYISDPPQISVTANQSIKKSFFLKVWWNHIVNFFTG............. 413
141 0.000e+00UniRef50_A0A1V1PSA8 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1V1PSA8_9PROT  ali  30  41.............VIMDAASGALLACENCETPVPPASMSKLMTVLLVLEALQAGDITLDTRYRVSEYAWREHGAPGGSHMFLPINSEVSVRDLLRGAVIVSANDACVVLAEGLAGSEEAFVARMNRRAQELGLRSARFRNATGLD--------------DPEHVVSTADLARIARHLILTYPDFYRTYSERSFTY----GNRTQENRNPLL----GAFEGADGVKTGHTDESGYGLVGSAVLNGQRRIIAFNGTNTMAQRRSEAIRLMRAAFHDYSVVQIAAAGEQVG---EAEVWLGSRGRTPLVTQQAIVVGGTRAIQAGLSAHIVYNGP-VHPPIQEGDVVARLVVEGPG--------YTTQEFPLVAGRKVGRANWFSRAWEGLRLTLFG............. 388
142 0.000e+00UniRef50_F3ZXX2 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Clostridia TaxID=186801 RepID=F3ZXX2_MAHA5  ali  33  42.SEDPLKLQSKSAVLMDAATGQLLYEKNAHEKLPIASITKIMTMDLIMEALDSGRIKPTDVVRVSKDAASLGG----SQIWLEEGEEMTVDEMMKAIAVNSANDAAAAMAEYIAGTQENFVKMMNEKAKSLGMNDTNFANVHGLD--------------DDNHYSSAYDVALMSRELAK-HDGIFKYTSIWMDTLRDGETN--LANTNKLIRTY-----GADGLKTGSTDKAKYCISATAKKDDMRLIAVILGGPTSQVRFDEAAKLLDYGFNTFTINRIVKKGEIIRN---IRVTRGKSDQVNGIAADDLSVLTKKTDTASIEKRIEL-PETIEAPVVESQKIGKLTALKGEQ--------EVGSVDIIADKPVERASVTDILKDLLAQWF............... 394
143 0.000e+00UniRef50_A0A1G9QD93 D-Ala-D-Ala carboxypeptidase DacF. Serine peptidase. MEROPS family S11 n=1 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A  ali  33  39....EPDVTAPAALLLEPETGSVLYEKNAGKEHPPASLTKMMTVLLGIEALEAGEIKLKDRVTASSYASSMGG----SQIFIEEGDILSVEELLKAIMVASANDASVVLAEAKAGDCSVFIEKMNERAEELGLDNTHFKTVNGLP--------------HENQYTTAEDMARLARELVK-YPKVMDWSQIWTKTLELADREAMIVNTNRMIN----SYSGLDGLKTGYTRDAGFNLVATASRDNMRLISVVLGAENESNRSESTAALLDYGFENYRLEKVLAAEEVLKD---LSLKNSAPENVKGTPGSNLYALVEKGDTTEIDYELELD-KNVEFPVEAGESIGTIYSLVEGEP--------VYEAELEAENRIEKAGILMRILRWFRNLF............... 391
144 0.000e+00UniRef50_A0A2T5C9R2 Uncharacterized protein n=4 Tax=Desulfonatronum TaxID=66848 RepID=A0A2T5C9R2_9DELT  ali  29  70............YLLMDADSGQLLVAHDIDASREPASLTKMMTVYVAGQKLLEGTIFMTDEVRVSQRAWRMTG----SRMFLDLNSTVSVAALLHGIIVQSGNDASVALAEHIAGNEAEFVHMMNRTAWDLGMTRTNFANPTGLPAPGVQ--------------TTARDMATLSLALLRDHPYLYSLHSIRHFEY----NNINQTNRNRLL----HRDPTVDGIKTGYTRAAGYCQTTSAVRDEMRLIAVVLGAGSVAARTRLNQELLDYGFSNYETHRLHFRGEPLGA---IKVWKARQNELAYGLNSDIVVTIPRGRLPDLDQRVSLLTEPVIGPLLRGQKVGALEISLDGQIL--------AREDVFTMNEAAPAGFFSQVVDSV................... 409
145 0.000e+00UniRef50_M4VFQ0 D-alanyl-D-alanine carboxypeptidase n=10 Tax=Alphaproteobacteria TaxID=28211 RepID=M4VFQ0_9PROT  ali  30  53......QTTAKQAIIIDYDTGMVLMEKDADAQMPTASMSKTMTLHMVFKALKEGKIALDTMLPVSEKAWKMQG----SKMWVELGKSVSVEDLIRGVAIQSGNDATIVLAEGLAGTEEAFATMMNEEAKRIGMMNSNFTNASGWP--------------DPNHYSTARDLAILAVDTIRNYPEYYPYYAELEFTYH----NIRQANRNPILTQNL----GADGIKTGHTEEAGYGLMASAVRDGRRIVLVINGLDSMAARAQESARLVAWAQSTFENVSLFKAGDVV---EEAEVVMGQSATVPLVVEEGIKITLKKAMRNDLKVSVLYKGP-LQAPVKKGDVVGSLKVEAPG--------LHPFEVPLVAGADVAELGLFAKTIEKAKVMIG.............. 401
146 0.000e+00UniRef50_A0A1L8I758 Uncharacterized protein n=1 Tax=Bacillaceae bacterium G1 TaxID=1836462 RepID=A0A1L8I758_9BACI  ali  28  21ETMQPSSLSSAGALLMDLDTGQILYEKQADQPFYPASITKILTAIVAIE-----NGDLDDVVTVSENAVR----ADGTRVYLVPGEQKTLRELLYAMMVNSGNDAAVAIAEHIAGSVEAFAQLMNQKAADLGATHSHFVNPSGL--------------HDDNHYTTAYDMAIIAQYAMRN-PVFREIVQTKTMPWNGDEWQSQLVNHNRLL----WQYEGATGIKNGYTSKAKQTFVATAKKGETELLAVCLQAPSQAAMYNDLITLLNYGFEAYEAVPAVSKNDRFYPPDR-------SVEVAMRTSRDIRILRPIEEPPAVVTKVVMDD--VQYPIHKGQQVGQLHISLGNKP--------IVQAPLYAAEAV................................ 355
147 0.000e+00UniRef50_R6TYZ1 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Clostridiales TaxID=186802 RepID=R6TYZ1_9CLOT  ali  31  70...PGFDPDCKSCVLMEASTGRILYAKNGEEALPPASVTKIMTLLLVMEAIDAGKLHWDDMITAGAHACSMGG----SQIYLKENEQMTAEDMIKSVVIASANDAAVALAEHVMGSEEAFVKAMNRRAEELGMQNTHFENTNGLDDTAQ------------NHRISAKDIAIMSRALIS-HKRILTYSSTWMDTVRDGA--FGLTNTNRL----VRFYKGCNGLKTGSTSKAGFCVSATADRDGMTLICVIMGAETRDKRNATAASLLDWGFATYGLYS-----DPGGTTDPVRIRGGVTDSLTGSYP-AYTCVLEKAETERVQ-KVISLEEGLAAPIKKGEKIGTVSYMLGEQTL--------ATTDILADEFVEKIGYWGLFLRMLADFL............... 420
148 0.000e+00UniRef50_A0A0B0HFT1 D-alanyl-D-alanine carboxypeptidase DacF n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A0B0HFT1_9BACI  ali  44  28....ELATEARSAILIERDTGAILYEKNAHEPLPPASMTKIMTMLLIMEAIDQGKLKLDERVRASEYAASMGG----SQIFLEPGEEMTVDDLLKGVAIGSGNDASVALAERIAGSEEAFVHMMNEKARQLGLKHTAFENTTGLPAK--------------NHYSTAYDMAVMAKELLK-YDLITKYTGTYEDYLRNTNKKFWLVNTNRLVK----FYPGVDGLKTGYTSEAKYCLTATAKKGNMRVIAVVFGAPTPKARNAQITKMLDYAFSHYETKPLYKKDE.......................................................................................................................... 286
149 0.000e+00UniRef50_Q0C175 D-alanyl-D-alanine carboxypeptidase n=33 Tax=Alphaproteobacteria TaxID=28211 RepID=Q0C175_HYPNA  ali  30  17.SAQMIDTPAEYAVIMDHATGKILYSKRGDEPMTPASMTKMMTAFVVFELIDRGELSLTDKFTVSEDAWRRGGFPSGSTMGLVPKDTPTVEELLHGVITMSGNDACIVLAQGISGSEEAFSRRMTEMAHELGLSSVNFVNTTGL--------------EGDGHVVSAEDLARLAKMTIDKYPQYYEWYSLPSYTWR----EYTQANRNPLL-----EVAGADGLKTGHLESSGYGLTASAVRDGVRRTIVVNGLPTMAARAQESERLMRVAFQSFDLKTIGPETLVLPD---VEVWLGEARAVPVSLAEPIEVAGHKAAFSKANVEIVLDGP-VKAPLKKGDQVGRLVITMEG--------SEPTEAPIIAEADVKKLGFVGMALEGVRTFISS............. 375
150 0.000e+00UniRef50_G9Q293 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=G9Q293_9BACI  ali  42  35ETTPKLAEQASSAIVIEQDTGKVLFDKNPNEKLPPASMTKIMTMLLIMEQVEKGKLKLTDKVRASEHAASMGG----SQIFLEPGEEMTVNEMLKGIAIASGNDASVAVAEHIAGSEEGFVNMMNKKAKDLGLKNTHFQNPTGLPAKD--------------HYSTANDMAIMARELMK-YPLIRKYTGKYEDYLRDTDKKFWLVNTNKL----VRFYPGVDGVKTGFTTEAKYCLTASAEKNGMRVISVVMGAPTSKERNNQVTKLLDYAFGQYMTKKLYTRGEKIKTVQ.................................................................................................................... 303
151 0.000e+00UniRef50_A0A1T4JUQ3 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=Garciella TaxID=218204 RepID=A0A1T4JUQ3_9FIRM  ali  27  29.....LNISCESAIVIEQNTGRILYSKNIDRKRAMASTTKIMTAIVAIE-----NGHLDDIITISQNAAEIEG----SSIYLEANEHLTLEELLYGLMLRSGNDAAYAIAEYIGGNVEKFINMMNRKAEEIGANNTHFMNPHGL--------------HDKQHYTTAHDLAKITAYAMKN-ETFKKIISTKNKTWENHEWNRSLTNKNKML----WNYQGGNGVKTGYTTDAGKCFVSSAFRNNIQLIAVVLKSNDI---WKDATALLDYGFDHYKPYKVISKEDYLK---SISVIEGTKDRIRTYSKKDVIIPIRKEEKDKIQVKIVL-PEEIQAPVMREQIVGKLEVYVNNE--------KIDSTDIYVKDSIQKKSVQNMFEKFINHWVG.............. 376
152 0.000e+00UniRef50_F6ASF3 Serine-type D-Ala-D-Ala carboxypeptidase n=4 Tax=Bacteria TaxID=2 RepID=F6ASF3_DELSC  ali  31  31QISRSIPLDAKSYVLIDAYTHQVIAENNANDPVHPASLTKLMTAYLAFDAVKHRRISLDQRLPVSKRAWD-ERLGNGTLMFLAMGMSPTMDELLSGLIVQSGNDAAVVLAEAIGGSVEGFVQMMNYKAKEWDLKNTNFANSTGLTN--------------ENHKMSAMDAAKIMSQILKDHPKFHSYFSLKEYTFNG----IRQLNRNALLD----IDHGFDGGKTGYTDAAGYCLATTSHREDRRLISIVMGATSKDSRKLETLKLVNWGFSAFRWEVLFEKDRVVK---SVRVWQGDILNVELVVDRDVSIAVPKEDRKNLVIDFEVDEP-LTAPLEKGQQAGWVKIMTRDGVF-------ISRHPLLVSREIIKGSYPKRLFHAF--IIHS--KNLVNQFLGLF 406
153 0.000e+00UniRef50_A0A1M6EY11 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=[Clostridium] caenicola TaxID=659425 RepID=A0A1M6EY1  ali  26  71.....PTINARSACVIDFDTGTILYEKNAFVKRPMASTTKIITAILAIENCP-----MDAWVPISGRAAGIGG----SVMGLKAGTNVRMEDLLYGLMLCSGNDAAVAIAEYCAGSVQAFADMMNEKARQIGAYETHFSNPHGLDAKD--------------HYTTAYDLAKITRYALQN-PVFNRIVRTREYYYDG----RTLTNTNEMLEL----YEGADGVKTGYTGLAGRCLVTSATRDNIRLISVVLFCDSRSLRAQSSMRILDYAFENYGYVQLLRKGNIMG---EVPVIRARKETITAGVANDVKAILKHGEKDMLSTRISLLQD-VEAPVRKGTILGTVSVYKGDEIIGESS--------LIAMESAERMQFVDYLNQVVDHWVHML............ 417
154 0.000e+00UniRef50_Q38YZ6 D-alanyl-D-alanine carboxypeptidase n=34 Tax=Lactobacillus TaxID=1578 RepID=Q38YZ6_LACSS  ali  38  26.ATSAPQVDASAAIAIDPQSGQVLYEKNADQVLPIASMTKMITAYVVLDQIKQGKLKWNQTTKPDAAIYKLSQDKELTNVPLQADKAYSVRELYQAMLIASANDAAMMLANLVAGSQKNFVDLMRQQVSQWGIKDAKLYSVSGLNNQYLTGETYPGSAADAENEMSASEVAIVAQHLLKTFPEVLETTKQTAFTFPKTIDETKMATWNLMLPGQNNAPKDVDGLKTGTTDKAGDCFTGTATKDGQRILTVVMHANGSDKRFIETNKVMQYVFDNWQQTQLVKKGATIKPFATADVKYGRTKTVALETPQAIAMWVPKGTQVDWDYQVVQQKRQLTAPVKKAAVIGKVTPKIAGVTNRYLGTTPQYTVQ--TKTADPKANVFVLIGTGVREFFTNLF........... 428
155 0.000e+00UniRef50_A0A2E0EY59 Uncharacterized protein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A2E0EY59_9GAMM  ali  26  44..PKAPNIDVTSYVLLDANTGTXIASLDETTMIKPASITKLMTAYATFQAINEEQVRLDDPVRISQRASSIGG----STMFLNPYMDVTIDDLLKGMIIVSGNDASVALAEHLAGSEETFXEYMNMYAEALGLNNTNYTNASGLD--------------DDDHYSSALDMAMLASQIIKEFPEYFNLYSERSYSFPQTKEPIVQYNRNRLL----RRDASIDGMKTGYTSSAGYCLVATAEKNSMRLIAVVTGAKSSEDRNNSAYALLNYGXRFFEKQLLVENGKTYG---KAEVWKGVDDEIDLVASKDVVKTITKGISXDIERRIDIFEP-IIAPVDRNKVIGKLTVTYEGKVL--------AESSLYAKTNIEQDGLWGWLYDSALLLF............... 404
156 0.000e+00UniRef50_D5XF27 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Thermincola TaxID=278993 RepID=D5XF27_THEPJ  ali  29  25....QPAVSADAAVLMDANTGQVLYAKNAHKRRPPASTTKILTGILALDM-----GNPAETVVVSPRAAAVG----ESSIYLSAGEKLTLDELIQGALMKSGNDACAAIAEHIGGSIEMFSQLMNLKAKMLGAWNSNFINPHGLPAK--------------NHYSTAYDLALIARYAMQNR-RFAEIVAQKEKEWYGQSWNRHLKNTNKLL----WRYIWADGIKTGTTKAAGQCLVSSASKDCRKLIAVVLKSGD---RYGDSIQLFEYGFNNYYYQQVAVAGEYFGY---ADVKNGLYPKVQLAFKSDLGVLVPKDRPGSLEKRLVLERKP-QAPVKAGQTLGWMEVNID--------RQRVGRVELVALNEVPENSLKNRVLSWIQKIIG.............. 372
157 0.000e+00UniRef50_A0A1M3MIQ0 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhizobiales bacterium 63-22 TaxID=1895812 RepID=A0A1M3MIQ0_9RHIZ  ali  26  41.SATVMTTKAPKALLIDDRSGTVLLSKDADKPVPPASLAKLMTAEVVFEALDKGDITLQTPYTVSEYAWRTGGAPSGSTMFARIKSTATVADLLQGMIVQAANDGAIILAEGLAGSEQAFAQRMNERAHQLGLTGSVFVNATGLPA--------------PGQAVTLDDLVTLARHIHSAYPQYYKFYSQPAFTW----NNIMQRNRNPLLRLGI----GADGMGTGYTQASGYALVGSAEQNGRRLFLAMSGLASIKDREEEARKLIQWGMTAFDDTRLYAANDVVG---EAQVFGGAEGAVPLKVKDDVEVLLPKEGRDKLKARIVYTGP-VRAPVARDTQIGTLRLQLNGTTLR--------EVPVFAAKAVDKGSMSQRAWGAAMELSTGWLRR......... 404
158 0.000e+00UniRef50_A0A2N2DRZ8 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DRZ8_9FIRM  ali  29  25..PQTLSLIAKSAILIDAKTGEILYEMNSHQQLYPASTTKMLTGILAMENLE-----MDELVPIDAE----TPFTEGSRIYLLEGEQITVRDTLYGLLLESANDAAVALAKMISGSVSDFSVLMNAKAQELGALNSNFVNPNGL--------------HDDEHLSTAYDMAMIARYAMEN-PIFRDYVSTYQYTVAATNETRYLYNTNRLLYDNINKYEGVTGIKTGYTSKAGGCLVAGAKRGETELIAVVLGS-TDMGRFSDSIALLDYGFANFKTVNIMKAGSPLG---SVQVKRGAVRQVEVATAEESYATLPIEASEHILRTEVLLEEYLQAPVKQGQKAGTVQIYAGEELLGEFKA--------VALEEVEEGGLLSVF....................... 383
159 0.000e+00UniRef50_A0A101E8M4 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E8M4_9FIRM  ali  30  39EDARSLDIYAEGAVLMDAESGRVLWAKNPHKRLYPASTTKILTAVLAIE-----KGKLDSTVVVSREAAETEG----SAIWLKEGERLTLEDLLYAVLLSSANDAAEAVAEHIGGTQENFVRMMNEKAKAIGARDSHFENPHGL--------------HEESHYTTAYDLALIARYAMTNS-TFEKIVATKIIPWEGHDWSRLLINKNNLIR-NPKLFPGADGIKNGYTKAAGNCLVASATRNGMRLIAVVLNAPNATG---EVIKLLDYGFKNFSKEKLVNKGEILGSF---KVEG--YGRVNLVASKTMGAALREGEKNRIKA-VVYAPKKIDHSVRKGDIMGKIKFTVDGETIAV--------VDLVAAETV-KNPWLSGLLKVFLDVFSFW............ 392
160 0.000e+00UniRef50_A0A1Y0IU39 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Tumebacillus avium TaxID=1903704 RepID=A0A1Y0IU39_9BACL  ali  29  32..AEEVSVSAHSAAVIDVQTGRVLYEKNGDEKMLIASLTKIITAIV---AIESG-VDLNSTVTVSSRASGKEG----SSIYLKVGEKQKLIDLLYAVMLRSGNDAATAVAEHVGKTEAGFVELMNKKVEELGLKQTHFANPHGLDA--------------EGHYSSAHDMAVLTAYALRN-PVFAEIVKTKSIPMPGEAWDRKMYNKNKMLN----RYDGADGVKTGYTKAAGRCLASSATKDGRQ-IAVTLDASSD---WNDHANLLNYGFEKYKFMPVVKEHDVL---QTVPVEDGMKKEVDVVIGHEFNFPLRESEQEKLTRKIELD-DSLDAPIAAGQKVGEMKIYFDERLVGA--------VPILAGHDVMEETFWQKMKGLFTSMIS.............. 382
161 0.000e+00UniRef50_A0A2E6NZ66 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Rhodobiaceae bacterium TaxID=2026785 RepID=A0A2E6NZ66_9RHIZ  ali  32  36.........AKAAFLVDHATGQTLYGKNEDLRIYPASMSKLMTLYILFETLDEGIISLDEKFIVSMNAYQREG----STIYAELSTMISVENLIKGIVVSSGNDACVVVAEALAGSEENFAMQMNLIAKDMGLLNTNFTNSTGLHNK--------------NHFSSPRDLVQLATRLLDDFPQFYKYFSETSFTW----NNIIQYNRNNLLRMDL----GVDGLKTGHTIQSGYGIIVSSKRDNGRIIAFVSGLDSNDERTSEILKLLNYSYRGFKSYQILKKDQLI---EKVKVWKGKKENVSLIVDEDINLLLDIPARRGIRLEYLYKEP-IIAPINKGDKLGEVHIIYPN--------SETIEVPLVAGEDVKKKNAFINMIDAIRHFI............... 380
162 0.000e+00UniRef50_A0A1V5BGZ1 D-alanyl-D-alanine carboxypeptidase DacB n=3 Tax=Pelotomaculum TaxID=191373 RepID=A0A1V5BGZ1_9FIRM  ali  26  29.....PEIVGGSAAVIDSKNGQVLFEKNMRQRMYPASTTKILTAIIALE-----KGRPADMVTISGEACNIEG----SAIGLDEGEKISLEDLLYALMLNSGNDSAVAIASYIGGSVDGFVDLMNKKAAELGAVNTHFNNPNGLP--------------DPNHYSTAYDMAVIARYAMQN-PEFRKIVATETKDIEDPNAQTYLLNHNKLL----WQYEGANGIKTGYTELAGQCLVASAARQGRELIAVVLGSEGTNI-WSDAKVLLDYGFVEFNSVSVTEAGKRITD---VPVRFGVSDSTPVLTSCSLTYDFPRNKQYEIRQEVRL-KEKIIAPVEAGEKLGEVAFFANDR--------EIGRVDLVSKQAVQRK-MPARLW---LYLFVAL---ALFTVRAIF 384
163 0.000e+00UniRef50_A0A143X296 D-alanyl-D-alanine carboxypeptidase DacF n=6 Tax=Firmicutes TaxID=1239 RepID=A0A143X296_9FIRM  ali  31  23..AEELASQAKAAILIEAKTRDVLFTKSEHERMYPASTTKIMTMILIFEALNEGSLQLDEMIHTSAYAASMGG----SQVYLEENEVLPLSDMLKAIAVSSANDCCVAVAEHIAGSSEAFVDMMNKKASELGLKDTHFVNCTGL--------------HDENHYTSAYDLAMMAAYLVEGQDQLFDLTSLYDAYIRDTDQKFWLVNTNKALNPS----QGIDGLKTGFTKEAGYCLVLTGQRDGLRMIAVVLNEEDPKVRNAEATALLESGLAQYTTTTLYRAGDVVTEMD---VKHGRVSSAPVISAEDIQVPYPKTETYEPDYAIEIDRD--EAPLYTGEVVGYLKLMNEE--------ATVARYPLIVNQDVERISYWSFFKELFGNLL............... 379
164 0.000e+00UniRef50_A0A0J1DQ13 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium 1109 TaxID=1655638 RepID=A0A0J1DQ13_9FIRM  ali  35  11..AHALELKAQAAVLMDASSGSILYEENSEVPLPVASLTKMMTLTLVLEAVERGELALSDIITASEYAASKRG----SRIWLEAGEQMTLEELLYAIAVGSANDAAVAVAEYVAGSELDFVARMNQRAQELGLANSHFLNSTGLPPENG-----------PEHTMTARDAATLARHVLS-VPGMMDYVSTYEYTMRKSTTRIVLWNSNKLL----RRYSGVDGIKTGFTTAAGYCMAATAVRDGLRLIAVVLGSPSEAAREEDVRALLDYGFRRYHSYLAAAKGQAFG---SIYVWNGSPHQVEAALGEDFTVTVERGREGEIRLEADLAQ-TLRAPLEPGTEVGTLYALLDNETLAA--------APLVAPSTVGRAGFWSLTNRTIREL................ 368
165 0.000e+00UniRef50_D5BQA0 D-alanyl-D-alanine carboxypeptidase n=7 Tax=Proteobacteria TaxID=1224 RepID=D5BQA0_PUNMI  ali  30  29...TEITTPAEFAYITDFDTGKVLFQKNADMQMKPASMAKIMTIFIAFERIREGGLSLNDKFQVSEKAWRKGG----SRSFLEVGSFVTVSDLLNGVIVQSGNDAAIVIAEGISGTEESFAEEMNFWAQKLGMENTVFRNSTGWP--------------DPELTTTAKDLALISRFPIDEYPDLYPMFKKKRFEYNG----IDQPNRNPLVYGTV----GADGLKTGHTKESGYGVVGSAIREGQRVVMVLNGMTSMKQRSAESRRLMDLAFREFKQYRFFEANETV---DVANVWLGKMPSVDLVLANPLHRVLSRDERRHLKMSVNWVDP-VSAPITKGQKLGVLTI---------EGKSSSETIDLLAANDVEELGVFDRIGAAFKYLIFG............. 385
166 0.000e+00UniRef50_A0A1Q6Q4Q8 Uncharacterized protein n=1 Tax=Faecalibacterium sp. CAG:82-related_59_9 TaxID=1897006 RepID=A0A1Q6Q4Q8_9FIRM  ali  32  28EAGTPLSLTSPSAILCEASTGRVIFEKNADERRSVASVNKVMTILLTLEAIDDGRVTVNDRVTVSPRAASMGG----SQAFLDAGSTYKLGELLKSVIIASANDSAVALAEYLCGAEEAFVRRMNERAQELGLENTHYVNCTGLPAQ--------------GHYTTARDVAKLSTHL-DEHPLYYQYSTIWMDEILHRGGRVTLTNTNRLI----RFYPDCDGYKTGSTNEAKYCISATAKKDGMRLIAVVLGTPAGQTRFDEARAMLEYGFAGYQMFSAVGEGEAL--NMSVPVRLGGRDSVSVVSGGDCGLLIKKGGQGDISLEAALV-ESVHAPVCEGDVLGEIRVKQGERIVAI--------VPAVAGETVQLPGIIDALIRI.................... 381
167 0.000e+00UniRef50_Q0FAY0 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Rhodobacterales TaxID=204455 RepID=Q0FAY0_9RHOB  ali  29  21...NAFDTIARSAMVIDQTTGTILMAKDADRRVPPASMSKLMTLFMLFEALRDERIAMDTEFLVSERATKIGG----STMFLREGERVSVRDLIQGIIVQSGNDACITVAENIAGTETAFADQMTKRAIELGMNNSSFGNSTGWP--------------DPLQRMSARDLVTIANIIITEFPNYYPFFAQTSFTWDG----VKQNNRNPLLPLGI----GADGLKTGHTNEAGYGLVGSARQGQRRIIFMITGLESKAARANEAEKLTNWAFRQFVIKDLFKKDEVIS---KADVWLGENKTIDLIAEDNISGLFPLGSLKNVDIEINYKGP-IAAPIKKGDRIAILTVS--------TPKIGKSEHHLVASKDVASGSILNKILASAELL................ 370
168 0.000e+00UniRef50_R7IBA2 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Clostridiales TaxID=186802 RepID=R7IBA2_9FIRM  ali  28  29ESGTPMTLTTPSAILAETATGTVIFEKNADERREVASITKLMTALLVLEALDRDEIALTDSVQISPRAAAMKG----SQALLDASAVYPLEDLLRTTIMASANDSAVALSEYIAGSEENFVDRMNRRAAELGMTNTNYVNCTGYPQS--------------GQYTTARDVCRLCCE-IAKHPRYNQYASVWIDKLHPGGRVTDLTNTNRL----VRFYEGCDGYKTGSTDAAKYCLAATAEKNGMRLVAIVLGTPVSQTRFNEARQMLDYGFATYRRVVIANKGDLLGQ--NVEVRGGSAESVPLALGSGLSMLLKNGQQSGLSLSVQL-PESVDAPIAQGDVIGLVDVLLDGQVIAKLNC--------VAAEDVPRPGFIEGLLRILRNW................ 386
169 0.000e+00UniRef50_A0A1Z8WVU0 Uncharacterized protein n=1 Tax=Methylococcaceae bacterium TMED69 TaxID=1986766 RepID=A0A1Z8WVU0_9GAMM  ali  32  53..PPEPILSVGSFILIDANTGAVLAEKNSSMRIEPASLVKIMTTYVAAHALKAGHVNLTDNAIVSEKAWRMEG----SRMFIEVGSEVSVESLLNGIIIQSGNDASVALAEHIYGTETSFVSQMNVFADKLGLTETSFGNVTGLPGKDT--------------YTTAKDVVNLSQKLIYDFPEIYKRFSIETYTY----NNIVQRNRNILLRKSRF----VDGIKTGYTESADYCLVSSGDNGSIRLIAAVIGAKTNKARFRDTKALLDYGFRFFESKRLF---ENFTTIKKVKVWEGEDDEIEIGSSKDIFALRPAGYSEPVDFDIVMNKK-LRAPIKKGQKIGNIVIYIGNKMV----------YDLIALEDVAEGGFFKRMIDSVLILF............... 404
170 0.000e+00UniRef50_A0A2S6QSC8 D-alanyl-D-alanine carboxypeptidase DacC n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6QSC8_9PROT  ali  29  29.AQNTINTSAKYALLMDYETGRILLNKNSDIKMSPASMSKLMTIYLAFEALNQERMNLDTELVVSENAWRKSLPPSGSSMFLEPLTKVTVEDLLKGIIVQSGNDACIVIAEALNGSEEAFASKMNEKATELGLVNTNFTNSTGWPDKL--------------HLMSSYDLAILASRLYEDFPEYMHYFSQLKFTYNG----IAQSNRNPVL----YQDIGADGLKTGYTKSSGHGVVASAMQNGRRLILVLNGIEGRKLRAIEAERIINWGFREFENIVLYERNEIV---DSANIWLGNRPTVPLIVKDKVTLTLSKADRKDLKAIVKYVGPLIP-PLNSDFAVAKLIIKNN-------KGDRVSEYNLFPEFEVNRAGPIGRLFGSLSYLIWG............. 395
171 0.000e+00UniRef50_R1CFK9 D-alanyl-D-alanine carboxypeptidase n=13 Tax=Firmicutes TaxID=1239 RepID=R1CFK9_9CLOT  ali  30  22..ADSPSIEGQSGILIEADSGRILYSHNINRKLPMASTTKIMTALIALE-----NGNLDDIVKVDKKSVGVEG----SSIYLYEGEEISLKDLLYGLMLRSGNDSAVAIAKHIGGTVENFVDMMNKKAKEIGAYNTNFTNPHGL--------------SDRNHYTTAYDLALITREAMKNQ-HFKNIVKTK-LWIADRKRNRYFCNKNK----TVFQYSGGDGVKIGYTTAAGRCLVASATRNNMQLIAVVLNDYNW---FNDCYGLFDYGFENYISYIVFDKGQL---AKTVYVDNGQKEYLPLITADKFLIPLKESEKGKIKTVIK-APDKVEAPIIKGKSLGTVEVYLKGKLIHKE--------NLLAKENIKEKNTLDKIYDFIQNLFK.............. 368
172 0.000e+00UniRef50_E8T7R1 Serine-type D-Ala-D-Ala carboxypeptidase n=108 Tax=cellular organisms TaxID=131567 RepID=E8T7R1_MESCW  ali  26  73..AQLFETKAAQAFMIDAETGTVLFSKEADKPIPPASMAKLMTMEVVFNAIKSGRLKLDDTFVVSENAWRKGGAPSGSTMFAKLKSSIRLEDLIQGVTVQAANDGCIVIAEGMSGSEDNFAVQMTERARQIGLKTSTFVNSTGLPA--------------DGQQTTVRELAQLALHLWRDYPDFYRYFAQKDFTW----NKISQRNRNPLLAMDI----GADGLAVGASEAAGFGIVGSLSHNGTRVIAAMSGLASDKERAEEARKLLDWGVRSFEKTEIFARDEVVG---EAQVFGGAKSGVTLKAKGPIDIFLPITNRDKLTARIVYDGP-VAAPVEEGQPVGALRVWIGDTL--------SQETPLFAAESIGVGTLPQRALDAVKELAVGWLR.......... 434
173 0.000e+00UniRef50_Q67L74 D-alanyl-D-alanine carboxypeptidase n=5 Tax=Firmicutes TaxID=1239 RepID=Q67L74_SYMTH  ali  29  1.............MLLDFATGQVLYEKNPDEPIAPASLTKLMTLHLAFKRIEAGQMSYDDPVVVSRNAWA-ANFPDSSLMFLEPGDKVTVGEVMKGLAIVSGNDAAVALAEHIGGTVENFVKMMNDEAQALGFKTFRFVDPHGLS---------------PQNQVTAGEFARFARLYIQLHPESLEMHSQKEYSYPQYENPITQMNRNGLL----WTYEGVDGLKTGFVDEAGFNLAVTAQRGGMRLVGVLLGADSSAKREAEGAALLSWGFNNFVTVKP-----QMPEVKPVRVWKGAANEVTLQAAGGTTLVLEKGLESSLTASVR-QEESVTAPVAKGQKLGEVIFAADGQ--------EVARLDLVAAEDVPQGGFFKRIWDSLKLWIHGFFNR......... 374
174 0.000e+00UniRef50_A0A173XZ82 D-alanyl-D-alanine carboxypeptidase dacC n=61 Tax=Clostridiales TaxID=186802 RepID=A0A173XZ82_9FIRM  ali  32  48......QISAPSAILMEASTGQIIYEKNPDEKLPPASVTKVMTLLLIFDALDSGQIKLGDEVTTSEYAASMGG----SQVFLEPGETQTVDTLIKCISVASANDACVTMAEYICGNEEEFVTKMNKRAKDLGMKNTHFVNCNGLDA--------------DGHLTTARDIALMSKELITTYPQIFDYCNIWMENIQKGESEFGLTNTNKLI----RQYEYATGLKTGSTSKAKFCVSATGRKDDIDLIAVIMAADDSKARVRDAITLLNYGFGKCQKYT--EKKQ--KKISPVEVMGGREKQVKVRQQGAFTYIDTTGADLTKIENKTRKDKNVKAPLKKGEKVGETMYYLNGK--------RIGSIDIITTEEIEKQNY........................... 391
175 0.000e+00UniRef50_A0A2K9EAH6 D-alanyl-D-alanine carboxypeptidase DacB n=2 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9EAH6_9FIRM  ali  31  68..AEPPKISAGAAVVLDTVSGRILYEKNAHSRRAMASTTKIMTAIVAIE-----NGNLDDRVTVSRRAASIGG----SVINLKTGEELTLRELLYGMLVKSGNDAAIAVAEHVGGTVENFVEMMNKKAKELGLKDTAFKNPHGLDAT--------------GHYSTAYELAKLTQYALKN-PVFSEMAGTQSIHIT----NRDLYTTNEMLS----VYPGADGVKTGYTGKAGRCLVTSATKDGWRIISVVLNCPSRSARAQSSKDILDYAFSNYKIYNLAQAGE---EERSINVHRGKKNKVPAVIMKDIKIPLTLAEKEKLKKTI-YYKRTVNAPVYKDIEVGEIRFTIDGKLIAKTGLKTGDEVP....................................... 397
176 0.000e+00UniRef50_A0A1C7GM90 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C7GM90_9FIRM  ali  30  26...EGVEVSAPAAVLMEAGTGRVLFEKNAHEVRPCASITKVMTLCLTFDALESGQLSLSDQLSASAHAASMGG----SDIWLKEGELMSVDDLIKATVIMSANDAAVVLAENVAGSEEAFVARMNERAGELGMEETVFKNCNGLD--------------EEGHVTSAYDVALMSRELIR-HEKITDYTLTWIDYVRDGA--TQLVNTNKLI----RSYKGITGLKTGTTSQAGSCITATAERNGLRLIAVVLGAGSTDDRFKDAAALLDYGFGGWS-VTVPES----PQLPDVPVKGGMEETVGAVAGESPEILMESAAMGEIEESVSINPD-IKAPVKKGDVIGRITYSAGGET--------VAQVDITAAGDVEKISFFTYLLHSFLGL................ 377
177 0.000e+00UniRef50_F6DSR8 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Desulfotomaculum ruminis (strain ATCC 23193 / DSM 2154 / NCIB 8452 / DL) TaxID=69628  ali  28  27...QELSLSAASAVVMDADTGQVLYAKNCHQPKPIASTTKIMTALVAIEC-----ASLKSIATISPHAAGTEG----SSIYLKAGEKLVLEELLFGALLHSGNDACVAIAEHVAGREEVFVNFMNYKAYRLGAKNTHFCNTNGLPN--------------DQHFSSAFDLALITCNALKN-PVFNRMVATKTHSITGPEGKRFLSNTNKML----WSYQGANGVKTGTTDAAGKCLVSSATRDGRRLIAVVLHSED---RWGESIRLLNYGFERFQNRTVAVQGEAFS---TIGIKEGEKRTVPVSVAQNIVVALPVDKEEKVE-RIIMMEPELRAPVRPGQAVGKLQVLVEGEM--------VGQADLITMEGTPKLPAYQMMWHKIWNKI............... 372
178 0.000e+00UniRef50_A0A212LS13 D-alanyl-D-alanine carboxypeptidase DacB n=3 Tax=Sporomusaceae TaxID=1843490 RepID=A0A212LS13_9FIRM  ali  29  29.....PELTAKSAIVIEASTGKVLYSKNAAEQRYPASTTKIMTLITALEY-----GKLDDVVTASDQAAGTEG----SSLWLTAGERLTLLDMLYGVMLVSGNDATVAVAEHISGSVENFAKQMTAKAHAIGAVNSNFTNSSGLP--------------DEQHYSTAHDLAKITAYGYKNQ-LFAQIVSTQHKPWPGKDHDRDLYNENKML----WLYDGANGVKTGYTDAAGRCLVSAANRNGIQIIAVVL---DSEHMWDDSIKLLDYGFSKLTQLPVVRKDDILK---TVKITEGKVGKVKLMATDDIILPVADNEFDKFT-TVIDAPEKVAAPVAAGQKLGTVTVMYDN--------VAVASTELVADRTVERKSFFKLIWGSVVGFVTFVIRNFA....... 382
179 0.000e+00UniRef50_Q75Y43 D-alanyl-D-alanine carboxypeptidase n=486 Tax=Bacteria TaxID=2 RepID=Q75Y43_STREE  ali  36  22..AQDFTIAAKHAIAVEANTGKILYEKDATQPVEIASITKLITVYLVYEALENGSITLSTPVDISDYPYQLTTNSEASNIPMEA-RNYTVEELLEATLVSSANSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNNETLGDNIYPGSKKDEENKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAG----MTITSTNYMLEGMPAYRGGFDGLKTGTTDKAGESFVGTTVEKGMRVITVVLNADNPYARFTATSSLMDYISSTFTLRKIVQQGDAYQDS-KAPVQDGKEDTVTAVAPEDIYLIERVGNQSSQSVQFTPDSKAIPAPLEAGTVVGHLTYEDKDLIGQGYITTERPSFEMVADKKIEKAFFLKVWWNQFVRFVN.............. 410
180 0.000e+00UniRef50_UPI0007836AC1 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Aureimonas sp. AU12 TaxID=1638161 RepID=UPI0007836AC1  ali  30  21......ETAARNAILVDFDTDTVLFEKNADDEIPPASLSKLMTLAIIFDQLKSGAIRADETFPVSEYAWRTGGASGGSTMFLPLNSQVSVDDLIKGIAIQSGNDATIVAAEGIAGSVPAFAELMNAKARELGLTHSHFANPHGLP--------------DPGQRVSVRDLATLATYLIRTYPEHYPLFSEEEFTFNG----IKQRSRNPLLAF------GADGLKTGHTAEAGYGLVASAKDEGRRIVFAMTGMKTVGERATEARAMLTTGLRGFENVVVLKDGAVAG---EVAVTGGTGSSVPVKAAREVRFLEPRGSGAPYKSEVVPVG-TLEAPVAEGRRVAVLRVTRDGKTMR--------EEPLYAAAAMEEAGLFQRIQETVMSHFR.............. 373
181 0.000e+00UniRef50_UPI000B7EF475 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Dehalobacterium formicoaceticum TaxID=51515 RepID=UPI000B7EF475  ali  30  23.AYASPEVTAKSAILIDASSGRILFEKNAHERLPQASTTKITTALLALE-----NADLSKQVQVPADFV----NPGESNIYLGPGEVHPMEDLLYALLLKSANDAAEVIAIDIGGSVEQFAEMMNKRVKEMGLKDTHYVNPHGLN--------------DERHYTSAYDLAMIAREALKN-EKFREIVNTNKYEWEGNEYNRVAYNTNRLLK----TYEGADGVKTGFTRQAGSCLVGSATRNGMQLIAVTLNCNGM---YQEMTALFDYGFQNYQKKEIFEENQTAGQ---IPVKGGTSKTVHAVAKAPLGVAFNIKDKDLLEPSI-YLPEKIKAPVKEGQRLGSAVVKIDENTF--------VTTELVAANDVGKSSFFAYLWDTF................... 368
182 0.000e+00UniRef50_UPI0004E0B2E6 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Desulfotomaculum alkaliphilum TaxID=105483 RepID=UPI0004E0B2E6  ali  30  26....APEITADAAVLIDANTGQVLFDKNMHQRRPPASTTKIMTALLALEG-----GNLTDKVTVSDKAAQTGEC----SINLRPNEILTLEALIYGALMRSGNDACVAIAEHVAGSEENFIRLMNHHAKILGAQNTNFLNTNGLP--------------EDQHYSTAYDLAQIARYAMNKV-KFRDIVSTKSKEINEDGEKRFFQNTNKLL----WLYRGSDGIKTGTTDAAGSCLVGSAKKDGRHLISVVLHSDD---RYADTIKLLNHGFDDYEEVVVLTKGE---HFTTLHIENGYSSTVPIIAGSGLSVLVPKGEIGTFE-QLVKLERNLSAPIRYHQRVGTLDVSVKGEV--------VGSVELITGAAINKLPVHLKIYNKL................... 367
183 0.000e+00UniRef50_A0A1M4WIK9 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Caldanaerobius fijiensis DSM 17918 TaxID=1121256 Rep  ali  29  29...APPQINAKNAVVMDYETGQILYDKNGHIKVYPASTTKVLTAILALE-----KGNLDDTVTASKNAANVEG----SKIYLSEGEQLKLRQLLYAMMVESANDAAVAIAEYIGGSVENFANMMNEKAQQIGAKDSHFVTPNGL--------------HDPDHYTTAYDMALIARYAMKNQ-FFRELVNTITYVIPPTNKKRVLLNTNMLIRPTKYHYDGADGIKTGYTSEANKCLLATAMRNDRRVIVAIYDDDSSII-WKDATDLLNYGLDNFITKTYIHKGDYVK---KIPI-DGTTAYVDLKAAQDFIYTVPTDKADSIKAHIKI--KNIKVPINKGQRLGYISYELDGK--------EIGKVNLIADRAI-KANILSNLYSS.................... 375
184 0.000e+00UniRef50_A0A2E9VY56 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Bacteria TaxID=2 RepID=A0A2E9VY56_9FLAO  ali  27  22..PNPPEVSASSYLLLDAKTLTVISSSEADQSTGLASITKIMTAYVVADQISKGFISLETMVDISVDCWKMEG----SKMFIREGTQVSVSDLLKGIVVQSGNDASCALAEKIAGSQSAFADLMNNYAEQLELDNSNFINPTGLP--------------DVNHYSTANDIAKLSIALINDFPETYVLFKEKEFTF----NNIKQLNRNSLL----WQDDSIDGIKTGHTSDAGYCLVASAKRGDMRLIAVVLNSASEKTRLQDSRRLLDYGFRFFKTKKILDKYQQVTI---VDVWAGIDEKLVLGPSSDIYLTLTKPQFKNLEV-IASKNLGIKAPIIEGQAIDSMDVVIEGKVHS--------SYELVAVSNVNSKGFIRSSFEALAFYVYSFF........... 377
185 0.000e+00UniRef50_A0A1L8PPA4 Uncharacterized protein n=3 Tax=Carnobacteriaceae TaxID=186828 RepID=A0A1L8PPA4_9LACT  ali  41  34...PSVDIEAESSLLIDFETGQILHEQNADAYRGIASMTKMMVEYILFEEIEAGNLSWDTEVTISEYAYTISQDYALSNVPLQLNDTYTVKELYEALAIYSANGATIALVEQMEGSESAFVDRMRLLVEEWGVDEYELYNTTGLNNSYLIDNHYPGSETDDENAMSAKNIAKVAKNLIEDYPEVLETSSIPTKIFRGTSDAISMMNWNWMLEGLPHERMDVDGLKTGTTGFAGATFTGTAESEGRRLISVVMGAGDRGLRFNETAKLFDHGFDEWIYNTLVEGDVVLQNVDPLAVKNGLAENVSLKTVDSLSYYVPSNQDEKASYSFQPNEEEIEAPVEEGDILGELVLDNQDNV-EYLEGEADQTVQVAAADSVERAGFFTVFSNLVKDFFSKL............ 436
186 0.000e+00UniRef50_A0A2T2XIF4 D-alanyl-D-alanine carboxypeptidase n=6 Tax=Sulfobacillus TaxID=28033 RepID=A0A2T2XIF4_SULTH  ali  28  31QSPPPPPINAKAAELVDANSGQVLYTKNAQQELPMASVTKLMTLYIAVRAIERHQIRLHDMVPADEEAYRIGG----SQIWLEPGERLSVDQMLKAVAVGSANDAAYALGTYISGSEAGFVQQMNETAKALGMTHTHFSNPHGLPQS--------------NHYSSAHDLAILGEKAVK-LPLLLKYTSLWEDRSNGKGGTLWLVNHNRLL----RTYPGADGLKTGFTREAGYCMVATAKKGETRMVVAILGAPTGKIRAQDAASLLTWGFQNFRTVSIAPAHKIMGY---VDVRRGVEPRVAAWVVDPVLLTLPA-SSGHISQALTL-PQEVQAPVRVGQALGHLEIKSG--------RHVIRSVSIVAAKQVARTTIGALTWKYLWKLFT.............. 390
187 0.000e+00UniRef50_A0A2W4Q118 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4Q118_9FIRM  ali  29  101.AGPALAIGSPSAVLMEARSGRILFAKNPHERRNPASVTKIMTLLVAYDALAAGKAAWDDPVTTSAEAKSQGG----TQVFLEVGEVNPLGALLKAISVGSANDAAVAVAEHLGGSHEGFVALMNDRARGLGLQNTQFQNATGFDA--------------PGHYSTAYDIAVIARELILRHPQALRHSKIFYELFHPDGRETEMLNRNRLVHFHNW----VDGLKTGHTQASGYSIAATGERGGTRMIAVILGAPNADTRQADALRLLEYGLARFTTVTHAPPGQPLAA---VPVLRGMRRQVAAVPRVPVAVTVPREDREKVEWKVQVA-PRLQAPVTRGQVIGRVTAVVGGR--------EEAAYELVAAENVPRLTLWAAFRRAFSRLLGS............. 460
188 0.000e+00UniRef50_A0A2A4LKA5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Pelagibacterales TaxID=54526 RepID=A0A2A4LKA5_9PROT  ali  29  19KAYSKIEXDASYXILQDHLSGEILYEKDADXXIYPASMTKIMTTIVTFDLLKKGETSLDEMITISEKAWRMSQ-SGYSSMFIMLNDQVSVEDLLKGIIIVSGNDACVALAEGLSGTEKEFVILMNEKAEEIGLEXTNFNNSSGIN--------------DVNNYSTVRDILKMSRYMIQNYPEYYSYYKDTSFTWRTGGDPITQGNRNPLLYKNI----GADGIKTGFLTVEKYSLASSIKHGDRRINAVASGFKXXNSRSRESVKILTWALRSFDTIQVAKKNEVIA---SLDVWLGKKNKVEALVLEDIYXTVPKRKKKIIKAVIEYNXP-IEAPIAKGDKLGSLNIYVXGEL--------KKKIDVLSGEEIKKANIFSRLLKSFNFLVWG............. 382
189 0.000e+00UniRef50_UPI0009855D36 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Massilimaliae massiliensis TaxID=1852384 RepID=UPI0009855D36  ali  33  43EKKTELAVNAKAAILIEQETGTVLFEKNADEKLEPASVTKVMTMALVLEQVSKGKIKLDDMVTATARAKEMGG----TQINLDDGEQMSVYDLLMAVAVASANDAAVALGEYVGGSEAAFVEMMNQKAKELHMENTHFENTNGLPA--------------EGHLTTARDIALMSRFLLS-FEQASEFTSTDRYPIRSDTNEYMMRNSNAL----VREYDGCIGLKTGYTQTAGHCLSSAATRNGMTVIAVVLGESDSKTRFQESKELLDYAFAHYD---LYRPEVTFEQPGEIPVKMGTQGAVAVVAEQAAPVVIKKGAEPNLEIKTEL-EESVTAPVEEGAVVGKTVVTLDGKEVGAYEYK--------AAESVTKRT----VWSAIQMIFYRIF........... 402
190 0.000e+00UniRef50_A0A1Z9YE37 Uncharacterized protein n=3 Tax=Hyphomonadaceae TaxID=69657 RepID=A0A1Z9YE37_9RHOB  ali  28  22...QAFETQADHAIILDYETGAVLYSYESEAPMVPASMTKIMTAYMVFERLSDGRLSPEDTFTVSERAWREGGASGGSTMGLAIGQEVSVADLLHGMIVQSGNDACIVLAEGISGSEEAFADLMSARAQELGLETAHFENATGL--------------FAEGHEISAHDLARLAQMTIENFPNYYRIYNVRDFEWNG----ISQPNRNPLL----YRFNGADGLKTGHLSQSGYGVVGSAEVDGVRRIIVLNGMESETARAAESERMMRAAFREFSLSEPFADGAEVGM---VPVWLGSSDHVSAIIREDVVIAYESASRNDLSADLI-VPDVLSAPVSEGDEIGTLEIRNGAEVIG--------SFPVYAGSDVSRTGLLSRAISGVSALIS.............. 378
191 0.000e+00UniRef50_K7YRD8 D-alanyl-D-alanine carboxypeptidase family protein n=7 Tax=Rhodospirillaceae TaxID=41295 RepID=K7YRD8_9PROT  ali  31  26..AAKIATSAREAILLDYDTGYVLLQKNADRLMPPASITKIMTVLLAFERLADGRLRMEDEIPISEQAWKKGG----SKMFVEIGSRVSVHDILRGIIVQSGNDAAIALAEAIAGTETAFAELMNEKASRIGMGEATFYNATGWP--------------DPKHLVTARGLAVLAIETIRKFPEYYKIYAEKSFIYNG----IKQNNRNSLLYKNI----GVDGLKTGYTEIAGYGLTASAKRNERRLILVVSGLKSANQRSRESERLLEWGFREFNNYKLFDSGQTV---EQAEVWFGEQNTVSLTTEKELVITMDRISRKEMQVSVEYDSPIL-APILKGQVLAQLRISIPNREDQI--------VPLVAKNNIDKLNGLNRISRAIYYLILG............. 379
192 0.000e+00UniRef50_A0A2N6AHA2 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2N6AHA2_9PROT  ali  27  63.........AKQIFLVVPETNRVLLEKNGDEKTPPSSMTKIATLMMVFEQLQSGQLSLDDTFSVSVNAWKKEG----SRMFLEPNTQVRVEDLIRGIVVQSGNDATTVVAEGLAGDERQFADQMTERLKELGLQNTNFVNASGLPS--------------PDHYSTARDLALMGVQMIRLYPQFYHYFGEKSFKY----NNIHQANRNQFLFRSPSH---VDGIKTGITDAAGYGIVASAAHDGMRFILVLNGCESDKDRFQVGEKIFKWAFREYKNQTLFEAGQILG---EARIWLGAKKTVSLMVPERVRLTLSQKEHKHLKVTYHYNDP-IEAPVKQGVRVGDLVIEAPGNKWV---------YPVVAGETVNEVGFFGRAISALYYTIWG............. 409
193 0.000e+00UniRef50_R7K7Y2 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Acidaminococcus sp. CAG:917 TaxID=1262688 RepID=R7K7Y2_9FIRM  ali  32  145........SAKASLLMDYATGTVIYSKNETERLPIASMMKIMTVLLTLEEIDKGNLKLDDKVTVSENAASQGG----SQVFLDANEEQTVGALLESVIVASANDSCVALAEHISGSVEGFVAKMNERAEQLKMGNTHFANCTGLPS--------------PENYSCAKDVATMTRELVK-HPTYFEYSKVWLKDFHNSERKTTMTNTNKLI----RFYKGCDGGKTGFTNEAGFCLSATAERDGMRLIGVVIGEKDSKTRFKDASNMLNYGFANYENKVYLDTETEIKND--IELKKSKQDTCKIVVDSPLVSFAKRGDESGFEIKYEL-PKSIKAPKKKGEKIGKAYLVKDGVV--------VDESNVVLKENLDKSSLLDDLKKLFGL................. 493
194 0.000e+00UniRef50_A0A0E4GC39 Peptidase S11, D-alanyl-D-alanine carboxypeptidase A n=2 Tax=Syntrophomonadaceae TaxID=68298 RepID=A0A0E4GC39_9FIRM  ali  31  35.......ISAESYVLMDADSGKVLKSKNMHKKLPPASMTKLMTMLLALEAIEHNQVGKSDKVIASPYAASMEG----TRIYLEPGEVMNMDDMLIAMSLVSANDASVAVAEKLGGSEAAFVELMNKKAAAIGMKDSRFRNSHGLPA--------------PGHVSSAYDMAILARYTLDNTP-VLRYSSLKEHSLRQGEFPI--HNSNKLL----WRYEGADGLKNGYTSEAKNCLTATAKRGNLRLIVVVMGCPLKGGQTNDVINLLDYGFDNYSTQKLLSSHNVCA---TTRVRGGIDKEVKVLVRDDVNAIYQCNQGASFTRRQNVAG-SVKAPVQRGQKLGEMEILNNGILLK--------KVDLVAANDVPRITWGER........................ 373
195 0.000e+00UniRef50_F9Y4S5 D-alanyl-D-alanine carboxypeptidase family protein n=46 Tax=Alphaproteobacteria TaxID=28211 RepID=F9Y4S5_KETVW  ali  29  24..AQSFVTSARAAYVLDQTTGTVLLDHNADEVLPPASMSKLMTIYMAFEAVSNGRLHLTDELRVSQHCMNYGG----SSMFLNTQDRPHVEDLLRGVIILSGNDASCVLAEALSGTEGGFAALMTTRAHELGMSNSHFMNSNGWPA--------------AGHLMSMRDLGTLSRHLIEDFPTFYPIFAETEFHYDGRVPSNSQ-NRNPILSLGI----GADGLKTGHTSEAGYGLAGSARQGDRRVIFVITGLESEAARRDESERIINWAFRQFALQDLGKAGDIIPGG-TADVWMGAAPRVQLALGQDLQILVPTTSANEMTTEVVYNGP-IAAPITAGQELATLVIDREGMP--------QMTVPLVAETDVPAGGFVNRVMGSAMILLGKV............ 385
196 0.000e+00UniRef50_A0A2S6QZ36 D-alanyl-D-alanine carboxypeptidase DacA n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2S6QZ36_9PROT  ali  32  18.SAHAIDLNAESYYIVENKTGTVLLEKNADKQMGPASLTKMMTAFLIFDALERGDLTLDTMMPISEKAWRKGG----SKMFLEVGKKVKTEDLIKGILVSSGNDACIVASEFLAGTEEAFAQMMNDKALEIGMLNTTFKNASGWPN--------------PEQVSTAKDMTILARAILNTYPQYYKYFGIDRFTYS----DISQPNRNGLLRRNM----GVDGLKTGHIEDAGYHLVASAEKDGVRIVSAVMGTNGSRAREDETLTGISYAFRTNSMITAVEKGKQV--VEAAPVWLGEAKTVALTVGESLELYVANKDKKDIKGEAVYNAP-LPAPITKGQEVGKFIVTHP-------TTGEKIELPLVAGNAVAEAGLGSKAWSYIKH................. 370
197 0.000e+00UniRef50_D5X9D9 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Thermincola TaxID=278993 RepID=D5X9D9_THEPJ  ali  32  32...QEPGIVGKAGVLIDARSGQVLYAKNPDLRLPPASTTKILTVAIALEE---GNV--NDKVTVSKNAVTQEG----SSIYLTAGETLTLEDLLYGVLLSSGNDAAVAVAEHIAGSVPAFVKLMNKKAKEWGATNSNFCNPNGLPN--------------DEHYTTARDLAMIAKHAM-ELPLFREMAATKVKEIKDPANFFRLINHNKLL----WRYEGANGIKTGYTRVAQQCLVSSAKRGDQEFIAVVLGSVGNNI-WTDSMALLDYGFKNFRTTKLVEKGKFI---QEISVKDGT-GKVRVVTEREQYFTGKLADNDVPKAKTIIF-KGLAAPIKKGQKVGYITYNFDDK--------EIGRVYLVAANAVDKKVMVKR........................ 371
198 0.000e+00UniRef50_A0A259UQD2 D-alanyl-D-alanine carboxypeptidase DacB n=1 Tax=Sporomusa acidovorans DSM 3132 TaxID=1123286 RepID=A0A259UQD2_9FIRM  ali  29  29.....PDLTAKAAIVMEASTGKVLYSRNAEERRYPASTTKIITLITALEY-----GKLDDVVTASQNAATTEG----SSLWLLPGEQLTLLDMLYGIMLVSGNDATVAVAEHISGSVDVFAKLMTEKAHSIGAVNSNFVNTSGLP--------------DERHYTTAHDLAKIAAYGYKN-PLFTQIVSTQHKPWPGKEHDRDLYNENRML----WLYDGANGVKTGYTDAAGRCLVSAANRNGVQLVAVVL---DSERMWDDSIKLLNYGFAQLKPVPVVHKGDILK---TVKISEGKTGNVKLVADQDIVLPMADNEHDQFS-TVIDAPNKMNAPVAAGQKIGTVKVLYNN--------VEVANADLLADQQVERKSFFGMLWGSVLGIVSFVIHNFA....... 382
199 0.000e+00UniRef50_UPI000D64639C D-alanyl-D-alanine carboxypeptidase n=1 Tax=Eubacterium ramulus TaxID=39490 RepID=UPI000D64639C  ali  28  39.AGSAPSVTAPCALLMDAATGTILYEKNSTEERPLASVTKIMTLLLIFQALEAGQIHLEDTVTISEHAAGMGG----SQVYLEPNETQTVETLIKCITVASANDACVAMAELISGSEDAFVQKMNETAASLGMTHTNFVNCCGLDA--------------DNHYSCANDIALMSRELTVNHPAIFDYTKIWQEDIARGDSAFTLSNTNHLIK----QYPYATGLKTGFTSKAGFCLSATATKDSLSLIAVVMGAASSKERIADVKSMFDWGFVNCRVYT----DENQDVLPDILVSRGSQSQLSLQYESAFHYLDTQNTSGELEKKLEL-PDRVEAPIQKGDVIGKAVYTLNSE--------NVGSVNILAANSIPLLTLKDAWVQIVSRFFLN............. 400
200 0.000e+00UniRef50_K8Q5F3 D-alanyl-D-alanine carboxypeptidase n=64 Tax=Lactobacillus TaxID=1578 RepID=K8Q5F3_LACRH  ali  42  31ESSDTNLVNAKAAVAIEPTTGKVLYAKNASTVLPIASMTKMISIELVLDAIKSGKIKWDDKVTLDQSIWTISQDRDLSNVPLRRDGSYSVRELYDASLIYSANAAMMLLAKAVAGSQEKFVNQMDAKLKSWGITDAKIVNVTGLNNSQLKDAKVPGTGDNAENEMSAKDMAQVAQHLLKDHPEVLKTTSIAKQTFRGTDDAINMENWDWMLKGLVSYDKNVDGLKTGTSDAAGDCFTGTVEKNGMRIITVVLHANGDAKRFDETKKLMTHVLENWKTITLANAGQSIKGYSKVNVNRGASRTTPIAPSAKAVAVVPADASKK-TLKYTYTPAKIEAPVKKGTTIGNLKVTAKDDQLGFVGDNAQEGITLKTTKSNQKANFFVLIFRGIGDFFSHIF........... 436
201 0.000e+00UniRef50_C0GE00 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Firmicutes TaxID=1239 RepID=C0GE00_9FIRM  ali  33  27....EFEFSSKAQLLMDVGSGEVLYENNIHEQLYPASVTKIMTMLLAMEALEEGKVKPDDLVPVSEAAAAHGG----SQIFLSPGDRITFEDLMIGIGVGSANDGSWAMAEFLAGSADAFVTQMNEKARELGMNNTNFMNPHGL--------------HDENHYTTAYDIALMSRELLR-YPKIHEWITIWMDELKGKEEGVYLSNANR----IVRYYDGGDGLKTGFTSEAGNCVSATAKRGDTRFMAVILGAPGRPALFDEAKTLLDYGFANYKSVPIAQKGEVFG---TVMVDKGVIPEVDIVAGDDLSLLLEKAQQDEVDLEVSL-PTRLPAPVPEGKAVGSLIVKTPE-------GNEVGRLPLVPAEEVSRANIFTFFGRFMHKWVN.............. 386
202 0.000e+00UniRef50_UPI000A00DFA4 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Clostridia TaxID=186801 RepID=UPI000A00DFA4  ali  29  17....PMRITADAAVLMDAGTGQVLYAKNAHQPRPPASTTKILTALLALE----GGV-PDQLVTVSPRAAAVG----ESSMGLFPHQRLTLRQLVYGALLCSGNDACVAIAEHLAGSEENFVWLMNGKARELGATRTSFRNPHGLPA--------------PGHVSTAYDLALLARYALSN-PAFREIVSTRYHAFTCPPWGVYLHNTNRLL----WSYPGADGVKTGTTGEAGQCLVASASCGGRRLISVVLHSED---RYGDTVALLNYGFGAFKEDTVVEAGQVCGQAE---VSFGVAPRVSLVSARTLKAVLPARGGAGAEKRV-FSPGGLVAPVPPKMPAGHLEVWVGGQPVARAL--------LLTASQVKKKPFYRLWWEGIKDF................ 361
203 0.000e+00UniRef50_F6B3N6 Serine-type D-Ala-D-Ala carboxypeptidase n=4 Tax=Desulfotomaculum TaxID=1562 RepID=F6B3N6_DESCC  ali  25  31......EISGEAAVLIDAGTGQVLYGKDEHKRMYPASTTKTLTALVALE-----HAKLTDLVTIGPNALQAGG----TSIGLTEGEKIPLKDLLYALMLNSANDAGVAIAEHISGSVEKFAALSNQEAKKIGAKDTHFTNPHGMP--------------DKNHYSTAYDLALIARQAMQNQ-EFRRIVSTVHYQVSDPNAQKYLFNHNKLLWSKIYGYQGTTGVKTGYTVEAGQCVIASAQRDGRELIAVVLHSDGSNI-WSDATKLLDYGFTNFHSRQVVKGGQVMAN---IPVKYGKSPNVDLVASRDFYYTFPLEGADDLQISVQPQKE-VKAPVTRGQVLGSILLSQNGK--------QVGKVDLVARGNVAK.............................. 366
204 0.000e+00UniRef50_A0A2S6RSH8 D-alanyl-D-alanine carboxypeptidase DacC n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6RSH8_9PROT  ali  30  22..AYSMETSANSAYIIDVNSNTILYEKNADERQGPASMSKLMLIYMVFERLQNGTLALDNEFLVSKKAWKFGG----SKMFVNVGDKVTVKDLLMGVIVQSGNDACIVLAEGISGSEEIMASNMNEKAKDIGLTNSNFINVTGWPNKD--------------HYMSLRDIGHLSKLIIKKFPEYYNYFSLSEYTY----NDIKQFNRNKLLSR-----EGFDGLKTGRTTQSGYGIAVSAIKDNRRVVSVVNGLNSDKDRVNETLKLVNWAFRDFVNLDLYQAEETI---QSAKVWLGKESFIPLILNEDLSVTVKKNNFEKFKVKLVYETP-IIAPAKKGDKVAELHL-IDGENIKIK--------DVYAGKDVEKVSRFYRSFSIINYLLFGVSNK......... 377
205 0.000e+00UniRef50_A0A1C2J0G6 Peptidase M15 n=18 Tax=root TaxID=1 RepID=A0A1C2J0G6_ACITH  ali  31  46...........SYVLMDYDTGQIIAAKSENLRRAPASLTKLMTAYLTYQAIHNGTLNSNENIQISNTAWKTGG----SSMFIQPGLAVNVDQLLHGLLIDSGNDAAVALAETVAGSRSGFVTLMNETAAQLGLHNTHYNNVDGLP--------------DDNLYTTALDVARLSRTLIQQYPQLIQITKQKSYTY----NKITQRSWNPVL----FRDPSVDGLKTGLTDASGYCIDATAQRNGRRLIAVVMGGPNWAGSTNAVEALLDYGYRFFVNHPVYQSGQQVGKITR---NDFSPMHVPVGVTQKVTVTVPKGHFSDLQ-RVVELNPNLQAPLKKGTVVGTLVFQLDGKTLK--------TVPVVSMVSAEKAGWLSRMFHKIGD................. 386
206 0.000e+00UniRef50_A0A2D6HLK7 D-alanyl-D-alanine carboxypeptidase n=2 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A2D6HLK7_9PROT  ali  28  37EAFDSPKTSAKQVFIQDFETGQILFEKAAQERMPTSSMSKVITAYAIFDAIEEGKISMDTKYLVSEKAWRMGG----SKMFVPLGEEVSVSDLLKGVIIQSGNDATVVLAEGLSGSEEGFAKVLNAKAKELGMTNSHFMNASGWP--------------DDNHYSTAEDLGKLATALIKNQKAHYPLYSETEFKF----NDILQYNRNPLLYKNI----GADGIKTGHTEAGGYGLMASAVNDGRRVIMVINGVPSNEERSTEALKLMQWALSQFENKVIANPDQILG---EAPILYGKAKVVPYAAQDTLSVTLPTYATGADVTQENVLKDSIVAPVKKGDVIGEVSILYKGDV--------VKTTPLIALSDVAESNPVMKLFQKIGN................. 389
207 0.000e+00UniRef50_UPI00036EAECF D-alanyl-D-alanine carboxypeptidase n=1 Tax=Uliginosibacterium gangwonense TaxID=392736 RepID=UPI00036EAECF  ali  30  31EAAVAPAVNARAWILYDPGSEQILAQHNADQRLEPASLTKLMGAYLVFKALHERRLDHRQQIEPSPNAA----VPNGAAMHLQAGKSVSVDELMLGMLVVSANDATLALAETLGGSEAGFVSQMNQEAQRLGLANTHFRNATG--------------HSMPEHYSSAHDLARLATAIVRSYPEEYSLFSRHEIRY----GDLSQLNRNRLL----WLDATVDGMKTGQTEAAGWCLVASALREPRRLIVVILGASSDNERFADAQRLLNYGYQAFDTVRLHQERQALK---RLPVWLGKAPSVEIGLREDLILSVPAGRAASLTERLRYH-DALRAPLRAGDPVGSLLVSLDGQQLG--------EYPVQVLHDVPAAGWLGRSWDRLRLWLKNF............ 388
208 0.000e+00UniRef50_UPI00058FE9F8 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Alkalibacillus haloalkaliphilus TaxID=94136 RepID=UPI00058FE9F8  ali  37  31EGSSELVESAKSAMLLEVDTGTVLYDKDPHKRLPPASMTKLMSMLLIMEELDKGTITLDETIQVSEYAASMGG----SQIYLEPFEEMTVEELLKAVAVASANDATVALAERIAVTEQAFIDQMNERASELGLENTNFVNSTGLP--------------DENQYSSAHDMARIAQELL-NHEEITDYTKIYEDYLRDTDDEFWLVNTNRLVK----FYQGVDGLKTGYTSEAKYCLTATAKRGDMRVVSVVMGAETPQKRNADITSMLDYAYGHYELHQVHAKGDELYRWQHI---KADNDYLVASPKQNISMLLEKGEKSDYRTEISVDSSD-EWPLAKDDEVGKIEIYKEDQLVKDY--------PLTIKEEIKDASVFTLWKRMMNQL................ 388
209 0.000e+00UniRef50_A0A0W7WDP0 D-alanyl-D-alanine carboxypeptidase n=11 Tax=Rhodobacterales TaxID=204455 RepID=A0A0W7WDP0_9RHOB  ali  27  25...SAFDTRAEAAFVLDQTTGTVLLAKNADTALPPASMSKLMTLYITFEAIRDGRLRMEERLPVSAHAMSFGG----STMFLNTQDRVTVEDLLRGIIVLSGNDACVVLAEALSGTEAGFARLMTQRAQQLGMTNSVFKNASGWPA--------------DGHVMSMRDLTLLATKIIEDFPEFYPMFAERRFAFDGRAPS-NVNNRNPLLGLGI----GADGLKTGHTQEAGYGLVGSATNGDRRVVFSVTGLETERVRAEESEAIVNWAFRQFAEQTIVTEGDTVTQAE---VWMGAADRVDLVATRDVTLLLPTMTPEGLKAEVVYTGP-IEAPVSEGQQLAELIIQPEGLP--------ETRVPLVAAHKVDAGGFMHRMLTVSGVLLKRL............ 383
210 0.000e+00UniRef50_C0GDY6 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Dethiobacter alkaliphilus AHT 1 TaxID=555088 RepID=C0GDY6_9FIRM  ali  29  24...ETPDVTARAAVLLDQETGRILFSKNAHERLPMASTTKIMTAIL---AIESGR--LDEMVTVSEYASLVEG----SGVDLDAGEQKTLEELLYGLMLRSGNDAATAIAEHLAGSVEKFARQMTRRAGELGAAQTRFENPHGLEA--------------ENHYTTAYDLGIIAVYAMS-LPEFREVTSEKRISWTGRPYDRILYNQNKLLDM----YEYADGIKTGWTTPAGRCFVGSSNKDGWGLVSVVLNAP---QMWEDTIELMEFGYSYYHWEPLVEEG---RHLKTAQVERGTADRVTLVAGNDLGLPLKENEADVLRYEFNVAEP-LRAPVSAGDEVGTMEVYFG--------TQRIAEVPLVAASDVGRRGLFG----ALRNFFGRLF........... 371
211 0.000e+00UniRef50_D9S3C8 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Thermoanaerobacterales TaxID=68295 RepID=D9S3C8_THEOJ  ali  28  32.....LSLNARAYVLMDPVSGRILVEKNSEIRLPMASTTKIMTAIVALE-----KGDLNSTVTVSRKAASVRG----SSFHLEPGETMSLESMLYGLLLPSGNDAAVAIAEHIGGDVKTFVELMNLKAREIGAFNTHFKNPHGLD--------------EPGHFTTAKDLALITRYAL-NIPKFREIVRTKDIIITEGRRPRHIYNTNRLLRVS----EEIDGVKTGYTGKAGRCLVATAERNGMRLISVVLDAHD---HFSNTLKLLNYGFSTYRLNKLVQKNNIYAA---VPLKGGIINKAVLIAGEDVALPMRDGEKAHLKLVI---PSFVPAPVFKDQVVGEIQVFIDG--------VLVRRVPLLSIQDIRKKTFFDRFYRIMMEWVTS............. 375
212 0.000e+00UniRef50_A0A2N0V004 D-alanyl-D-alanine carboxypeptidase DacF n=20 Tax=Firmicutes TaxID=1239 RepID=A0A2N0V004_9FIRM  ali  33  27.ALSAESISAPSAVLMESSTGKVLFEKNPHEQRPCASVTKVMTLLLVFEAVDSGKLSLDDEITASEHAAGMGG----SDIWLEKGETMSADDMIKATVVVSANDAAVALAEHISGSEDAFVEKMNSRAKELGMNDTVFKNCNGLD--------------EDGHITSAYDVALMSREL-TKHEKIFDYTSIWLDNLRGGKTQI--VNTNKLLK----TYNGITGLKTGTTNDAGCCMSATATRGDVSLISVVLGCKTGKERFADAAALLDYGFANVSVKELTLPEDM---PKSIDVNGGMTDSVKLECKVSSKIVVDKGNGAKITTEIDL-PDKIDAPVEKNRKIGTLTYLVNSK--------KAQSFDICAGDSVQKTSFGALLEYVFASLIS.............. 381
213 0.000e+00UniRef50_M1MFA0 D-alanyl-D-alanine carboxypeptidase DacF n=63 Tax=Clostridiales TaxID=186802 RepID=M1MFA0_9CLOT  ali  34  38..AEGTNIEARSALLMEPMSGKIIYEKNADEKFAPASVTKIMTMLLTMEAVDSGKITIEDKVTCSENAKKMGG----STMLLDTGEIRTVEELLKGVAIASGNDAAVALAEYLGGTEADFVNMMNTRAQELGMKNTTFKNCNGLPA--------------DGHLSTAKDIAIMSKELLK-HPKVLKYTGTYMETISGRKSPIELVNHNKL----VRFFEGCDGLKTGFTDEAKYCISATATRNGVRMLSVIMGAPTYKIRNRDAGVLLNHGFSKYEGKKLISKDEDV---DKIFMDEQTDKYFMAKAKNDLTVILPKGESKELEKKIVIDELKKEY--KVGDIVGKYEVYLGN--------DKVGEIEVYCDRDIKKGNIFDNIKYNIKNLF............... 392
214 0.000e+00UniRef50_A0A2D9B1K4 Serine-type D-Ala-D-Ala carboxypeptidase n=9 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D9B1K4_9GAMM  ali  31  40...........SYVLMDFDSGMIIASKNPDAQIPPASITKIMTSYIAFLELQNNTLNMNEDVLISKKAWKTGG----SKMFIEVGKKVKVSDLLHGIITSSGNDASVAMAEHISGDEDTFSIYMNQIASNLGLKNTNYTNSTGLP--------------DDQLFTSARDMAVLSRALIKNFPNQYKMYKNKEFIF----NDIKQYSRNKLL----YLDDRVDGIKTGFTKKAGYCLVSSSKRGKRRLISVVMGAKSPDQRTDISKSLLEYGFRFYETHKIFSPDDKI---HTARVYNGEKKELSLTVKETEFISIPRRSLKRIKTNFVID-KGLTAPVKAGENVGFVAIKLDDKV--------VTRINLYASESIEIGNVYRRSVDSVLKNF............... 382
215 0.000e+00UniRef50_C6XJM5 Serine-type D-Ala-D-Ala carboxypeptidase n=9 Tax=Hyphomonadaceae TaxID=69657 RepID=C6XJM5_HIRBI  ali  28  24..ADALNTSADYAYIMDADTGMALYSKDGDTPFIPASMTKIMTAYIVFERIRDGRLTLEDEFVVSETAWREGGASGGSTMFLELGSKVSVRDLLRGVIIQSGNDACIVIAEAISGSQEAFAEEMTRRARELGLDSATFENPTGL--------------YSDNHRISAADLAQLAYLTIKDFPEFYALYSEKEFTWNG----IRQPNRNPLL----GEVQGADGLKTGHLEISGYGLVGSAVRDGKRRIIVLNGLDSIAERASEARRVMRSAFVDFKVVEVVQPDQIVG---EADVFLGKQKTVELKAIELMKAALHADSIRDIKVEVVYNGP-LKAPLSEGDVVGEIIVSAPG--------MQDVRAPAVLAQSIARKSLFERAL...................... 373
216 0.000e+00UniRef50_A0A2E6KLX4 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E6KLX4_9RICK  ali  27  27..AETPVISAKQALIVDAQTGSVVFEKNSMDQMPTSSMSKVMTMLVIFDALKDGRLKLDDTLLVSKKAWAKGG----SKMFVGEGTRISVEDLIKGVIVQSGNDACIVLAEGLAGSEEAFVDLINQKARELGMNDSNFKNSTGWP--------------DPDHYSTARDLMKMSLDLVYNYPEFYHYYSIKEFE----HNGIKQNNRNPLLYRNL----GADGIKTGHTDVAGYGLIGSAEQAGRRIFMVLNGLETDKMRRSESARLLAWIYNNTENVTIAKKDDVI---YNAKVWMGSEKIIPLVLNEDFHATIYNDSKDQIKTEI-LIEEPLQAPVAFGAEVAKLRVTLPDNT--------VIEKPLFAATHSPEMNIFGKALARIEYAVVGL............ 383
217 0.000e+00UniRef50_A0A174C8J4 D-alanyl-D-alanine carboxypeptidase dacA n=18 Tax=Clostridiales TaxID=186802 RepID=A0A174C8J4_9FIRM  ali  29  60.SSDVLNLSAPSVLLMEASTGTILYEKNSHTVLRPASITKIMTLILIFDAIESGQISLEDTVTVSEYAASMGG----SQVFLEPNETQTVDTMIKCISIASANDACVAMAEFICGSEAAFVEKMNARAKGLGMNDTTFVNCCGLDV--------------DGHMTSAYDVALMSRELTTKYPQIHNYSTIWMDTIRRGSEEFGLTNTNKLI----RQYQYATGLKTGSTSLAKYCVSATAVKDGMELIAVVMAAPDFKIRFADAATLLNYGFSKCRIYS----DENTDTLAALPLKKGISDEVSLCYRSPFQYVVTDGSDLSGITKELELPESVEAPVASGDVIGRAVYKLGDRELG--------TVDILCSEDIAAAVYKDYFMESLQMYL............... 420
218 0.000e+00UniRef50_A0A0K8MBU8 D-alanyl-D-alanine carboxypeptidase DacC n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0K8MBU8_9PROT  ali  30  42..........KQAILIDLTTNDVLLEKNADEKMTPSSMSKILTTYLVFAELKSGRLKMTDTFPVSEVAWRKSG----SKMFLKINTKVSIEDLLRGAIIQSGNDACIALAEGIAGSEEAFAAQMTQVAHEMGASHSNFVNSTGWP--------------DANHYATARDLALIAWKLIKEYPEYYALYGEREFTY----NNIHQMNRNPLLA----SFEGADGLKTGGTDDGGFGLVGSAVQGGRRLMMVINGADSKKKRAVDAKALMAWGFNNFLSPCLYKKNQMIDQAE---VWLGDQSKVGLSVTRDVCITIPRQNIKNLKVDLIYNGP-VEAPVQAGQQVGVLVISMPDKPDMI--------VPVVATQSIGKAGFFSRIGAAFTYLLKG............. 387
219 0.000e+00UniRef50_A0A173UAB2 D-alanyl-D-alanine carboxypeptidase dacC n=27 Tax=Clostridiales TaxID=186802 RepID=A0A173UAB2_9FIRM  ali  29  27..AEEVEISAPSGILMEMSTGTVLFEKDADTARPPASVTKIMTMLLIFDALENGTVSLDDEVSTSEYAASMGG----SQVFLEPGEIQTVGTLLKCISVASANDACVTMSECICGNEQEFVKQMNARAKGLGMKHTNFVNCNGLDA--------------DGHEMSARDIALMSRELMTKYPQIKDYCTVWTHTTARGSSEFGLTNTNKLI----RQYEYATGLKTGSTGKAKFCVSATASKNGVDLIAVIMGAEDSKSRFKDAVTLLNYGFGKCQ---IYKAKER--KLPSVLVKGGKEEHLKIQYEEGFTYVDTEGSDLSKVEEVTEIPDEVKAPVKKGDTVGRICYRINGK--------EIGSINLIAATPVEKADFGDYLKKIWKKLL............... 385
220 0.000e+00UniRef50_B2TQW7 Serine-type D-Ala-D-Ala carboxypeptidase n=28 Tax=Clostridiaceae TaxID=31979 RepID=B2TQW7_CLOBB  ali  32  38..ADGMNVEAKSALLIEPTTGKVVYEKNPDEKFAPASVTKIMTMLLTMEAIDNGKIKLDDKVTCSENAKKMGG----STMLLDTGEIRSVEELLKGVAIASGNDAAVALAEYLGGTESDFVGLMNKRAQELGMKNTVFKNCNGLPA--------------DGHLSTARDISLMSIELLK-HPTILKYTGTYMDSISGRKSPIELVNHNKL----VRFFEGCDGLKTGFTNEAKYCISATATRNGVRMLTVIMGAPTYKIRNRDAGILLNHGFSKYEGKKIVSKDEDV---EKVLMDKQTDRFFMAKAKDDLTAILPKGSNGEISNKIVI--EELKPEYKMGDIVGKCEVYLGEE--------KVGEVEIYSDRDIKKGNLFDNIKYNIKNLF............... 392
221 0.000e+00UniRef50_A0A1T4LXD1 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=7 Tax=Aurantimonas TaxID=182269 RepID=A0A1T4LXD1_9RHIZ  ali  29  34.SAPTIETTAKQAILIDGESGAVLFEKSADEPFEPASLAKLMTMDLVFDALAKGKIALDQTFAVTEHAWRTGGAPSGATMFAKLNSEVPVEALIRGAIVQGANDAAIALAEGMAGTEGAFAMLMNQRAEELGLKHSRFVNPTGLPA--------------DGQQVSARDMAVLARHIERSYPDLYKIYAEPSYEW----NKIFQRNRNPLLEMDI----GADGMGTGYTESSGYSLVGVTHGEDRTTILVVSGLASAKERASEARRLLEWARDSFRRQTLFAASDVVG---TAEVYGGTQSSVALTPSQDLVALVPEQAPDSVTAHIKYVGP-LKAPVEQGTKVANIEIRIGERL--------SLTAPLYTAESIAVGSFSGRALEAAGELAFGWLKML........ 398
222 0.000e+00UniRef50_A0A257BBM6 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Bacteria TaxID=2 RepID=A0A257BBM6_9BACT  ali  31  93..AGTPTLQARAAILMDAETGQVLYAKNAHQKLPPASLTKIMTAIVVLERCR-----LDDSVKASQRAV----NAQPSSMHLRVGEEVTVRDLLYALMLRSANDAAVALAEHTAGSVEAFAQLMNAKAREIGATNTHFVNPHGL--------------HHPLHCSTAYDLALITRYAMA-HETFREIVKTRSYIVSLNQEDLWMVNKSKFLQ----QYPYAEGVKTGYTNQAGFCFAGAASKEGRRLITVVLNSP---QREADTMALMEHGFNDWERIGV-PAGEVVG---TVQVTNGEPNSVAVRLDKPLVWVVPKAQRTRYHWK--LLAEPLSAPLRAGDPAGWLVMYSDEKPLLKAPVSVAHTV........................................ 422
223 0.000e+00UniRef50_A0A2G6LD75 Serine-type D-Ala-D-Ala carboxypeptidase n=4 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6LD75_9GAMM  ali  35  27......DIQAKAYILIEADSERVLTQYRATERLSPASITKLMTAYVVYKSIASGLLSLDDSTVISAEARAM---TEGSRMFIEQGSRVTIAELLHGLVVQSGNDAAVALAEAVAGSEQAFVELMNQAAAALAMTDSHFKNVTGLTQ--------------EGHYMSAHNIAILARAIIKQFPEHYRLYKEKSFTWNG----IKQANRNTLLK----TDPTVDGLKTGYTEAAGYCLTVSAKRHDMRLISVVLGTKSKAARVRASEKMLDYGFSNYRLQTFYRADQVIT---RINVKNGKQDNIAVASTDDVILPVTAQEATQINARLVVD-ASLAAPLAGGQQVGHFEIRLADQVL--------LTVPAKILSSVEEIGLLQRFWRYISDFFVTLWQFIKQTVSAWF 394
224 0.000e+00UniRef50_A0A1L8QVA9 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Enterococcus aquimarinus TaxID=328396 RepID=A0A1L8QVA9_9ENTE  ali  34  34.TPDDFSIEAKAALAVDMQTGTILYEQQSEERMPVASITKLLSLYLVQQAIANGELRWDDNVTISSDIATLSQNLALSNVILEAGETYTVEELFETAVILSANAATVALAELVAGSEFAFVDLMKEQLTTWGITDFVLVNSTGLNNEDMTTPLYPSSNPTDENEFTAKDIAIITRHLLQDFPETLDYTNKASAVFSKSGGPATMYSTNWLLAGMPYEKAGVDGLKTGTTDLAGPSFVGTIEKDGRRVITVLLNAETSEARFSETSRLMDYAYNQWAYQTILNAGDEIPSVSPVEVLEGKEEAVSVIVNEELTALLPITSEPDFRYTLLFDDSKLKAPIAKNQALGEVQVQLPADSLVYLEESDANTTTFYANNDVERVNFFVRLWRQL................... 430
225 0.000e+00UniRef50_A0A271M8M8 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A271M8M8_9BACI  ali  38  91.AKTPFDLNAKAAILVDAKTGKILYEKNAEQSLPVASMSKMMTQYVVLNQIKEKKLSWDDVYKAQEIDQLLSTKPGLSNIPLYQGEEYTLKELYDSMMIVSANASSRALGEMAGKTDKQFVQMMNEQAKQLKLHNSYFVNTSGLNNEDIHPYEVKGTNPTDENHMSAKDLALLAYHLTKEFPEELAVETTETKPFYITDNVIDMVNTNEMLPGGKYPYEGILGMKTGMNKAAGHGFTGHVKRGDIELISVVIGGPSSKARFMETKKLLDYGFKQWECQSVNPADYT----QQPNVEKGKQETIAIDTTNKSCMMIPKTADQQPKGKLHLNEESMQAPIEKGKKLGTMELTGPTEQYLTPELKKQATINIVAKESVEKENWFILLWKSI................... 480
226 0.000e+00UniRef50_A0A1G4V3T3 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1G4V3T3_9FIRM  ali  35  29......SVSAPSAILMEADSGKILFEKNTHERRPCASITKVMTLLLVFEAMDSGTLHLEDTITASAHAASMGG----SDIWLEEGESMSADDMIKATVVASANDAAVALAETVSGSEDAFVERMNARAKELGMEDTTFKNCNGLD--------------EEGHLTSAFDVALMSRELMK-HEKIYDYTSIWLDYLRGGETQI--VNTNKLLK----TYKGITGLKTGTTDDAGCCMAASAQRDGMTLLSVVLGCDTGKQRFADSAALLDYGFANYSIQEL---KYPAELPETIEVEGGMAKQGAIGCDVTGSIVTEKASADEAVCKID-MPESIEAPVQNGDILGSVVYTCGEEE---------RRFDITAREDVEKATF--------GAIFAHLFNSITSL..... 378
227 0.000e+00UniRef50_R6M388 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=R6M388_9CLOT  ali  31  51...NSLNISSKSAVLIENNNGRILYSKNKDKEMIPASITKIMTLNLIFDALESGKIKLDDEVSTSEYAASMGG----SQVFLEPGEIQTVDTMIKCISISSANDAAVSMAEYIAGSETDFVKMMNEKARKLGMKHSNFKNCNGLDDSIKS-----------GHFSSAYDVALMSRELITKHPQISKYSTAWMDTIRKGEKEFGLTNTNKLI----RTYNGITGLKTGSTSKAKYCLSATAKRNGISLTAVVMAAPDPKKRFSEAASLLDYGFSLCKN---YSEKTSKIIPETLKITGGKKNEIKLKTLEDFKYILVNNESSDKISRKVYLKKTVNAPLKNNEKVGKIVYLLDDK--------KIKEIPIYTSEAIAKSSFFDYLLLLIKKLV............... 413
228 0.000e+00UniRef50_A0A286ECJ3 Penicillin-binding protein 6. Serine peptidase. MEROPS family S11 n=2 Tax=Alysiella TaxID=194195 RepID=A0A286ECJ3_9NEIS  ali  34  59....QPEIAATAYLVKDLQSNQIIAGKNVDNQIEPASLTKLMTAYLAFKALEEGKLKPDQMIKVSDKAWKAEG----SRMFLDTKKSVSVSDLIKGLIVVSGNDAAITLAESIAGDESKFAQLMNDEAKRLGMNKTHFENSTGLPSK--------------NHLTSVNDLVILSAAIIRDYPQYYPIYSIKTFAYNG----ITQTNRNLLL----FRDPSVDGLKTGHTNSAGYNLIASSQRNGRRVVSVVVGTASNEARATESSKLLNYALQGFDTPKMYAANQEISQ---VKLYKGAAKSVPVGFLEDAYMTIPTGQVENIKPILETSQPLL-APIQKGQELGILKFVENGNVL--------AEKKVVALTDVAEAGFFGKLWDGIVLWFNDIF........... 412
229 0.000e+00UniRef50_A0A0L6JN24 Serine-type D-Ala-D-Ala carboxypeptidase n=16 Tax=Clostridiales TaxID=186802 RepID=A0A0L6JN24_9FIRM  ali  32  48..ASIPVVNAHAAIVMDSNSGRILYSKNAEQRKYIASTTKIMTAIVTLE-----NGNLDDIVTISKRAASIKG----SSINLKEGEKLKLKELLYGLMLNSGNDAAIAIAEHIGGDVETFVDMMNKKAKELNLVNTSFKTPHGLDR--------------EGHYSTALELAQMAKYALSK-PEFASICKTISKSITG----RSLYNTNEML----GFYPGADGVKTGYTGQAGRCLVCSATRDGWRLISVVLGCPTRTIRAESSRKILDYSFKNYKLRTLKRVDDEFK---RVPVIKGKEKFVAITSSDEIKYPLTDEEFNNLK-RVEEIPDSIEAPISEGVNIGNISFSLNGKL--------IAQSELKTKHEVLRKGFLDYMCEMLKDWL............... 393
230 0.000e+00UniRef50_A0A1K1KMH9 D-alanyl-D-alanine carboxypeptidase n=22 Tax=Lactobacillus TaxID=1578 RepID=A0A1K1KMH9_9LACO  ali  39  46....DVNLNVKSAIAIDAKTGQVLYAKNANEKRETASMSKLMTLYLVLDAIDNKKLSWDQKISPSAGAVKVSQNTNYSNVPLKADHEYTVRDLYRATVIYSANGAAMALADQIGGTQQKFIDMMRAEAKKMGIKDAEFYTANGLNNGDVEQDKYKGAPDSATNKMSANDVALLSQKLIQDHPEVLKTTSIKEAKFDNGDTKTDMPNWNWMLKGLTKSYSPVDGLKTGTSDTAGANFAATVHKDGHRVITVVMGADQDTARFEETQKLMSYVYNNYTYTNV-KSGLNFKKDSQLPVYHGKDLTIPTKTSKCTHIWLEKGDVDSVTGKVSYKKNGLEAPIKKGQKVGSYKLTVKGQETPFVNGSNGFKTQAVASQADKKANIFVIGWRAVKGLF............... 444
231 0.000e+00UniRef50_F8BUG0 D-alanyl-D-alanine carboxypeptidase DacC n=67 Tax=root TaxID=1 RepID=F8BUG0_OLICO  ali  30  44.....IDTDAPTAILIEAKTGSVLFEKNADELRAPSSMMKLMTAEVIFHALAKGEIKLTDEYRISENAWRRGGAPGGSTMFAAIHSIVSVDDLLHGLAIQSGNDSCIALAEGYAGSESAFVAKMQARAREIGLARSTFGNTNGLP--------------DPDNKMSVRELGHLARHLILTYPDLYKLFGEREFTW----NKIRQQNRNPLLASL----DGADGLKTGYTKEGGFGMVGSAVQNGTRLVVVVNGLSDAADRAAAAKRLLEWGFKNFETRTLFEANQTVGYG---KVFGGDTGRIALHANEPVGVMVQRNGSDKINARIIYKGP-VRAPVQSGDRIGAIKVWRNGNL--------ALEVPLYASESVGTGSLTQRAFDGASELAIGLLRSGIE...... 406
232 0.000e+00UniRef50_A0A1M5YFN2 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1M5YFN2_9FIRM  ali  33  54...SDLNISAPSAILLEKETGRVIYEKNADEKLEPASVTKVMTILLIVEAIEAGKITLDDMVTTSAYAASMGG----SQIFLEEGEQMSVRDMLKSIVVASANDCAVAMAEYLSGSESVFVAKMNERAKQLGMTNTNFTNCTGL-------------LDDTTHVTTARDIATMSRELIK-HDMIKQFTKIWMDSVRNG--EFGLNNTNKLI----YYYPGATGLKTGFTSRSKYCLSATAERDGVEYIAVILHAETSANRFESAKTLLSYAFANYSLISAYPDSALLP----VRVNLGKVPYVQPVIQGIDKILVDKETASTVTKEVQVIDK-VPAPVKAGDKLGALVVKSGDNVLG--------EYPIVAGDSVGKLGWGNIFGQFLQMLFTG............. 407
233 0.000e+00UniRef50_A0A1G6CAD1 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Desulfonatronum thiosulfatophilum TaxID=617002 RepID  ali  28  44.AVPFPSGGAEAYLLMDAHSGRLLVSHNIDALREPASLTKMMTVYVAGRELNAGRLFMSDMVRVGRNAWRMTG----SRMFLDLNSEVSVAALLHGIIVQSGNDASVALAEHIAGSEGEFVKMMNQAALDLGMTSTNFANATGLPAPGV--------------HTTARDLARLSLALMHEHPYLYSLHSVREFE----HNNIKQTNRNRLL----HRDPSVDGIKTGYTRAAGYCQATSAQRGEMRLIAVVLGCDSVAARTRLNQQLLEYGFNRYETHRLYARNEPLG---SVKLWKARQSELSYGIQDDIFITIPKGQIDVLDRRISLLIDPVFGPVLRGQKVGTLQVALGEEVL--------AEQDLLALTEADEAGFFSQMVDTV................... 394
234 0.000e+00UniRef50_A0A1J0KTB2 D-alanyl-D-alanine carboxypeptidase family protein n=1 Tax=Francisella sp. CA97-1460 TaxID=1542390 RepID=A0A1J0KTB2_9GAMM  ali  29  50..PVGIELDVPAWVAMNYRTGEIVSEKNMDVKREPASLTKIMTAYIVASELKAGNIHMEDMVTISRDAHNTGG----SKMFVREGDRISVGNLLTGMIVDSGNDAAIALAEYIGGTPDNFTTIMNQTAQAIGMTNTHFANPDGLP--------------GGEQSTTAHDMALLARSFIYNFPDIYKIYAQKSFTWEG----IKQNNRNRLL----YTFDGADGMKTGHTDAAGYCLVSSAQQDGERYIAVVLGASSEATREQESSKLLRYALTKFQNVLLYKANSPVSISADA-ISGAKKQTLTVASSQNIYKTVPKTYVSYLRQGVEL-SPNLKAPIKKGDTVGNLVITVNN------GEEKIASIPVVAKNDISTGGWW.......................... 395
235 0.000e+00UniRef50_Q2RJL7 Serine-type D-Ala-D-Ala carboxypeptidase n=9 Tax=Moorella TaxID=44260 RepID=Q2RJL7_MOOTA  ali  30  25KAADELQITAPAAVLMEASTGQVLYERGAREKRPPASTTKIMTAILALEL-----GRLDTPIKVSENAATTPGA----SIYLQKGEVLTLGDLVKGALLESGNDATVAIAEGLAGSEAGFAFLMNRKAWLLGARTTHFNNPNGLP--------------DPGHYTSAYDLALIARYALGN-PVFRRLVATVEDQIPGPDGVRHLYNTNRLLE----SYPGADGVKTGTTAAAGQCLVASATRGGRQLIAVVLGSAD---RYGDTRTLLDYGFKNF-YCEMVKAGEPLGQ---VYIPNGEMTSIGVAPAMDAGFTAPLARSGQLEKKV-LLPRAARAPVRKGQELGRVQILFAGR--------EVAAAPLVATGDVRAIPWWSRLISLGSNIFH.............. 373
236 0.000e+00UniRef50_K2LKR6 Serine-type D-Ala-D-Ala carboxypeptidase n=13 Tax=root TaxID=1 RepID=K2LKR6_9RHIZ  ali  26  26.SAQLFETRAKQAFMIDAETGTVLFSKEADARIPPASLAKLMTMEVVFNAIKSGRLTLNDAFYVSEHAWRTGGAISGSTMFAEIKSSVPLEALIQAVIVQSANDGCIIIAEGMAGSEENFARLMTERARTIGLTDSVFVNATGLPA--------------EGQHVTMRDLVRLSAHIWREYPEFYKYYAQEAFTW----NKILQRNRNPLLRMDI----GAEGMKTGFTEETGYAIVGAVHRGDRRLFVAMSGLSSESERAEEARKMLDWGIRAFERTEIFAAGETIG---RVSVFGGEQPDLALRAEGPIAIFKPITEADRLVARIVYQGP-VPAPVAAGTRIGTLKVWIGDTL--------SQETPLYAAEDVAVGTLSDRAMDAVGELLVGWLRKYRS...... 392
237 0.000e+00UniRef50_A0A2N2E2S4 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Firmicutes bacterium HGW-Firmicutes-12 TaxID=2013773 RepID=A0A2N2E2S4_9FIRM  ali  35  43..AVELPLKASSAILLDAQSGKILYEKDAHKVSYPASMTKIMTLILAAEAIEQGKIKLTDVVTASEKASSYGG----SQIFLAAGEKLTLKELLLGIALASGNDASVAVAEYIAGTHEAFVDMMNEKAAELGLKNTHFVNCNGL--------------HDPEHYSTAYDFAQLGLLALK-YPLIRELSTVKHYRIRETSRPFQYDNKNKLL----WTYEGADGFKTGWTVDAKYCLTATCERDGLRFVSVVTGVPIKSGHFADAKVLFDWGYSQFTFKKFYEAADVIG---SVEVGKGVVDTVEVVPENKVGITVLKGEDKDLRAEVE-IEPVVDSPVHKGQVVGHVSIMRGEEVL--------NRMNLVTKESVEKGSWWREFKKVLK.................. 395
238 0.000e+00UniRef50_A0A2W5I6V3 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Azospirillum brasilense TaxID=192 RepID=A0A2W5I6V3_AZOBR  ali  31  57...SQLETAASHMMLIDYNSGTVLAEKASGAKMYPSSMTKMMTLYIIFDRLKQGSVALDSQFTVSENAWRMQG----SKMFVPLHGQIPLSELIMGISVQSGNDACVTAAEGLAGSEEAFAQIMNDTAKKLGMKDSHFVDSSGWPHVD--------------HYTTAHDLALLGVALVRDFPEFYHYFSEPEFTYNG----IRQYNRNLLLNDKPL---GVDGLKTGHTEAAGYGITLSAKETGRRLILVINGLDSEAARAEEGKKLLTWGFRNFEEVALATPSKPVAQ---AKVYMGEAQSVGLAVKEPVILSIGRMGKEKISMTANYTGP-LSAPVEKGAEVGTLKITLPN--------GATKEVPLVATESVARLGLFGRMGRYLG.................. 407
239 0.000e+00UniRef50_A0A2D4VVQ3 D-alanyl-D-alanine carboxypeptidase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D4VVQ3_9PROT  ali  27  37..AAEITSSAAFAYVTDFGSGKVLMEKSPDASMKPASMAKIMTVYIAFQRIADGSLSMDDTFLISEKAWKKGG----SKTFVEVGKQVSVRDLLYGVIVQSGNDAAIAIAEGISGTEEGFAEEMNYVARALGMSNTVFKNSTGWP--------------DPDQHTTARDLNILATALIRNHPDLYPIFAEKNFTFNG----IKQGNRNPLVYGT----QGADGLKTGHTEESGYGLVGSATREGQRVIMVLNGMESMKQRSSESRRLMDLMFREFKLYKFFDAGEAVDH---ANVWLGNAGKVGMVLEEPLHSVMARSDRRKMTMTVQWNDP-VPAPIKAGQTIGTLVVKVPGDT---------KTYDLLAAEDVSALGIFDRVGEALKFLIFG............. 394
240 0.000e+00UniRef50_A0A1F8UW82 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1F8UW82_9FIRM  ali  36  41EAEQAVSLSVKSAFLMEASTGKVLYSLNENDRLPIASVTKIMSTILVMEAIDSGKIKLEDMVTVSEHAASMGG----SQVFLEAGEQMSVHEMLKALVVVSANDATLALAEHIYGSEESFIMEMNKRAKDLGMENTNFINTNGLPI--------------ENHYSSAEDVALMTQELLK-YPLIFEYTTIWMDTIRNGT--FGLANTNKL----VRFYNGANGMKTGFTNEAMFCLSGTAKRDGMQLISVVLGADTSDARFSTVKKMLDFGFANYSIVTPEK-----LTLEPISIIKGVKETADIDYT-PSSILLEKGKKSSITQTAHIDQPP-EAPVKKGDTVGYISYEVDET--------EITRVPVYITEDVDKISYFVILGRIIKNIFSFF............ 399
241 0.000e+00UniRef50_E7FTI6 Serine-type D-Ala-D-Ala carboxypeptidase n=28 Tax=Lactobacillus TaxID=1578 RepID=E7FTI6_9LACO  ali  39  44QTDSNLNLDVKAAIAVDAKTGQILYAKNAEQALPVASMSKLMTVYLVLQAIKNGKLSWNQEILPDAASQKVSQDTQLSNVPLKADHKYTVKALYQATLIYSANGAAMALANAVGGTHKNFIDMMRKEARKMGINDAEIYTANGLTNDEVFDAKYPGASDNAENKFSAKDMAIISQRLIEDYPEVLETTKITRMKFNNGTDETTMENWNWMLPGLAKAYSPVDGLKTGTSDSAGACFTGTVNKDGHRLITVVLGAKHDSQRFVETQKLMSYCYNNYSYETI-KAGKAFKNAASLPVYHGKDLKVAVSSKNGTDVWLKSSSSANLVAKLSYKDGGLVAPLKKGQTVGELSVKVKGQDLYYLDGATSIKLKAKTDKAVDKANVFVIAWRAIKGVFN.............. 447
242 0.000e+00UniRef50_R7MF81 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=environmental samples TaxID=2231195 RepID=R7MF81_9CLOT  ali  33  24...SGIDIKSESGIIMEASTGKILFDKNMDEQKSPASMTKIMTMLLTVEAIESGKISLDDEVNISANASKMGG----SQVYLEENSTATVEMLLKSIAIGSANDASVAVAEKIGGTESNFVNMMNKRAKELGAVNTTFKNPHGLD--------------EEGHLTTAHDLALIARELIK-HKEILKLTSTYETTITHKNGKLWLVNTNKLIK----FYNGLDGLKTGFTDNAGYCLTGTMLRNDMRLITVTMKAPTKEDRNTDTINLMEYAYSMYYKSTLIKKDKKIGDMF---IDNAKKRKISYYLKEDASVILDKDVR-NIKYNYSVKLNNVKAPLKKNDVVGTLTLHLNNQDIN---------YNLIVKENIKKSNYFVRLNNYLKDIING............. 379
243 0.000e+00UniRef50_A0A173RDN0 D-alanyl-D-alanine carboxypeptidase dacB n=6 Tax=Clostridiales TaxID=186802 RepID=A0A173RDN0_EUBRA  ali  29  52.AAPVLTLTASSALLMDAATGTVLFEQNAAKERPIASVTKIMTLLLIFQALHNQTIQLEDLIPVSAHAASMGG----SQVYLEEGETQTVETLIKCIVVASANDACVAMAEQLAGSEEAFVQQMNETAASLGMLHTHFANCCGLDT--------------EGHYSTAYDIALMSRELTVNYPEIFDYTSIWMEDITHGDTSFTLNNTNHLIK----QYPYATGLKTGFTSTAGFCLSATASKDGMDFIAVVLNAPSSKERMADIETLFEWGFANCQVYT----DENLDSLPKLPVSRGRHSQLSLKYESAFYHLDTTNAAGELAKKIEL-PDSVEAPIKKGDIIGKAVYTLNDNTVGSVNLLASESIPLITLKD................................. 401
244 0.000e+00UniRef50_R6DQG8 D-alanyl-D-alanine carboxypeptidase (Penicilin binding protein) n=2 Tax=Firmicutes TaxID=1239 RepID=R6DQG8_9CLOT  ali  38  58.......TDGKSAILIEEATGKVLYEKKSHDRYAPASMTKIMSMILIMEQIEKGKLKWNDTLVTSEYAASMGG----SQIFLQPNEKMSVKDLFKAVAVGSANDATIVFAEKIGGTEKRFVKMMNEKAKKLGLKDTNFKNAVGLD--------------EANHYSSAYDMAFMARELIK-HEKVFSFTTIYEDYLRDTDNKFWLVNTNKLIK----TYDGADGLKTGYTKEAGYCLTATAKRDRMRLIGTIMGASESKTRNSNMMKLLDYGFNSYEMQVEVKKGEVVSEK---NMSKAENKRIEIVPKKDASVLVEKGEKDALNYEMRLNK--IKLPVKKGEKVGVLKLKDGSKI--------INEVDLTVKEDANKANILELYKRSIISILSG............. 410
245 0.000e+00UniRef50_A0A2A5GFR6 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2A5GFR6_9RHIZ  ali  28  28..AQNYQSRAKQAILIDVETGSILFSKDANVAAPPASLTKIMTAAIVFDAIKNGEITLETEYKVSEYAWRTGGAPAGSTMFAALGSEISVENLLRGLIVQSGNDSAIILAEGMNGSVEKFAERMNNFGKKLGLTDFNFVNPNGLP--------------HPDHRISASDLAAIANYIITKHADMYPMFAERSFKW----NNIRQSNRNPLLSAPI----GADGLKTGHSQEAGYGLIGSAVQNGTRLIAVLMGMKRETDRTVDGRRLLEWGFASFIPTDIISANTHVG---SVRLYGADQGRLNVKIGEALTALVPKQSRDSMEGRIVYKGP-IPAPIKEGEIVAELHVYSG--------IRLVVTAPLYAEESIAVGSAASRAISGLGEFFFGWL........... 388
246 0.000e+00UniRef50_R6D083 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Firmicutes bacterium CAG:176 TaxID=1263007 RepID=R6D083_9FIRM  ali  29  24..AVDLPLTSRAAVLMEKTTGQMLFAQNEHEKLEPASVTKIMTLLLTMDAIDSGALAYDDVVTVSANAAGMGG----SQVFLAEGEQITVEELLKCVCVSSGNDAAVALAEKVAGVTELFVEQMNNRARGLGMDDTHFANPTGLTA--------------AGHVTSAYDIALMSRELLTKHPDIRNFTTIWTDSIRNGT--FDLANTNKLI----RWYDGATGLKTGYTASAGYCISATAEREGMELIAVVMKGETSDKRNTDAKALLNYGFSAYTLVSAAPE----EPLPALPVTMGEAEQVSLTLPETVTAVVEKAQASSLEYRVDL-PETLAAPIQQGQQVGTLTLCSGDT--------EVLAVPILAAESVPGRSWGRMFTDLLKQ................. 375
247 0.000e+00UniRef50_A0A2E1MB59 D-alanyl-D-alanine carboxypeptidase n=5 Tax=Pelagibacteraceae TaxID=1655514 RepID=A0A2E1MB59_9PROT  ali  29  21...SAPEIKVKTGILVDYHSGKILYELEPDMSIYPASMTKIMTSIIAFDLLKNGKIKLDDEVVVSENAWRMSKSGYSSQ-FIMLNDKVSIEDLLRGIIVVSGNDSCIALAEGIAGTESNFVDMMNEKADEIGLTNTNFTNSSGIN--------------DPDNYSTVRDIAIMSKYLIENYPKYYEYFKETEFTWRTGGDPITQGNRNPLLYKNF----GADGIKTGYLAVEKYSLASSVVGEKRRLISVGSGFTTKQSRSTESIKLISWGLRNTNTYEISDKNIPKFEFKT---WLGKKDYVKGKTKENVYITLNKKKVRKFNVFIKYNGP-IKAPIKKDDEIGNIIVQIGDQEEKI--------IPVYASEDVKKLNFFKSLFMSFNYMIWG............. 381
248 0.000e+00UniRef50_D4Z1L1 D-alanyl-D-alanine carboxypeptidase n=101 Tax=root TaxID=1 RepID=D4Z1L1_SPHJU  ali  29  21.AAPPYSSEAPIAYMKDLSSGAVLYNKGGDTRIPPASMAKMMTAHVAFRLIQKGDLKLEQKFTVRPETWQQWGPQAGSTMFLSPGEQVSVENLLHGIVTLSGNDACVVLAEGIAGTEQAFVALMNQEAKRLGLKNSNFGTSNGWPDEGVTYVTAADLAALAE-------------ATIEETPNLYKFYATRSFTWGKTGADIEQGNRNPIL----GKVAGADGLKTGHTQEAGFGFTGSAEQEGRRLVMVVAGLTSFNQRIAESVRFMDWGFRAWKAQPLFKKGQTV---ETAEVQLGSATSVPLVAPQDMAVTLPRAASSNISVKVAYTGP-IKAPIAKGQRIAQLIVSTPDTPPQIL--------PLVAGEDVSEAGIFGRLWNGLKSFFG.............. 387
249 0.000e+00UniRef50_A0A101FRQ3 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Clostridia bacterium 62_21 TaxID=1635276 RepID=A0A101FRQ3_9FIRM  ali  29  26...PPPQVVAGAAILMEADTGQVLYAKNPDARMYPASTTKILTALIALERCD-----LDEEVRVPP---GFTGI-DGSAVYLREGEVFTVRDLLYALLVHSANDAAVVLAEHVAGSVDAFARLMNKKAASTGARHSHFVNPNGLP--------------DENHYTTARDLALIARAAMRQ-PTFREIVATKSYVLPEREDPRHLWNTNKLL----WRYEGANGIKTGYTTQAQQCLVASARREGRELIAVVLGSVGNNV-WTDATALLDYGFDGFTRSQIVGANRSVA---SVKVAYGARD-VALVTASPFVWSFPTGESPAVRWDVRL-PRPVTAPVQKGQELGSLVLYSGARRLGA--------VPLLAADDVPR.............................. 361
250 0.000e+00UniRef50_A0A074LUR9 Uncharacterized protein n=5 Tax=Alicyclobacillaceae TaxID=186823 RepID=A0A074LUR9_9BACL  ali  31  47..AEDVSVSARSAAVIDVQTGRLLYEKNGDDKMLIASLTKIITCIV---AIESG-VDLDSQTTVSNRAAGKEG----SSIYLKVGEKQTIRDLLYAVMLRSGNDAATAVAEACGGSEAKFVEMMNAKVQDLGLTGTHFANPHGLDAKD--------------HFSTAHDMAVLTAYALRN-PTFAQIVSTKTIPYPGENYNRKLYNKNKMLT----RYQGADGVKTGYTKAAGRCLVSSATVDGRQVAVVTLDAPSD---WVDHEHLLDYGFETYQNFPVAKENQVVK---TLPIEDGVESQVDVQAGDEFNYPVRKNEQDKLRTETKLD-DHLEAPVKAGQKVGEMKVYYEDKLLG--------TVPLVVAKDVREKSFWER----FKSFFSGLITSGR....... 401
251 0.000e+00UniRef50_Q3AAQ3 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=Q3AAQ3_CARHZ  ali  36  25....PLEINARAAILMEPYTGKILYEKEIHKKLPIASVTKLMTLLLAIEAVEKGKVNLEDIVKVSEEAASMGG----SQLYMYAGEEFSFKDLLMAVAVASANDACVAVAETVAGNEQAFVEEMNKKAEELGMTNTHFVNSYGFD--------------DPNHYSTCYDLAILLREAIK-HPLFLELSQIKEFTLRGGETRRF--NTNKLL----WYYRGVDAGKTGWTEEAGYCLASTASRDDLRLIAVVLGCPVKKGHFTESIKLYNYGYANFKAYPILAEKFSVKVKVVKG----EKEQILVGPGAPVLLVEEKGKKINPRYELKL-PEKITAPVKNGQVMGEVVIYDGTKIIG--------RAPLKSLEDCLKA----RLDFAIGRFLKSLL........... 374
252 0.000e+00UniRef50_A0A259UYR0 D-alanyl-D-alanine carboxypeptidase DacB n=13 Tax=Sporomusaceae TaxID=1843490 RepID=A0A259UYR0_9FIRM  ali  29  29.....PELTAKAAIVMEASTGKVLYSRNANERRYPASTTKVITLITALEY-----GNLDDNVTASPNAATTEG----SSLWLSPGEQLKLRDMLYGIMLVSGNDATVAVAEHISGSVEGFAKLMTEKAHALGAVNSNFVNTSGLP--------------DERHYTTAYDLAKITAYGYKN-PLFTQIVSTKQKPWPGKDHDRDLYNENRML----WLYDGANGVKTGYTDAAGRCLVSAANRNGIQIVAIVL---DSERMWDDSIKLLDYGFAQLKQVPVITKGDILK---TVKIKEGKASNIKLLAANDIILPIADNEHDKFT-TVVEAPAKITAPIAVGQKLGTVKIMYNN--------VEVANTDLIADQPVEKKSFFTIFWGSLVSFVTFVFHNFA....... 382
253 0.000e+00UniRef50_A0A0P7WIE9 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=35 Tax=Bacteria TaxID=2 RepID=A0A0P7WIE9_9RHOB  ali  30  24..AQSFDTRAGAAYVYDQTTGTVLLAKNADEPLPPASMSKLMTLYMAFEAIADGRLDIDERLPVSEHAMSFGG----STMFLDTTDRVRVEDLLRGIVVLSGNDACVVIAEALSGTEAGFARMMTERGRDLGLTQSTFVNSSGWPA--------------AGHRMSMRDLGILADRLITDYPTFYPLFAEETFEFDNRAPQ-NVSNRNPLLGLGI----GADGLKTGHTQEAGYGLVGSAKQGDRRIVFVITGLDSQQARAEEAERIVNWAFRQFTEVDILRAGTRIADAE---VWMGEAPLVDLVAAEDLSLLVPVLDAGSLQAEVVYDGP-IEAPIADGDRIADLVIRLDDLP--------ETRVPLVAGSAVPRGGFQARLTVAADVLLGKW............ 383
254 0.000e+00UniRef50_A0A1E8GID4 Uncharacterized protein n=1 Tax=Floricoccus penangensis TaxID=1859475 RepID=A0A1E8GID4_9LACT  ali  37  28......NLDAKAGIAIDINSGKILYEKNSKQKLPVASVTKILSMYIVLEEINSGKLKWEDEVVISKNAYDLTLNENASNIYLDEGGKYTVRELFDAAMIQSANSATIALAEKISGSEQKFVEKMRKTAKSFGVKDAKIVNSTGLNSEVLEEDSDSKNKKIDDNEFSARDVALISYYTLTRYPEILEVTKKTTETFKGGSNEQELHTYNEMLEGMEYERRGVDGLKTGTTDSAGQCFVGTTYQDNYRIITVVLNASNPNARFDATNKLMDYVYGNWQAKEIVKKGQSIKGFKTIDVSNGKKDKVNVVAADDTRIVMPKKMAVK-DLQINYLGSSVQAPIKRNQKLTSLIIKENDK-LGYLIDSSGQAVDMVAKESVKARG............................ 403
255 0.000e+00UniRef50_A0A2M7CDR7 Serine-type D-Ala-D-Ala carboxypeptidase n=11 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7CDR7_  ali  33  30.TQPNLRIRAQSVILMDAISGQILYEQTPQLKMAPASFVKMLTLYLAFDAIRTGDLKMDDVLTVSEKAWKTGG----SKMFLKVGETVNVEDLLKGIAIVSGNDACVALAEHMAGSEDAFVAKMNEKAKTLGLENTQFQNSHGMPARD--------------QYTTALDMAILARRYIEAHPEALSFHSTLSFE----HNGILQGNRNVLL----RRDIGVDGLMTGHVEESGYHLVVTAKRNSWRLIAVIMGSKSLSNRAREAQDLLGFGFKHFSVEEPFKKGSPLG---SIKVVRGKMSQVELIAAEDGRVVVTKGEENSVSVNPEL-PSFIAAPLLKGQRVGKVLIQSGGKALR--------EVDLLSSSDVPK.............................. 367
256 0.000e+00UniRef50_A0A2E6RM38 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E6RM38_9PROT  ali  29  34.ANNQIETLAKYAIVLDYQTNKILLNKNSEELMFPASMSKLMTAYVVFSHLSSNKISLEDTFRVSEKAWKKGG----SKMFVEIGKRVSVEDLLRGMIIQSGNDASIVLAEGLFGSEELFSMEMNRFARTLGMNNTNFRNSTGWP--------------DPEHVTTAKDLSLLAISLYKNFPEFMKYYSEKNFTY----NDIKQGNRNPLLYKNL----GSDGLKTGHTEESGYGLVGSALRNGRRVIIVVNGLKSSKDRSNEAERLIDWSFREFKNYELFDKNDIVFD---IPVWLGNKETVPLVLNKKLLLTLNNKQYRNLKLKINYKGP-IKAPIKKDTKLATLKIYLD--------KGEVIEKPLYSNVSIEQLTFIGKLKTKLEYLLFG............. 388
257 0.000e+00UniRef50_A0A1W1VQL6 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Desulfonispora thiosulfatigenes TaxID=83661 RepID=A0  ali  32  26..ANDLKLESPSVILIDAESGKILYEKDPHVERAPASVTKLMTLLVAIEAIKDGRGNFEDVVVASEHASQYGG----SQIYLEPGEEMKLKELLISIAVGSANDSCVAVAEHLYGSEESFIKAMNEKAKELGLKHTQFQNTNGL--------------KAEGHYTSAYDMAMIAKEGLK-HKELLQLTSIKHYKLRNTEKPFQLDSTNKLL----WWYKGADGFKTGWIEESGFCLASTAKRDSLRLISVVLGAQERRGNFRDAMTLFNYGFAGYKYQEFMKKGQEVGQ---INVDKGEQDFVTAVTKDNVGTIIAKGKDKNITKEIKLMS-SIKAPVKKGDKVGTVTILKSNT--------RICEYDLVAKENVKRGTIWRQF....................... 374
258 0.000e+00UniRef50_A0A2S7JYN5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Parvularculaceae TaxID=255474 RepID=A0A2S7JYN5_9PROT  ali  28  20.AQQPITTPADYAVIMDYRTGEILYEKNARTPTAPASMSKLMTVAIVFERLKNGSLQLTDEFDVSEKAWR---EREGSSMWVRVGDKISVLNLLRGIIVQSGNDACIVVAENISGSEEAFVELMNRKAHEWGLNDSTFGNPHGKPA--------------PDQKMSMRDLALLTRKIISDYSEYYALFAEREFTW----EKIRQANRNPILDM----VEGADGLKTGHTEESGYGLVGSAVQNGERRIVVVNGLSSERERATESARLMRIAFNDFSTKTFFEPGDIVGAAE---VFKGKDAHVPLIAREPVKLIMHRSLMDEAKATIVYQGP-VAAPVKENQQIGFLRV--------ETPSGPAREYALYAGQPVKETGIWGKIGLAAKKLLA.............. 374
259 0.000e+00UniRef50_A0A1F3A987 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 TaxID=1797225 RepID=A0A1F3A9  ali  29  12.........ARQAFMVDPQTSTVMLFKDAEQSMAPSSMSKMMTIYIIFEELAAGRLKLDSRFRVSERARAMGG----SRMFVELGSEVTVEDLIKGIIVLSGNDACVVVAEGLSGSEESFAERMTKRGRELGMTKTVFKNSSGWPA--------------EGQYTTARDLAVLAWRTIDDYPKLYRYYSETDWTY----NNIRQANRNRLLKIT----PGTDGLKTGHTEEGGYGQTTSALRDGRRLILVVNGLTSMAERAQETSRLMEWGFREFANTTIFRAGDTV---VEAPVWLGAQDKVPLVVARPIQITAPTGQAVSPRVVARFEGP-LAAPLAKGAKVGTVAVTIPD--------GRVIEYPLEVGMDVARMGVIGRVTAMIQHYLFGWLS.......... 361
260 0.000e+00UniRef50_R5MS93 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R5MS93_9MOLU  ali  31  19..AIDLASNAKSAIIIEPTTGKIIFEKNSNERLEPASMTKIMTLLLTFEAIDNGRVSLDDMVNISKRAEDMGG----SQMFLEAGSNIRLEEIIKGVSIASANDGAIALAEFIGGSVENFVDMMNKKVEDLGLSNTHFANPHGLHA--------------DNHYSSAYDMAIMASNLIS-HEKVLNYTSIYEDYFNKPDGSRTLVNTNKL----VRFLEGVDGLKTGYTSEAGYCLTATAKKGNVRYITVVMGEPSSDIRSSETANMLNYAFNSFKLNTILDKSQELG---TIYIDKSKQKTAKIVVKNPVTELISK-EKDIPNYTYNLKVEKITVPIKAGTKVGTVEILDNEGLI-------VREEDVTISYDIEKCNLWETFLENLM.................. 372
261 0.000e+00UniRef50_A0A151AX11 D-alanyl-D-alanine carboxypeptidase DacF n=8 Tax=Moorella TaxID=44260 RepID=A0A151AX11_9THEO  ali  30  23EAAGGPYLTAPAAILMEAGTGQVLYEHGAREERPPASTTKIMTAILALEL-----GRLDTPVKVSKYAATTPGA----SIYLTTGEVVKLGDLVKGALLNSGNDATVAIAENLAGTEEEFAWLMNRKARQLGANHTHFKNPHGLP--------------DPGHYTTAYDLALMARYALGN-PVFRRLVATQEDQIPAPDGVRYLYNTNRLL----GSYPGADGVKTGTTNAAGQCLVASATREGRQLIAVVLGSSD---RYADARALLDYGFNGFYTET-ARAGEPAG---RVYVKNGEVISVPVAPVVTAGFTVSMDQAAFLEKRV-LLPAVVKAPISKGQELGQVKILYQGR--------EVASSTLVATRDVAALPWWSRFKK..................... 364
262 0.000e+00UniRef50_R5LJ06 D-alanyl-D-alanine carboxypeptidase (Penicilin binding protein) n=4 Tax=Terrabacteria group TaxID=1783272 RepID=R5LJ06_9MOLU  ali  33  29....EPIVNAKAGLLIEANTGKIIYEKNKNEKLAVASMTKMVAQIIILEQVESGKIKWSDVVTVSKNAADMGG----SQIYISEGEKITVEDLMKGISMASGNDATVAMAEVIAGSEEKFVKLMNKKVKELGLKNTVFKNCTGLD--------------EEGHYSSAYDMAMIARELVINHPEILRFSSMYEDYLRNTDNKFWLVNTNKL----VRFYEGADGLKTGHTDNAGYCLAATAKKNNMRLIAIVLGEDNSKTRNSEAMALLDYGFLHTKFNLLKEKGTIIK---KVKLDKSNREKVDIILKDDLGVVELVDDSKH-KYDYNIKIDDIKLPISSGDVVGKIEVVSKNKT--------IVTGDLIINKDAKKLSIWELFYNSFRGICSG............. 385
263 0.000e+00UniRef50_R7HG48 Serine-type D-Ala-D-Ala carboxypeptidase n=1 Tax=Mycoplasma sp. CAG:472 TaxID=1262904 RepID=R7HG48_9MOLU  ali  35  21.SAVEMEISAKSAILVDFNTGKVLYSKNENEPLAMASMTKVMSMLLIMEKIDDGSLKYDDIVEISTESSSMGG----SQIFLNPGDKYKVIDLLKGVAMASANDAVVALAEKTYGSKEHFIEAMNKKAESLGLKNTHFVNVHGLD--------------EEGHYSSAYDMSVMARELLK-HEKILDFTRVYEYLTKPDGSQIWLVNTNKL----VRFYDGVDGLKTGFTQKAGYCLTATGKKNNLRLISVVMGEESIEKRSSDTVKLLNYGFNTFKVNLIKNKSEILG---KVNVQKGKKENVDVVLVNDLIELLNASDKPS-NYKFKILVDKITAPVKKGDVIGKVKVLNDNDIL-------ISQVDITVNENVLKANLWDLFKRNLKY................. 376
264 0.000e+00UniRef50_A0A174AHA4 D-alanyl-D-alanine carboxypeptidase dacC n=36 Tax=root TaxID=1 RepID=A0A174AHA4_9FIRM  ali  33  59...EGLSLTCRAAVLVEPESGRVLYEKNPDERVPIASITKLMTLLLTFEAIHGGKLTLDTLVPVSEHAYHMGG----SQIWLEPGEQFTLDEMLRAICVSSANDAAVAVAELVGGSEPVFVEQMNARAAELGMTNTSFRNACGLDT--------------EEHLSTARDVATLSCYILNTCPELLHYTGIWTDSLRNG--QTQLVNTNKLLK----RYSGITGLKTGTTSGAGVCISASATRDGLTLIAVILGSPSSADRFNAATTLLDYGFAHYAAVPVP---QLPDRPLELAVKRSAEQTVPLYSALPSSVLLEKGAGAGLRAELTL-PEALEAPVQRGQSVGKVEIYAGDTLLSEAEVTAAADAPVLT.................................... 399
265 0.000e+00UniRef50_UPI00047844AE D-alanyl-D-alanine carboxypeptidase n=1 Tax=Methylopila sp. M107 TaxID=1101190 RepID=UPI00047844AE  ali  30  39EAKPSAPTEAPFAFLYDVTSDATLYAAKADMPTPPASMATLMTLELVFKALKEGRLTRDQTFRVTEDAWRRGGASRSSTMFAKLNSEVAISDLLRGVIVQSGTDAAITLATGLAGSEQAFVGLMNQRAKELGLSYSVFRNATG--------------QPDPEQKMTARDVAKLATHIVDAYPDYYRIFAEPEFTW----GKITQRNRNPLLAD----YAGADGLKTGFTDDSGYGLVGSVMRDGRRLIIVVNGLETAKSRAEEARKLLDWGFNAFEQRRLFEGDDPVA---EARVFGGAAMHVALVAQKPVDLLAPKGDDARVVARVSYDGP-IAAPVAKGQRVGTLKVWRG--------QMLTIETPVYANADVPVGDLSRRALDGALELVSGWVGQVAEKI.... 408
266 0.000e+00UniRef50_A0A2S6S0Z1 D-alanyl-D-alanine carboxypeptidase DacC n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6S0Z1_9PROT  ali  31  18....ALETNAKQALLFDQETKTVIFEKNADDLMSPSSMSKIMTIYLLFKKIKEGDVKLDDKFKVSKKAWKKGG----SRMFLNLNSLVTVEDLIRGIIVQSGNDACITLAEGISGSEEEFVNEMNLLAEEIGLNDSTFKNSTGWP--------------DPDHLMTTRDLLILAERTIEDFPEYYHYYAEREFEY----NKIKQSNRNPLI----FSDLNGDGLKTGHTSLGGYGLVASVEKKNRRLILILNGLNSNKQRRKESERLIKLGFNQFKNINVINMNTVIDD---IPVWGGKEKIIGIYSKEKINITVPKRLKKNLKYSIKYKTP-IIAPIKKDQKVAEFIIKKKNNEIL-------KKYDLFSDKEVPKLNFFGKVFQNLKYLIFG............. 370
267 0.000e+00UniRef50_A0A143ZPN2 D-alanyl-D-alanine carboxypeptidase DacF n=9 Tax=Firmicutes TaxID=1239 RepID=A0A143ZPN2_9FIRM  ali  29  43.SEQPVEIHAKSAVLMEVSTGKVLYEMNSHEKRAPASITKVMTALLTMEAVESGRISLDDMVLVSEHAQSLGG----TTIFLEAGEQMSVNDMLKGMMVNSANDAAVALGEYIAGSEEAFVAMMNQRAQELGMTDTHFVNCHGLDA--------------EGHETTAHDIGIMSVELLR-HEKIMDYTTIWTDSLRDGATG--LANTNRLI----RFYEYATGLKTGTTNNAGRCVSASARKDGLHLVAVVLGGEQKNDQFNGARNLLEWGFANYA---LVEPPVQQELLKPVKVLHGVEAQVELENGSVEKVLLEKGKESQIQCAVDLAED-VEAPVEKGQVLGKIVITADGET--------IAEIPLKAAEGVEKLSFGKAFELLIQEMLR.............. 397
268 0.000e+00UniRef50_Q73IQ6 D-alanyl-D-alanine carboxypeptidase n=37 Tax=Wolbachieae TaxID=952 RepID=Q73IQ6_WOLPM  ali  30  22....QFRTKAKQAVVLDLASDSFIFDHNSDEKMAPSSMSKLMTLYIAFDYLKAGIIHMEDKFRVSRKAWE----RRGSSMFLKEGQSVTVRELLEGITIVSGNDACITLAEGIAGSEENFVAEMNEVAQNLNLNDSHFVNSSGWP--------------DEDHFMNAKDLVMLAKRIFTDFPEYYDLFSEQYLTY----NEIVQKNKNLLL----FHDIGVDGLKTGYTNAGGYGIVASAKRNDRRIFAVVNGLNTEKERIEEAKRLIQYSLNHFNTKKIFVKDSVV---EEVNVLYGKDRKVPITVANDVTITYNRKLHDQIKVRIEY-KDMIPAPIKKGQEVGKVFVEIPG--------IEQQTTPLYAANDVQELNFVEKFFRML................... 367
269 0.000e+00UniRef50_A0A1E3W5H5 Uncharacterized protein n=2 Tax=Methyloceanibacter methanicus TaxID=1774968 RepID=A0A1E3W5H5_9RHIZ  ali  28  30...SEFETKAQNAILMDSGADLVLYEKGADIRIPPASMSKLMTLAVVFRELKSGRIKLDDTFTVSEHAWRTGGAPSGTAMFAPLGSPITVSDLIQGVTVQSANDGASSSPRGSAGPKRASVKMMNDYARQIGLTGSNFVNPTGLPA--------------EGHLMTARDLATLSKHLIETYPEYYPYFAQKEFRYR---DKFTFRNRNPL----VWSDIGVDGLKTGYTNESGYGLVSSAKRGDQRLVLVVTGLENKNDRETESRRMLEWGFKSFRPFRLFDDGQQVS---EALVWGGEKHYVPLVGDGAIDLLLPASATGAVSGEIVYEGP-IKAPIKKGDQIATLKVQSAD-------LAAVNEIPLYAGEDINSSGFAKRGIDSLLVLAFGWL........... 391
270 0.000e+00UniRef50_A0A2E5I9E8 Serine-type D-Ala-D-Ala carboxypeptidase n=6 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E5I9E8_9GAMM  ali  32  45.....PDVDVESFVLVDAKTGSVLVTKNPDKRLEPASLTKIAFLYLVFKSLKNGVINIDDTTVISKKAWRMEG----SRTFIEVNSKVKIKDLVKGVIVQSGNDASIALAEHIAGSEDFFVSMLNKLAVDLNLKNTNFTNVTGLPN--------------PNHYSSARDMAIISAKLIKDFPEYYLGFSERYFTY----NKIRQPNRNRLL----RSYNIVDGIKTGHTNSAGYCLAASAKKEDTRLISVLFGAESSRDRFRYSKTLLRFGFRNFVSKKFYSKNETLVES---RVWKGKRKVLRIGFEEDIYLTLLKNKDYNIKTIIKVIDD-LEAPIKKSQNVGTVEFVNGKEVIAAD--------NIYALEDIQIGGFFRRSYDEIVQFFR.............. 394
271 0.000e+00UniRef50_E6SKP8 Serine-type D-Ala-D-Ala carboxypeptidase n=3 Tax=Firmicutes TaxID=1239 RepID=E6SKP8_THEM7  ali  34  77.SGPGFRTQSAALLVMDAASGRVLWAKNADEPRHPASISKLMTLLLTLEAIQAGQIRLQDQVTVSPRAQGTPG----STAFLEVGERITVEDLIKAVAVASANDACVALAEYISGDVGRFVQRMNRRAQELGLTRTRFVDPHGLTDQ-------------PGNRMSARDIAVLSRYMIQYHPEILRYTSIWEDWLRGTDREFWLTNTNKL----VAWYEGVDGLKTGLTDESGPSVVVTARKGDDRFIVVVLGSPDSNTRWREASRLLDWAFASFDSIPIAQRGQVL---RTVRVAEGRRLEVPVTVEEAFGVTVPHGEGGRVRWTLEVAEP-VPAPVVPGQRVGRIVARDGDKEI................................................... 407
272 0.000e+00UniRef50_UPI000D705A47 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Salinisphaera sp. LB1 TaxID=2183911 RepID=UPI000D705A47  ali  27  62QAADTPSLGAKSYVLMDYRTGRILAAKNKDKELAPASTTKLMTAFVVFRALKRGRITLDTKFRVSKKAWHEGG----SRMFLKVGSHVSVDNLLKGMLVPSGNDAAMTLAEGVSGSEQAFVARMNRDARQLGLHDTHYTDPNGLPRPGL--------------HSSALDLAKLSRAIIRRFPEYARFFAVKSFTW----NNIHQNNYNKLL----WRDPSVDGLKPGYVSAVGYNLAASAKRHGMRLIGVVMGADKPKASAQVTGSLLDYGFHNYATHKMYAAGQSV---FKAPVKHGDQDKVALGLRKTLYVTVPRGQYAQLKASVKL-PGSITAPVKQGQSIGHLVVKLG--------PRVVARAPLVALAGDKRYSFW.......................... 424
273 0.000e+00UniRef50_A0A1H0SXH8 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1H0SXH8_HALAD  ali  35  36........SAKSAILMEKNSGMTLYDKDSNKKLPPASMTKVMTLLLIMEELDKGGIKLDEKVRISEHAASMGG----SQIFLEAGEEMTVEDLLKGIAVASGNDASVAMAERIAGSEKEFVAQMNQKAKDLGLKNTQFQNPTGLPA--------------EGHYSTAHDMAVMARELLL-HDEVTTYTKIYDDYLRGQDNEFWLVNTNKLIKN----YPGMDGLKTGYTSEAKYCLTASAKRDDMHMIAVVMGAENPKMRNSDVTSLLDYGFSQYEGVKLYSKDDTMK---TMKMTRGNPLELNLSPEKDVVVLKKNDKKSKYETELKVVEKS-DLPLEKGAHMGWVIVKNGDQ--------EVAKVRLETVETVDKAGFWQRSWKNLTSF................ 388
274 0.000e+00UniRef50_A0A174GHG0 D-alanyl-D-alanine carboxypeptidase dacC n=31 Tax=Bacteria TaxID=2 RepID=A0A174GHG0_9FIRM  ali  30  51EEVSGPDIDTPSAILMEAVTGQVIYEKDADTVLAPASITKIMTLILIFEAIEDGSINMEDPVTVSEYAASMGG----SQVFLEPGEIQSVRTMIKCIAVASANDACVAMAEHISGAENVFVDKMNEKARELGMSNTHFINCCGLDV--------------DGHTSSARDVAVMSRELINNHPQIKEFSSIWMESIRKGEKDFVLTNTNKLMK----QYAYATGLKTGSTSKAGCCLSGTANKDGIDLIAVVMAAPTSKIRFSDAITLLNYGFSVCSIY----KDEEPLDTESIKISSGRQDKIKITKEKDYSYMINKYNNDDIRRE-CIINDNIKAPLKEGDEVGTIKYYYNE--------AYIGSVKIISCENVDTAGFMDTVKKIFKSLL............... 412
275 0.000e+00UniRef50_UPI00046F4C30 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Atopobacter phocae TaxID=136492 RepID=UPI00046F4C30  ali  36  35EAAEAPIIKAKAALVADETSGQVLLSQNGDERLPIASMTKIITAYLVLDAIHEGTIQWDDVVPISPYAHRLSQNYNLSNVPLSEVESYTVRQLMETVMVYSSNSSAVALAEYLAGTEADFVKKMGALLENWGITDYQLFNASGLTNSLLGEYKVTSLPDDAENEMRARDLALVGKHIIDDYPEILELASLDNVQFRADSTTLTMTSFNHMLPQHEFYYEGVDGLKTGTTEGAGAAFIGTVKRGDTRLISVVIGAKESGLRFSETARLYDYIFEAYEPMRVMKKDALIDN-KTFKIVKGRQSEVKLAYGDAVKLLLPKGENMDVRVKLEMEEDKIVAPIKKGQIIGKAQIRYDNELGYLSEDNGGTTVEIKAAEEVKEANIIARYLHDLWRKFK.............. 439
276 0.000e+00UniRef50_A0A1Z9M9M7 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Pelagibacteraceae TaxID=1655514 RepID=A0A1Z9M9M7_9PROT  ali  32  19.ASANFEIKARTAILQDFLSGEILFEKEPDRSIYPASMTKIMTSIIAFDLIKSGDLTLDEKFIISEKAWRLSTA-GYSSMFVMIGDEVSVEDLLKGIIVASGNDACIALAEGIAGTEEEFAIMMTSKAKEIGMKNTNFSNSSGIN--------------DPENYSTVRDIMIMSNYLIKNHPKYYEWFSEKEFTWRTGGDPITQGNRNPLLYKNM----GADGIKTGYLAVERYSLASSLERKGRRLIAVGSGFETKNQRSRQSAKLLTYGLTNFDLVEISKKDTSFTN---INVWLGKQSTVKVYTKENIYKIIKKGQKKKLKAKVVYSGP-VEAPIKKNQVLAILKIIYD--------QNLIGEYDLLAVNEVKKINIFSRLMKSLNYLIWG............. 381
277 0.000e+00UniRef50_A0A2D7U3E8 Serine-type D-Ala-D-Ala carboxypeptidase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2D7U3E8_9PROT  ali  28  23..PNPPQLSATSYLLLDAKTLKVISEENSNQSTGLASITKIMTAYVVADQINKGFLRNDSLVKISEKCWRTEG----SRMFVKEGTEVTVENLMLGIIVQSGNDASCALAEHIAGSEYDFSILMNEYAKEMQLEETNFMNPTGLP--------------DVNHYSTAKDIAKLSIRLVEDYPDTYKIFSQKEFTY----NDIRQLNRNSLL----WQDDSIDGIKTGHTTSSGYCMVSSAKRGDMRLIAVTLNSSSEKARLRDSRRLLDYGFRYYSTKKILSKYETVS---SVDVWAGSEDVLNLGPSEDVYLTLTKPEFNSLEL-IVSKNLGVKAPIQKGDTLDSLDFVIDNKTLK--------SIDLVAVKKIDSKGFLSSSFEAIGFYIYSFF........... 378
278 0.000e+00UniRef50_A0A1M6WIR4 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Desulfotomaculum aeronauticum TaxID=53343 RepID=A0A1  ali  28  55QQGNGPHLSAAAALVMDADTGQVLYAKNPHQPRPIASTTKIITALVALEC-----GNLTDTAIISKRAAGVEG----SSIYLKAGEKLTLEELIYGALMHSGNDACVAIAEQVAGDEKDFVNLMNYRAYRLGAHNSNFCNTNGLP--------------DDHHLSTAYDLALITRHALKNS-AFRSIVASKTHTIRGPQGKRILSNTNKML----WDYQGADGVKTGTTNAAGKCLVSSATRDGRSLIAVVLHSDD---RYAESIQLLNYGFTHYKHQKVATRGQLFTQ---LPVKDSVKEKVPVTVAADLMVSVPVSPEFILEKDIML-EQGLTAPVHKGQVLGKLQVLVEGEP--------VGEIDLLAQEAIEKLPYHRLLLSKILN................. 401
279 0.000e+00UniRef50_UPI000DE9B76E D-alanyl-D-alanine carboxypeptidase n=1 Tax=Arenicella xantha TaxID=644221 RepID=UPI000DE9B76E  ali  30  38...PAPEFDAKAWVLMEMNSGTVVTGHNADQPMPPASITKLMMNYVVFQRLRDGDISLSSQVPISEDAWRAEG----SRMFADVNTRIELAHLLKSTIIQSGNDAAIALAEYAGGTEYAFAQLMNQAAAELGLQQSHFENSSGLPA--------------EGHAMSAHDIARLAAAIIREFPEFYSWYSEKEYT----HNNITQKNRNRLL----WKDDSVDGLKTGHTEAAGYCLVASAQRGSQRWIAVVLGSESERTREKQVLALLNYGFAAYDAVRVSVSDE---GAVSAKVYGGLADSLEMRAASNIDLVVPKNRQKEVTVALQY-SPYFEAPIIADQSVGLASVQLGGTTL--------AEVPLVAATQVDEAGWWKQLVDSIKL................. 386
280 0.000e+00UniRef50_A0A162T3S9 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Acidibacillus ferrooxidans TaxID=1765683 RepID=A0A162T3S9_9BACL  ali  31  39.TEPMPDLAAKSAVLMDAMTGTVFYAKNEHERLPIASVTKVATMLLVMEAIERKQLHFQDKVRTSDYAASMGG----SQIFLESGETMTVSELMKGIALASGNDAAVAVAEHIAGSEGAFVSLMNQRARQLGLQNTHFVNANGLPAK--------------GHYSSAFDLAVLSRELMA-HESITQYTGRYQDHLRGSGKPFWLVNTNKLI----RFYSGMDGIKTGFTAEAHYCLAASAKRDHFRLIAVILGASTAKERNAEITAMMNYAFSHYGVKMAYKKGQVVTL---VPVSRGELQAVAVTSARPVGVLLNRTTGQEIGTVVSEVHP-LVAPVTRGQIAGTLRVMINQKT--------VLQVPLLAVADVKKVTWFEMLGRTFKHVFS.............. 398
281 0.000e+00UniRef50_A0A1I4Y3I0 Penicillin-binding protein 6. Serine peptidase. MEROPS family S11 n=4 Tax=Comamonadaceae TaxID=80864 RepID=A0A1I4Y3I0_9BURK  ali  30  29..PVPPEIAARSYLLLDVTANQTLAQKDVDLPVEPASLTKLMAAYIVFDAIKARKITLSQTLPVSERASKMPG----SRMFIEPKMQVPVEDLIKGMVVQSGNDATLALAEGVAGSEERFVQMMNDQAKALGMRNTTYKNAGGLSA--------------PGHTTTARDLGILATRLIRDFPEELHFYAIKKYRYPGTPSTND-TNRNALL----FRDPTVDGLMTGHTDAGGYGMVATARRDGRRLLSVVLGTNGETARANETQKLLNWGYTAYDAVRLFDAGQPVA---TPRVWKGTTNELKLGRVEPIVVAVPSGTASKVATQVA-RPDPLVAPFTRNQGVGSLKVLLGDQV--------VTELPLVALAPVEQAGVLGRTWDSVRLWIK.............. 390
282 0.000e+00UniRef50_A0A0B5QL15 D-alanyl-D-alanine carboxypeptidase DacF n=28 Tax=Clostridiaceae TaxID=31979 RepID=A0A0B5QL15_CLOBE  ali  35  42......NIEARSALLMEPMSGKILYEKNADEKFAPASVTKIMTMLITMEGVDSGKIKLDDKVTCSENAKKMGG----STMLLDTGEIRTVEELLKGVAIASGNDAAVALAEYLGGTEQEFVNMMNKRAQELGMVNTTFKNCNGLPA--------------DGHMSTAKDIAIMSKELLK-HPKVLKYTGTYMDNISGRKSPIELVNHNKL----VRFFEGCDGLKTGFTDEAKYCISATATRNGVRMLSVIMGAPTYKIRNRDAGVLLNYGFSKYEGKKLVSKDEEI---DKVYMDEQTDKFFMAMAKDDLNVILPKGDNKDLEKKIVIDELRKEY--KAGDIVGKCEVYLGSE--------KVGEVDIYCDRDVKKGNIIDNIKYNIKNLF............... 392
283 0.000e+00UniRef50_H1AGX0 Uncharacterized protein n=21 Tax=Firmicutes TaxID=1239 RepID=H1AGX0_9FIRM  ali  34  24...NDVTPNAKSAILIEANSRQILYDKNAEEKLYPASTTKIMTMILMFEALRNKKISFDDEITTSKYAASMGG----SQVYLEVGESLSLKDMFKSIAIASANDASVAVAEHIAGSINKFVEMMNDKAKKLGLKNTHFKNATGL--------------HDPDHYTCAHDLAIMAAYLIEGGEDLFAVTSLYDSYIRDTKQSFWLVNTNKLLKL----YNGVDGLKTGYTKEAGYCLVTTAQRDGQRIIGVLMKETAPKTRNEEMCSLLDYGFNNYKQVTIFKKDTLIEQHL---VDKMDNLTIDVKCKKDIVYTKAKSADAKVSTKVNYKENFL--PVKQGDVIGTLDVIVDGKT--------IATYDVYSDTNASKSTYLSKTIKTLKYLF............... 379
284 0.000e+00UniRef50_A0A1V5X7C3 D-alanyl-D-alanine carboxypeptidase DacF n=1 Tax=Firmicutes bacterium ADurb.Bin193 TaxID=1852885 RepID=A0A1V5X7C3_9FIRM  ali  34  46EAANTLDINAQSAVLMDAGSGDVLYTLNPHDHLQIASVTKVMTLLIIMEALHTQRITLDEIVTASEYACSMGG----SQIYLEPGEQMSVSDMIKAIAVASANDASVAMAEHIMGSAPAFVNAMNTRAKALGMKNTNFVNCNGLDA--------------ENQYSCAYDVALMSRELLK-HDAIKSYLTIWMDTLRNG--EFGLANTNKL----VRFYQGTIGIKTGSTDDAKYCLSAAAERNGLTLIAVVLAAPSSSDRFEGAKKLLDYGFANYSVVSGAEKGTSYG---TIRVSKGEEKEVEAVVGESFNKLIPKDKKGSLEIKPKL-PESVSAPLKAGDKVGELEIFVDGK--------KIGSTNLVAKTAVPRIRLWNMFISIIRMW................ 399
285 0.000e+00UniRef50_A0A101V9F2 Uncharacterized protein n=1 Tax=Desulfitibacter sp. BRH_c19 TaxID=1734395 RepID=A0A101V9F2_9FIRM  ali  33  30......DIQAESAILIDAATGDVLFDLDSETKWYPASMTKLMTLLIALDLVEKGELSLEETVITSDNAASYGGA----QLYLEVGEEFTMEEMLKAVILGSANDASVAVAEHIAGSEEAFADMMNEMAKEIGCTNTHFVNSHGL--------------HDDEHYTTAKDMALIGQYSLR-YPKTLEFTSIQYHEFREDPPTAR-YSLNKLL----WWYPGADGFKTGTTSAAKRNLVATVSRDGLRLIAVVMGVDEVNGHFRESMKLFNYGFSKFIFKKFYAENKVFGQ---ARVGKGATDFVDVITTENVGVTILKGQDEGFSTKISIY-PYLHAPVEKGTVAGELTVIKDGK--------EIKSFELVTASEVPKGTLLQMVTKVFKCVFS.............. 380
286 0.000e+00UniRef50_A0A177W2E8 D-alanyl-D-alanine carboxypeptidase DacC n=70 Tax=Bacteria TaxID=2 RepID=A0A177W2E8_9GAMM  ali  26  136..PPQPQLNAKAYILMDAANGNVLAAYDGNKRMAPASTTKLMLLYIVQQELKSGRIHLDDMVTVPKIAWATGG----SRMFLKPGSQVAVKDLIQGIIVDSGNDAAVTLATYMGGTQSAIVHLMNQALRSLGMHNTHFSDVMGLPA--------------PAHFSTAYDLGKLAYGLINNYPEYYSWFSQKYFRYNG----IRQANFNRLL----FIYPYADGLKTGSTGAAGFSLVSSAKTPGMRLIAVVLGANSDNQVAALSKELLTYGFRFFEGRELYHADTKLSERH---VWLGQSNTLPVGIEKALYVTIPQGADAKLKANMVFD-DALKAPIIKGQKVGELKVTLAGK--------SVADVPVVAMTDIAQGSFFKRLSDHVRLFFDKIF........... 493
287 0.000e+00UniRef50_UPI00037C35AB D-alanyl-D-alanine carboxypeptidase n=1 Tax=Salsuginibacillus kocurii TaxID=427078 RepID=UPI00037C35AB  ali  32  29...........SYILMEKDTGMILNAENEDEQRAPASMTKMMTMLLLMEAIEEEEVSFDDKVTTSEQAASMGG----SQIFLEPGEEMTVRDLLKAIAVASGNDASVAISEHLEGSEEAFVERMNERAEELGMKNTHFKNSNGLPA--------------DGHYSTAKDLAMLASKLL-DHEEITSFTNIYEDYLRGTDDEFWLVNTNRLVK----TYEGMDGLKTGFTRESMYGLTATAKREDMRLIAVVMGAETPNDRNDQITGLLDEGFGAYKVENLFDRGQVITSS---PVEKGMKENIPVRTSDRTSLLLQKDESREGIEEKIQLKTNLEAPIEEGEIIGELRLEREGEVLS--------STELEAAESVESASWLRLFARSLLKL................ 375
288 0.000e+00UniRef50_A0A2V2EBY8 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2EBY8_9FIRM  ali  35  51...PTLNVNVKSAVLMEASTGTILYQTGQDVKYPPASVTKVMTLLLVMEALDKGSISLSDEVTASEHASSMGG----TQIYLEVGETMTVDELIKAVAVPSANDATVALAEFVAGSEEAFVALMNSRAKEIGANNTNFNNCTGL-------------FDDPDHVTTAHDIAIMTKELLK-HEKIFDYTTIWMDTLRGGT--FGLANTNKML----RTYSGMNGMKTGFTKLSGYCFSGTAERDGMTLIATIMGSPTSKDRFDATAAMLDFGFATYSVATASPETQA-----PIPVLKGKKDSVNLEVVGGLSILVKKGQQKGITTEVAL-SDKVTAPVQKGTEIGMLTYMMGGK--------AVASCPIVTAETVEHAGF--------GDYFGWLFDRIM....... 401
289 0.000e+00UniRef50_A0A1Q2D8S3 Uncharacterized protein n=2 Tax=Vagococcus penaei TaxID=633807 RepID=A0A1Q2D8S3_9ENTE  ali  36  24..AEPVTIYAKAAMVTDIETGKILYAKNIDEALGIASMTKLITAYLVYESVANGQINWTDQVKISDSLIKTTENPELSNVPLYKNQTYTVQDLLYASLISSANAATSALAEFISGSEPKFVDQMRAKMTEWGITDSFLISSSGLGTMFLENGKYPGSHDDDENRLSARDMTIVAEHLLADYPDVLAITKLSEYIFNGTKNQTLLTNSNYMLPNMPYYYAGVDGLKTGTTDLAGACFIGTIEKDGRRYISVVMGVDEEHNRFIETQKMLDYVFQTWVYQPVVTQGQS-AVEPTMPVNLGKEATVPLKTDQTVSAWVNTNQAEA-SVDVSFEPKSLNAPVKENKLVGYERIQSADRLGFLHPQQNKVTVPVKTAQSIEKVNFFVEVWHKVRNFFH.............. 419
290 0.000e+00UniRef50_A0A2D8TT74 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Pelagibacteraceae bacterium TaxID=2026775 RepID=A0A2D8TT74_9PROT  ali  29  21..AAYIDTDAEVAVVIDGHTGKVLFSKDKDKKTYPASMTKIMTTLIIFEKLANETLSLDDKFLVSEKAWR---EREGSSMFVEVDKEIRVEDLLRGIIVQSGNDACIVVAENIAGTEESFAKMMTQKAKEIGMKNTNFTNSTGM--------------YDKDNYSTVYDIALLSMHLINEYPQYYHLFAETEFEWSG----IKQNNRNSLLYKNM----GVDGLKTGHLSKSGYGLAASAVDQNRRVISVVNGFESTQKRTQGSSRLITWAFREFTNLKLFEKEDIVGQ---VEISGASSKESDVSTGEEIIITVPKSKRDGLTTNIVVD-DNISAPLNAGDKVGYLEISVPGE--------ENQTYELYATNEIDRSNIFVRFFNYLINLILSLFN.......... 378
291 0.000e+00UniRef50_A0A1C6BR69 D-alanyl-D-alanine carboxypeptidase dacA n=24 Tax=Firmicutes TaxID=1239 RepID=A0A1C6BR69_9FIRM  ali  30  58....SFQSAAPNAILMEASTGTILYEKDADKEKPPASVTKIMTLLLIFDALSKKQITLNDTVTVSEHAASMGG----SQVFLEPGETQTVDTMIKCIAVSSANDACVAMAEHIYGSEDAFVAKMNARAQALGMKHTHFINCCGLDA--------------EGHYTSARDIALMSRELIIKHPDIFHYTTIWMENIKRGESEFGLSNTNKLL----RQYQGATGLKTGSTSKAGFCLSATAERNHISLIAVVMACQSAKERVKDCASLLDYGFSLCKVYT----DKQPPALSPVSIHNGTQEMLSCKYDKNFSYVFTSEINPNKIQKKVIFQKNLSAPIKKNQVIGKLEYSY--------YQKNIGSVSILASHSVKKATYLDYLKKLILS................. 413
292 0.000e+00UniRef50_A0A1M7EP54 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=10 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1M7EP54_9FIRM  ali  33  123QSDIGFTLDSNSVVLMEASTGAILYSKDMDKQVEPASITKIMTMLLIFDAIDSGKIKLEDSVSVSEHAASMGG----SQVYLEPYETQTVNDMIKCISIASANDACVAMAEYVAGSEEEFVNRMNQKAQELGMKNTHFVNSCGLDV--------------ADHYSSALDVALMSRELITKHPEISNYSTVWMDTITHTTKKFGLTNTNKL----VRTYKGITGLKTGSTGKAKYCLSASANRNGMDMIAVVMGNPNPLQRFVEAAKLLDYGFANCS---LFIDDHKELTIEPVKVKKGLEETVEGKPNGEFHYLLTNTNPDEIKKEITMVEE-ITAPIEEGSKLGEIVYTYNGK--------KIGSIDIVAVKQVKEAKFKDYLGKVIQKFFLS............. 487
293 0.000e+00UniRef50_A0A1C6HH50 D-alanyl-D-alanine carboxypeptidase dacC n=21 Tax=Clostridiales TaxID=186802 RepID=A0A1C6HH50_9FIRM  ali  34  54....DLAVAAKSAILLEQSTGTVLYEMDADVQMPPASITKVMTLLLVMEAIDAGKFGYDDQVSASEYACAMGG----SQIWLEPGETMTVDELLKATAISSANDAAAALGEYVAGSPDAFINMMNERAAQLGMKNTHFVNPNGLDA--------------EGHVSSARDIAIMSCELLK-HPDITKYSTVWMDSLRGGA--TQLVNTNKL----VRFYEGATGLKTGTTDGAGSCLSASATRGGLSLVAVVMGCETSNDRFASARTLLDYGFANYEMAELKLPETAPAA---LKVKNGTEQAVQLVYQSSGKFLVKKGSADKITQEIKLA-ETLTAPVEKGQKLGSCDIVLEGQRIGG--------YDIVAKKAVPKMDFLTGFSNLSKQLF............... 404
294 0.000e+00UniRef50_F7Q1A6 D-alanyl-D-alanine carboxypeptidase DacF protein n=1 Tax=Haloplasma contractile SSD-17B TaxID=1033810 RepID=F7Q1A6_9BACT  ali  37  48........NSKSAILIDLNTGKVLYEKNSHEQLYPASMTKIMSMHLILEEIEKGNMTWDEVITVSDHAASLGG----SQIWLEPNEKMTVEDLFKSVAIASANDSVVALGERVAGSEEMFVKMMNERVKELGLKDTNFMNPHGLT--------------DEDHYSSAYDMSMMARDLLKDHEEVTQYTSLYEDYIRDTDDKFWLVNTNKLVK----YYEGIDGLKTGFTPEALYCLTATKRVGNMRLIAVVMGAETSQKRNADIVNLIKYGFSQYEVVDYVDKGVVMDQYENMMM---KPNNVDVVTKEPISFLVKKGEIKDLEQDIEYTIPKNGA--KAGDTIGKITIYKDGDPY---------EVELTVTEDIEKAGIFQLFGRMFKNVIYG............. 400
295 0.000e+00UniRef50_A0A259UV44 D-alanyl-D-alanine carboxypeptidase DacF n=16 Tax=Sporomusaceae TaxID=1843490 RepID=A0A259UV44_9FIRM  ali  33  32.ADSQVQTSAVSAVLMD-ENGTVLFEKDAHKRLPPASVTKIMTLLLAVEAIEQGRINLVDEVYTSETAWRQGG----SQIWLEPGEKMTVKDMLSAIAIVSANDAAVALMEHIYGSQQSAVEAMNNRAESLGLADTHFNNVNGLPTTD--------------HYMSAYDAALIAKEAVT-HPLYMDMCGIKEAWLRDGKN--WLVNTNKLL----WWYKGGDGLKTGWTEEAKYCFVGTAKRDGLRLISTVFATPEPRSHLRESMKLLDWGFANFAAVPIVNQGTVV---ERLKVNKGIEKEIQLVASQDLNLIIPKGQSKNLQKKIVADS-SVNAPIAEGQKCGELIVIKDGK--------EVGKVNLLAEKSIPKAG----LMRIFQTMITNIF........... 384
296 0.000e+00UniRef50_A0A1W1VYK5 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Thermanaeromonas toyohensis ToBE TaxID=698762 RepID=  ali  29  33.SSQEPLLEAKSAVLMDALTGQVLWSKNPHKQLPQASTTKITTAIVALE-----RGNLTDLVRASQRAAQVGEAA----IYLEEGETLTLEDLLYALLLRSANDAAVAIAEHIGGTEENFVALMNQKAWEIGARDTHYVNPHGLHA--------------PGHYSSAYDLALLARYALK-IPKFREIVATREKPWPGKPWDRLLVNTNQLLWGY-YAYPGADGVKTGYTREAGQVLVASATREGRQLIAVVMHSPNM---YQEARALLDYGFQHFTRQVLVPAGELITQ---APVKGALVGTVPLVTASPAVAAVPREGQVVWEKEITLLPE-LKAPLKKGQKLGELSFILKEAEV----SDQKITVDLIAARDVPRRPWWVAFLQGFLGVFNFPW........... 393
297 0.000e+00UniRef50_A0A2N2H7N1 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H7N1_9DELT  ali  29  60...SPFLLDAKAALLIDAKTGALLYAFNEHEQMQPASLAKLVTFYLALEALQTGRIKLDTPVIISEQAWRLSMDSTVSRMFLRVGQSVSIQDLLYGLMVSSGNDAAVALAEHLSGSPDGFTEKMNEKAKELGLTESHFGNPDGLPV--------------PGQYTTASDMAILARAILERFPDAVTYTGLKEFTFQ----KIKQPNFNSLL----FHDARVDGLKTGHVREAGYHLVATASEGEMRLVAAVLGTPNAEKRRIETGKLLAWGFRTFATVSL---DWPRDVAETLPVYGGDADQVAIAPAVTPRVTVLKGQEKKLGVTATFPSQYLVAPVAKDATVGELTVTTEGNAL--------ATIPIKAQAAVGPGGFFKRMIDRIRLAF............... 415
298 0.000e+00UniRef50_Q67NE3 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Firmicutes TaxID=1239 RepID=Q67NE3_SYMTH  ali  33  40.SGEPVKIESPSAILMEPLSGRVIYQKNAHERRNPASVTKIMTLIVAFDAIRDGKVSLKDPVTISEEAKRQPG----TTIFADVGETFSLEELLLSVAVGSANDAAVAVAEHVAGSVDAFVALMNKKAKELGMNDTQFMNPTGLSA--------------EGHYSTAYDIALMSRHAVLHYPELVKLTAIYNVPWRKNGPKFQLWNNNKLLT----WYPGADGLKTGWTQAAGYCLAATAVQNNTRMIAVVMGAESAKQRNIEVARLLDYGFANYTAVEIAPADKKFG---PVRVARGAVAAIEPVPRAAFGVSVPKGSQDKVKWEVRL-PKQVAAPLEKGQAVGEIVATLDGQ--------EVGRMELVAPEAVGKANLWQSVVHTVRNIFS.............. 401
299 0.000e+00UniRef50_B9YC96 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=Holdemania TaxID=61170 RepID=B9YC96_9FIRM  ali  36  27....DLTPSAKAAILIDYETGQILYEKNSSAKLYPASMTKMMSLLLVVEAIHNGKLSWDTEVTASAHASSMGG----SQIFLETGEVMTVEDLYKASTVASANDAIVALAEKVGGSEENFAAMMNEKAEQLGLEQTHFVNATGL--------------HDDNHYSCAKDMAAIGRALIQEQDDILRFTSTYDDYIRDTENKFWLVNTNKLI----RTYQGMDGLKTGYTTQSMYCITVTAKRDGLRLIGVAMGEPTRDVRNSEASALLDYGFSTYGYQIEMEKGTPVT---TIKVDNGKPDEVRLVTKEAIGHIVAKGAQSAINTEIVLDKK--KAPIQAGETVGRVILHFEDGTQIGQ--------DLVAEEAIMPLDFIDILLKTWKKLLF.............. 383
300 0.000e+00UniRef50_A0A1Q3PD78 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium 33-17 TaxID=1895704 RepID=A0A1Q3PD78_9PROT  ali  31  20..AFALETKAPHAILVDYDTDTVIFEKEADVPTVPSSMSKLMTVYVIFDKLKKGELKLNERFLVSENAWRKQG----SKMFLHVGSSVTLEDLIKGIIIQSGNDACITAAEGIAGTEEEFVNILNEKAKELGLTNSHFVNSTGWP--------------DDNHKMSMRDLSILSKHLINDFPEYYSYFAEREFVY----NNIKQQNRNLSLN----RFNGVDGLKTGHTDAGGYGIAMSAQQKNRRLIVVVNGLSSMKERAEEAERLLSHGFISYDNVHLVKKDVTIS---SIPVWLGDKNSIECYSKEDLVATLPKSDMSRVYITIRHLEK-IPAPIAKDSHIANLVIDVPG--------SSAKTYKLYAKEDVSSLGMIQRAIFKIKHKFS.............. 372
301 0.000e+00UniRef50_UPI000B4B3337 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhodomicrobium TaxID=1068 RepID=UPI000B4B3337  ali  28  21......ETEADYAIVLDVETQTVLFEKQADVLMQPASMSKLMTLAVVFEALDQGKITLQTEFPVSENAWRTGGAPSGSAMFAPLNTNVTVEDLLQGVVVQSGNDSCIILAEGLAGSEEAFAQSMNDYAHRIGMTKSTFANSTGLPN--------------PKQLMTARELALLALHLIEKYPKYYPYFLQKEFRYR----KHVFYNRNPLIYANV----GADGLKTGFTAESGYGVVGSAVQDGRRLIIVQNGVKSQSARKEDAARMLNWGFRSFEKFKVFGADETVG---EALVWGGEQRYVKLRGEGDVRILLPKNKQRKLRGSIVYKGPVI-APVHEGDRIGELRVTAENGV--------TTSAPLFAAESIQRAGLIRQGFDSALSLAFGWL........... 378
302 0.000e+00UniRef50_A0A2A5H3B8 D-alanyl-D-alanine carboxypeptidase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5H3B8_9PROT  ali  31  30....AIDTDAKQAIIIDYNTGAVLFEKNADTQMPTSSMSKVITMYMVFEALKKGTLSLDDTMMVSEKAWRKKG----SKMFVPVGKQVKVEDLIRGVIVQSGNDATIVLAEGLAGDEDSFAAALNRKAKSLGMDNSNFMNASGWP--------------DPDHYSTARDLSILAGAMIKNFPEYYSYYGEKEFTYS----KIRQENRNPLLYRNV----GADGLKTGHTDIGGYGLIGTGVKDDRRVIIVVNGLESSKARANEATRLLAWGLNSFRILSLFDGK---KDLECAPVYFGAKSTVGLQAKEPLSFVVPKLFENDLGVKIRYNAP-LKAPIAKGQEVGVIIVSVP--------KGGVVEIPLVTTEAVEALGTFAKVVAKARLLTTG............. 381
303 0.000e+00UniRef50_Q67P23 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Firmicutes TaxID=1239 RepID=Q67P23_SYMTH  ali  27  40...SPPSLWAHGAILMDAATGDVLWERNAHVRLHPASTTKVLTALIALE-----RGDLDARVTVSKRAAQTPG----SSMYLREGEVHTLHDLVHGLLMLSGNDAAVAIAEHIAGSVEAFADLMNERAERLGARNSHFVNPHGLT--------------HPEHLSTAYDLAVITRAALQN-PLFAEIVAQKELTYEELGRKVVLYNTNRLLRGGL---PGADGVKTGTTGAAGPCLIASATRDDQKLIAVVLNASN---RWRESAALLEWGFRNFALARLGRAGEVLVH---LPVRGGKRRAVPVALREELAVVVPRKTGAVPEVQVDLKRP-LRAPLRAGEVVGRAWVPLPG--------DGRRRVDLIAAEPLPAATWVDRVYQGLVALV............... 388
304 0.000e+00UniRef50_A0A1F2ZX25 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_12 TaxID=1797224 RepID=A0A1F2ZX25_9PROT  ali  29  23.AAAEVTTPAPYAVIMDYETGAVLFEKDADAPVGPSSMSKLMTVAIVFEKIKNGELKPTDEFSVSERAWR---EKEGSSMWVRVDTKIPLIDLLRGIIVQSGNDACIVVAENISGTEEAFADLMTKKAREWGLKNSTFVNSTGLP--------------DEHQKMSTRDLALLARKIIKDFPEQYKLFGEKDFTW----EKIRQPNRNPLL----YNFNGADGLKTGHTEENGYGLVGSAIVNGERRIIVVNGLPSDKDRAVESERLMRTAFNEFASRALYKKGDVAGD---ALVFGGKDATVPLVTLEPVSMILHRSQAQSVTAKVVYEGP-VAAPIAEGQQIGYLRV--------ATQAGDAREFPLYAGKAVKAIGPLGRIGLAVKALIGG............. 378
305 0.000e+00UniRef50_A0A0B5S415 D-alanyl-D-alanine carboxypeptidase dacA n=679 Tax=Bacteria TaxID=2 RepID=A0A0B5S415_BACMY  ali  45  43...................TGKILHEQNPDELLAIASMSKLIVIYAVLEAIKEGKITWDTKVTISDYAYEVSRNNEFSNVPFEKGRQYTVRELYHSIVIFSANGSSIALAELLAGSEKNFLNLANEHAKKLGLKKYKFVNATGLNNADLKGKHPEGTDPNGENSMSARDMGILSKIIITKYPEMLEDTKQRFRNFPDNHPKIRMENWNWMLPGAAFSYEGADGLKTGSSDTAGYGFTITAKRGDLRLISVIIKTKSMDERFTESRALIEYGFNNFEKQKL-----KIDKNNKISVVKGKEDYVTVAPEKEVTVVTAKGSKSPYKISTEADKSHLVAPIKKDAKVGSIVLEPSDK-YGFLDGNKSIKVTAKTTEEVEKANWFVLTMRSIGDFFSNLWSKV........ 422
306 0.000e+00UniRef50_A0A1M6L3A4 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=2 Tax=Anaerobranca TaxID=42447 RepID=A0A1M6L3A4_9FIRM  ali  31  25....ALELESQAAVLMEQSTGTVIFEKNAHEPLPMASISKIMTMLLALEAVEEGKVSLDDMLTTSQRAKEMGG----TQIFLEQGEQISLRDALIAVAVGSANDASVVIAEHIGGSYEGFIEAMNKRAEELGMKNTKFVNSSGLPVEG------------GGNVSSAYDIALMSRELLK-HEIIYQWTTIQWDT--NFLGRVYLSNTNL---KFLRNYPGADGLKTGWTTEAGYCLSATAKRDDTRFIAVIMKAPNPDIRLKEVSQLLNLGFGTYKTVHINKKGDVIENLV---VDKGIKEKINVITEDDVSVLLDKKGKEDITHRINL-PNKLTAPLIKGQVVGNIEVIKGDEVIK--------TVNLIVDEDVGKAGPFTLMGRLFIKML............... 378
307 0.000e+00UniRef50_A0A1C0YYQ4 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Caryophanon latum TaxID=33977 RepID=A0A1C0YYQ4_9BACL  ali  43  27.AATNLTPNVGAAILIDAETGKILYEQNADEIVGIASITKLLAEYILLDEIAAGKLKWEDTYNMTPNTYLLSQNRLLSNVPLREDGTYELWELYEAMAIYSANAATVAIAERVAGSEKAFLELMNKKIESLGVKDYQFVNVTGLNNEYLNGNHPAGNEKD-ENMMSAKSVAILTYHLLKSHPEVLETASVLEKTFRGTSDAILMRNWNLMLPGSIYAYEGVDGLKTGTTDFAGHSFVGTAERNGRRVIAVVLNAKEDQTRFVPTKNLFDFAFNQTAQKEILKAGATIEGSEFMPVVNGKQEQVKIATAEGISLVTT--EDAVYEPVVTLNAERLDATVKEGTVVGHVVMQRVNGEEYGYLEDKPLKVDLVTTESVERLGWAALFLAGVGSFYSEIWAGFKEFATKLF 436
308 0.000e+00UniRef50_A0A1C5MJQ9 D-alanyl-D-alanine carboxypeptidase dacC n=15 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C5MJQ9_9FIRM  ali  32  53.AQPALELPCRAACLIDQQTGTILYEKNADQQMPIASITKVMTLLLTFEAVHDGRIAMDTLVPVSEHAYHMGG----SQIWLEPGEQFTLDEMIKAICVSSANDAAVAVAELVGGSEPGFVQMMNARAAELGMVNTTFHNACGLDT--------------EGHLSTAHDVAIMSREILNTCPEVLHYTGIWTDTLRGGA--TQLVNTNKLLK----RYNGITGLKTGTTSGAGVCISASATRDGLDLIAVVLGSLSSSERFTAATTLLDYGFAAYAAVPLPAMED---RPLLIKVKGSAEESVPLYTALPETLLMPKESAAALTAQLDL-PQELEAPVQLGQTVGTVRILSGETQLG--------EYEVRAAADAEKMDFFGLLWDAL................... 407
309 0.000e+00UniRef50_A0A1J5QTF5 D-alanyl-D-alanine carboxypeptidase DacA n=2 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5QTF5_9ZZZZ  ali  29  32..PGAPDVDARNYVLIDPDSGQTLVEREADTQVPPASLTKLMTAYLTFEALTQGKLRLNQPGMISVAAWKAGG----STMFLQPGLPVTVEQMISGMVVVSGNDAAIALAETIAGDTASFVQMMNATAHQLGMTRSHFDNVNGLPT--------------PTHRVSAEDIALLTENIIRQYPQYLHYFAQQSFTYNH----VTQRNWNPLI----FSDSSVTGMKTGHTDEAGYCLDATATRNGQRLIAVVMGSRTRNDSARAAESLLNYGYRFFDTRHIYHAGQQISTLPDAW---ANPAQIAIGISREIWVTLPIGHSAQLQYSLNL-PAQLPLPLAKGQIVGSLILSDAGR--------EIRRIPLVALQSVEKTNWLRHLWNVSRAFF............... 383
310 0.000e+00UniRef50_A0A1Q6WAU5 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Q6WAU5_9GAMM  ali  29  26..PRAPAVSARSYILLDHFSGRVLADYHADERAEPASLTKLMTAYVVFTALAEGRLKLTDMAAISVHAWRTGG----SRSFVQVDTQIPVDILVKGMIVQSGNDASIALAEKVGGTESAFAEMMNEYARRLGMKSSHFENADGLPS--------------PNHYTTARDTATLANALIRDFPQYYPLFSLREFLW----NNIRQENRNGLL----GKDPSVDGLKTGHTDSAGFCLATSANRNGMRLVSVVMGAPSVKAREAASAALLNYGYTFFETVRVKAARETVLKP---RVYGSAAEFTPVGVPYDVYATVARGQAGMLRTSARLTHEPLTAPLAAATPLGELAVVDG-------SGEVVARAPLTAFAPVPEGGLWTRAVDHVALWFH.............. 380
311 0.000e+00UniRef50_A0A067Z2Z7 D-alanyl-D-alanine carboxypeptidase DacA n=150 Tax=cellular organisms TaxID=131567 RepID=A0A067Z2Z7_GLUOY  ali  32  74....PFDTVARWAYVVDYDTGAVLLDKASDERMAPSSLTKMMTAYIVFGMLATGRIRLEQSLPVSEKAWRTQG----SKMFVPLGQSVLVSDLIQGMLIQSGNDACIVLAEGIAGSEERFVAMMNEEAPKLGMMNSHFVNVTGLPA--------------DGHYMTARDVATVASHLIRDFPQYYHYFGELEFTYNH----IRQGNRNVLVDKGL-----ADGLKTGHTDAGGFGLCASSKRNGNRVIVVINGTSSSNERAHEGERLMSWAFANFENATLFRRGQVV---DSAPVWMGEHRQVSLVAGADIVMTLPVGWQQRSHIGVDYASPVI-APVTKGQVCGALVISAPN--------MADIRVPLEAGETVAKLGLVARAMTRLGH................. 420
312 0.000e+00UniRef50_W8YUB6 D-alanyl-D-alanine carboxypeptidase DacA n=33 Tax=Bacillales TaxID=1385 RepID=W8YUB6_9BACL  ali  41  70...................TGQVLYSYNIDKPLPPASMTKMMTEYMVLNAVKSGKLKWDQEISVSKEAASTP--KDGSQIYLAEGDTHTVKELYTAMSVASANDATVALASFLGGSEAGFVTEMNAKAQELGLKTAQFTSATGLLDTTVIA---------------AKDMAKLAMIILKETPEFLDYSKIPSVKFRERDAK-PMINNDWMLEGNKYVYDGVDGMKTGYLSAAGYCFTGTVKRGDTRLISVVYHTKTKGARFLETRKLYDWAFSNLERKTIVQPKTVVESAAEATITKGKAKTVGLVTESDFTLMVKKGAAVEPKIIATSIPKELVAPVAQGQKIGTVTYKYTD---ADTGTAVTKEINLIAAEGVEKAGWFKLMLRGIGGFFSGLFKGIVDLF.... 441
313 0.000e+00UniRef50_A0A1A5YME8 Peptidase M15 n=11 Tax=Paenibacillus TaxID=44249 RepID=A0A1A5YME8_9BACL  ali  40  45.TENALGLQVKAAILIEADSGQVLFQVNPDEALPLASMTKLMTEYIVLKEISTGRLSWDEKITVSADAANT--LPIESQIYLAAGDIHTVKELYTAMAVGSANDATKQLAITVAGSIDGFVAKMNETAKELGLTTAVFHSTTG----------FEVTETEELSVMSAGDIAKLARVILKEHPEFLEFSSISKYQFR-TRDKSPIVNINSMLQTKPLTYQGVDGMKTGFTEKAGYNFAGTVMRNDLRFISVVMDTATKNTRFYETAKLYDYAYGAFEKKTALPPKTVVEGLETVKIKKGVNKTVPIVTDKDITFIVKKDAEPKIEMTAVMPEEELIAPLAAGTKVGTVTYTYSDEATGKDLS---YTVNLVTAEKAEKAGWFKLFFRAIGDFFAGLFDSIVNLF.... 438
314 0.000e+00UniRef50_A0A078KLA9 Serine-type D-Ala-D-Ala carboxypeptidase n=10 Tax=Bacteria TaxID=2 RepID=A0A078KLA9_9FIRM  ali  34  85...NGPAIAAKSAILVEQSTGKILYEKNSHEKLPPASITKIMTELLTLEAIEEGKLKWDEKLTCSEHAASMGG----SDIWLEPNEQMTVTDLFKAMAISSANDAAVVFAEKIGGSEQGFVNLMNQRAKQLGMNDTHFVNANGLDA--------------DGHLTSAYDVMLMSRELLK-HKDVFKFCTVWMDSLRGG--KTQLVNTNSLI----RTYNGINGLKTGSTSKAGYCISATACRDDMQLIAVIMGADNSKDRFKSAANLLDYGFGGWSIV----KAQIPQKKFNIKVLNGEEYTVSATVTDLPNVLVEKGKEKSVTHKINIVSD-VAAPVEKGQVLGQITIWSDGKNIG--------TASIKADKAVPKMSFGKAFLRLIGFM................ 434
315 0.000e+00UniRef50_A0A2K2VQ66 Uncharacterized protein n=2 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2K2VQ66_9DELT  ali  31  31EMPHPFAVAAKSAVLIDGDSGQFLYGQNPDERISPASFVKLLTLFLVFDAIDQGQVLLEDKVWISEKAWRTGG----SKMFVRQGNRVPLVELIKGIAVVSGNDSCVAVAEFLQGNEQAFVEKMNQKLRELGLVNSQVQTVNGWPA--------------PDQYTTARDMALLALSYVQAHPQALQYHQLKDFT----HENIRQKNRNSLL----WRDPTVDGLKTGHTEDAGYHLLATAKRGEQRFIAVVMGAKSEAIRGRESLRLLNYGFRNFVSVQLFKKGDVLLQ---LSVWKGTEGQVELAAGETGIVTVPLTLQADVTWKAQ-APAQLFAPIERGQIIGEVVITTKDKVLK--------SIPLVANQEIPRAGFFKQAIH..................... 378
316 0.000e+00UniRef50_A0A0P1H4P4 D-alanyl-D-alanine carboxypeptidase DacC n=91 Tax=Rhodobacterales TaxID=204455 RepID=A0A0P1H4P4_9RHOB  ali  29  21.SVHAFETQAKSAYVVDLKTGTVLLNKNADIPLPPASMSKLMTLYIAFEAVRDGRLSLDEKLPVSEHAMSFGG----STMFLDTTDRVRVEDLIRGIIVLSGNDACVVIAEALSGTEAGFARYMTQRAQALGMTNSTFANSSGWPAI--------------GHRMSMRDLALLGTRLIEDFPQYYALFSEREFKFDGRAPQNT-RNRNPLLGLGI----GADGLKTGHTEEAGFGLVGSAKQGERRVVFVISGLETAKARAKEAETIVNWAFRQFVMRDVAKQGEVVAN---ADVWMGDAPSVGLTPAADIAALLPALDSKTVEAEVVYNGP-IEAPIAEGQELGQLILTPDG--------LEPLSFPLVADRAVAAGGFLTRVGTAATMLLRRL............ 381
317 0.000e+00UniRef50_A0A0P0UR32 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=11 Tax=root TaxID=1 RepID=A0A0P0UR32_9GAMM  ali  31  28.TPKAPSINAAAYLVVDHNSGVVIASSDADELRAPASLTKLMTAYVVFQLIKDGRVGLNDDVRISKKAWKTGG----SKSFVEVGKTIKLETLLQGMIIQSGNDSAVALAEHIAGTEGTFATYMNEYAKELGMLSSNFENASGLPVKDNKQNV------------TARDMAKLASAIIRDFPQFYPWFSQKEFSYHG----IKQRNRNKLL----WSDHTVDGLKTGHTKRAGYNLVVSAKRDDMRLISVVLGSTGTQARAEQTQTLLDYGFRFYETKKISE------ISNKIPIPSSTKKAIKVGFNHPQAITLPRGQY-RLSQQAIELNNNLAAPISKGDNIGHFIIKFEGNVL--------AKLPIIALEDAPESGFFSRLLDKIGL................. 378
318 0.000e+00UniRef50_A0A2G2GFB7 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Robiginitomaculum sp. TaxID=2030823 RepID=A0A2G2GFB7_9RHOB  ali  30  25...QGFETTAPVAVLMDAQSGTILFEKNAREPIPPASMTKIMTLYMVFERLKSGALTLDDEFTVSDDAWRRGGFRSGSSMCLNPNERVRVEDLIRGVIVLSGNDAAITLAENISGSEAAFAQAMTKRAHELGLASVNFLNSTGWPA--------------EGHVISGLDLARLARMSAQDFPEYYAYYGEKEFGWCKAAPSNRF-NRNPLLSL----VAGADGLKTGHTNEAGYGLVGSAVRDGKRRIVVISGLRSNRDRSRQSERLLRAAFREFDVKELFVPDAPIG---KIDVFLGTQKTVSVGVKQTVQFGVFKPQIRDVKAEIIYQGP-VSAPIEQGQKIAILRLTSPDRP--------PVEIDLFALESVAKKGFFSRVITGLVRFIQG............. 385
319 0.000e+00UniRef50_A0A0T8P338 D-alanyl-D-alanine carboxypeptidase, penicillin-binding protein 3 n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A0T8P338_ST  ali  99  2.............................................................................SNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELGLKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAISLPVPKGSKDVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVTTAEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF 331
320 0.000e+00UniRef50_A0A2E5R4W0 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Pelagibacteraceae bacterium TaxID=2026775 RepID=A0A2E5R4W0_9PROT  ali  30  19....SFELKSSNAIVLDYDTNDILYQKNLDKIIQPASMTKIMTAYIVFDQLKDGILSLDDEFKVSKNAYLKGG----SRMFVEMGDRVKVRELLLGIIVQSGNDASIVVAENISGSEESFAALMNKYAKEIGMKNTNFTNSSGWP--------------DKNHYSSVYDIAILSKSLIKNFPKLYEIFKEKKFIY----NNIRQYNRNKLIN----SYEGVDGLKTGYTEEAGFGISVSSLKDDRRIIVVVTGLKTGSERATEAEFLLDWAYRNTKHYVIFEKGQILSTTD---VWLGKEKSLDIITSQQLTKSLTLEQSQNLEIFITYDKP-MEAPIEKNQVIGKARIIIPDR--------NIITVDLISKDEIKRSKSIFRLFSALKYLIFG............. 370
321 0.000e+00UniRef50_UPI000494F768 D-alanyl-D-alanine carboxypeptidase n=3 Tax=Kurthia TaxID=1649 RepID=UPI000494F768  ali  46  35...DEPNVLAKAAIIIDADSGKILYEKNANKALGIASMSKMMTEYILLDKIKAGEISWDDKYNVSKYAYKISHDTELSNVALREDGVYTVRELYEAMAIYSANAATIALTEVMAGSEKKFLPLMNKKAEELGLEKYTFYNATGLNNSQLQNMHPKGTPKKGENKMPAKEVAKLSYALLKAHPEVLETASVLKKTFKGTKDAIPMENWNYMLKGGKYEYNGVDGLKTGSTDYAGQCFAATAKRGDMRVIAIVMGDSTYKARFDATKVLLDYAFDNFEKQTVLAKNTTFKNQQTIEVKNGKEKTVKIQATTPIEMVVNKNDTKTMKPKLVLDHSSISAPVKKGDKYGYIT-------------PTELTSDVVTTTSASERGWLSKGFTGLGDFFKNVWNKV........ 434
322 0.000e+00UniRef50_UPI0009D655B5 D-alanyl-D-alanine carboxypeptidase n=2 Tax=Alicyclobacillus TaxID=29330 RepID=UPI0009D655B5  ali  37  55..AKAPTIVAKSAVLMDAASGQILYSKNPNEERAPASTTKLMTMLLVLEAVKHKKAAWNDVVPVTPDAYKIATTPDVSNAYLDPREHFTLRDMMEFIAVLSAADATVAVADDLGGDKQGFVQMMNEEAQRLGLTHTHYMNPDGL--------------SEKNHYTTARDLAVLARYMVTNYPGILNFTKEPRVTVRKNN---TWRNTDELL----GRYPGLDGLKTGYTSEAGFCFVGTAERNGERLISVVMGDPSDQERFADTKKLLDWGFNNFVEDKVAAAGKTLSQ--TLFVKNGKSQRLPVAAKNDLVVAVPKG----VHGTLELESSSLSAPIAKGASVGTLKYVVNGKM--------VAEEPVVAAQTDGKASWLARLTRSIGSWFSNLAHRL........ 416
323 0.000e+00UniRef50_A0A097AQN8 D-alanyl-D-alanine carboxypeptidase DacB n=34 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A097AQN8_THEKI  ali  28  26...QKPEIVGPTAVLMDFTTGQVLYDKNMHKRMYPASTTKILTAIIAIE-----RGNLDDIVTASDNVTKIDGN----SIYLSPGEKLTLKQLLYALMLESANDAAIAIAEYIGGSVQNFAKIMNEKAKEIGAHDSHFVNPNGLP--------------DENHYSTPYDMALIARYAMQN-AEFRKIVSTIHYQIPPTNKVRDLWLSNRLIKPSSFNYEGADGVKTGYTVAAGQVLVASATRDGHRLISVIMGDQGTNI-WTDTIKLLNYGFENFSLVKKVQKGKLITY-----VNLGKSQKLPLIAKNDFYYEVPKGQENSIESQIILNKD-IKAPINKGDILGYIKYTLDGKEIGTN--------PLIAAESVYK-NFWG......................... 368
324 0.000e+00UniRef50_A0A2T5G611 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Brockia lithotrophica TaxID=933949 RepID=A0A2T5G611_9THEO  ali  33  72...PDLAPNAKAAILIEATTGAVLYEKEADTPLPPASMTKVMTMLLVAEAVDAGRIRLEDRVVASERAARMGG----SQVFLAPGEEMSLEDLLKSVAIASANDAAVALAEHVAGSVEQFVELMNRRARELGLEHTTFRNVHGLP--------------EEGHVASARDLALLGRELVR-HAWILEYTGRYEDMLRGSAKPFWLVNTNRLVK----FYPGMDGLKTGYTAEARYGLVATAKRGSLRFIAVVMGEPDVKTRNREVTTMLDYGFAQLEASTLYARGERVA---RLKVAGGTPEEVGARAGEEVVAVFPKGKGEVVRTEVVPRVP--RAPFAAGIPVGEVVVRTE-----IAGKTYEATFPLLAEEAVRLPSLPERIFRGLRDLV............... 428
325 0.000e+00UniRef50_A0A1Q3JIE1 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium 64-11 TaxID=1895709 RepID=A0A1Q3JIE1_9PROT  ali  28  19.ARAAIDTSAEHALLMDANTGQVLWQKDGLTPMPPASMSKLMTIELLFQRLKDGRIKLTDTFPVSVRAWRTGG----SKMFVREGSRVPVEDLIRGIIIQSGNDACVVVAEALGGTVEGFIKMMNKRAKELGLDQSTFVNPDGLPDP-------------PGQLMSALDLAKLARHIINNYPQYYHYFSEKEFVW----NNIHQPNRDLVLGQL----PGADGLKTGHTDAAGYGITISAKRGPQRFILVLNGLRYPQYRAEEAGRVMDVAFREFRSYLVAKAGQVVGQ---APILEGVEESVPVTVRQPFNVTMQVDSHSKMKLLLRYY-PGLKAPVAAGQKVGLLTVAAPD--------FPPLSVPVYAAQPVEQVGFISGLWRAARRKFWS............. 383
326 0.000e+00UniRef50_A0A259UQM7 D-alanyl-D-alanine carboxypeptidase DacF n=1 Tax=Sporomusa acidovorans DSM 3132 TaxID=1123286 RepID=A0A259UQM7_9FIRM  ali  34  30QSGTQLETSAVSAVLMD-ENGTLLYEKDAHKRLPPASVTKIMTLLLAVEAIEQGRINIADDVYASENAWRQGG----SQIWLEPGEKMTVKEMLTAIAVVSANDAAVALMEHIYGSEIAAVEAMNKRAETLGLADTHFSNVNGLPA--------------PNHYMSAYDTALIAKEAVT-HPLYMDMCGIKETWLRNGKN--WLVNTNKLL----WWYKGGDGLKTGWTEEAKYCFVGTAKRDGLRLISSVFATPEPRSHLRESMKLLDWGFANFVAVPIVNQGTVV---ERIKVNKGVEAEVQLLASQDLNLIIGKGQNKNLQKKIIADS-SVNAPIDEGQKCGELIVLKDGK--------EIGKVDLLAEKTVPKASLLRIFQNMITNMFS.............. 384
327 0.000e+00UniRef50_A0A1V4VJ44 D-alanyl-D-alanine carboxypeptidase DacF n=27 Tax=Firmicutes TaxID=1239 RepID=A0A1V4VJ44_9FIRM  ali  36  45EAAAPPETTAVAAVLLEPTSNKIIYEKELNEQLPMASVTKLMTLLLAVEAVEQGKFKLDDKVVTSENAWEMGG----SQVYLEPGEEMSLWEMLMAIGLQSANDSSVAVAEHIAGSEEAFVQAMNDKAKELGLVNTNFVNCHGLTA--------------DNHYTSAYDMAVILKEGLK-YPLFRKITSMKESELRGGA--FKLWNTNKLL----WWYDGADAGKTGWTEAAKYCLASSAERDGLRIICVVLGTSEPGSHFRESTKLLDYGFARYKAVNFAEQGASVGA---IKVGKGQADRVEAQTAEKVSVVALKGEEKGFESRVELA-DHLDAPVRKGQVVGAYVVTKGGQ--------EVKRVNLVAGDDVLKTTVFEQVKRVIDHVF............... 401
328 0.000e+00UniRef50_A0A1Z9N1P0 D-alanyl-D-alanine carboxypeptidase n=4 Tax=Pelagibacteraceae TaxID=1655514 RepID=A0A1Z9N1P0_9PROT  ali  27  20...AAPEINAKTSILIDYNSDEILYENEPDLKIYPASMTKIMTSIIAFDLLKKNEISLDDKYLISRKAWKMSQ-SGYSSMFIMVNDEVSVEDLLKGIIIVSGNDSCIALAEGIAGTEENFVYMMNEKAAEIGMENTNFANSSGIN--------------DPDNYSTARDIALMSKYLIKNFPNYYKLFAEKSFTWRTGGDPITQSNRNRLLYRNI----GVDGIKTGYLAVEKYSLASSMQKGTRRLISVISGIDTKQKRTNTSLKLLNWGYRNTDTFEISKANET---PFKIKAWLGKTKTIDGITKDDVYVTLSKRDSRKLKVFIDYNGP-IVAPIKKDQEIAKLKIFKDQELLK--------EITIYSSQDLKKVNFIMSIFNSLNYLIWG............. 380
329 0.000e+00UniRef50_A0A2N6ASK7 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2N6ASK7_9RHIZ  ali  26  23..AAPFETPAEYVYMIDAETGTVLYEKNPDSLMAPASMSKLMTVEMVFDALKSGVLTMQDKFHISDNAWRKGGVKSGSSMFAKLDSDIELKDLLLGVIVQSANDGCIAIAEGMSGTEAAFAKAMTRRAREIGLKKSTFANSTGWP--------------DPGQKMTARELVMLADHIIRNYPDLYTAFGHKNFTWNG----IKQNNRNPLL----GRMEGADGLKTGHTQESGYGLVASVRRNGQRLILAMNGLKTSRQRAQEARKMIDWGFRAFRSFKLFDAGVEIA---RAKVWGGDAGSVGLVAAKPVRGLMPITAQKDLKAEIIYQGP-LMAPVKRGHVVAELQISAPGGV--------RFSTPLQAMEDVSKAGLVGRGLGVLTHMVPGL............ 382
330 0.000e+00UniRef50_A0A1C6EMG7 D-alanyl-D-alanine carboxypeptidase dacC n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6EMG7_9CLOT  ali  32  28QEAFDYEFQSKSALLMDPVSGEVLFEYKSDEQMPIASVTKVMTLVLVMEAIDRGEIALDEVLTISKNAAGMGG----SQVLLDEGGQYTVSDLIKSIIVASGNDASVAMAERVAGSEAAFVDRMNARAQELGMEGTLFKNCTGLPA--------------EGHHSTAHDVAIMSRELIK-HEVYFQYSTIWLDYLQHANNRETMSNTNKLLQ----TYDGADGIKTGSTQEAGFCLSATAKRGDVRLIGVILGAPSSKVRFQEASDLLNFGFNTFQLQSVIQPNQVYGQS---NVVNGKEFTVNAVTQEGYSLLMSKNAPRQVQTQVNLQQE-VNAPVEQGQPLGELIVTEGDHELT--------RIPLIAESAVAKAEYADHLNKILGRWFH.............. 386
331 0.000e+00UniRef50_A0A1E3VS91 Uncharacterized protein n=2 Tax=Methyloceanibacter superfactus TaxID=1774969 RepID=A0A1E3VS91_9RHIZ  ali  30  1...............MDSGANLALFEKDADAQFVPASMSKLMTLAVVFRQLKEGRIKLDDTFVVSENAWRTGGAPSGTAMFAPLGDPITVNDLIQGVTVQSGNDACIILAEGIGGTEAGFVKMMNDYAKELGLTQSTFANSNGLPA--------------EGHMMSARDLATLAKHLIDTYPEYYHYFGQKEFRYR---DKFTFRNRNPL----VWADIGVDGLKTGYLKESGYGLVASAVRGDQRLILVVSGLESKNDRQSEARRLLEWGFKSFKPFRLFGADEKVSD---ALVWGGEKHYVPLVGDGEIDLILPVTSTGAVSASILYDGP-LKAPIRKGDQVATLRVS-------AAESTATNEIPLYAGEDIGQSNFAMRGIDSLLVLAFGWL........... 350
332 0.000e+00UniRef50_A0A1G9LGZ3 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Romboutsia lituseburensis DSM 797 TaxID=1121325 RepI  ali  32  30...APMNISSKSAILMDVSSGQILYEKNAHDKLPPASVTKVMTMLLCMEALDAGKIKLNDNVQISDTAASMGG----SQIFLEPGETQDVNTLLKGIAVASANDACVAMAEHVAGSVESFVELMNKKAQELGMKDTHFSNTNGLPI--------------ADHYTSAHDIALMSRELLK-HESINKYLTTWMDKVVVGKKQVTLANTNKMIK----HYQGATGVKTGFTQEAKYCLSASAKRGETHLVAATLGAETSPERFKDASNLLNYGFANYESLKLCSKDD---NMSTLTLDKAEDNKVNLVAKEDLTVLIKKGGNRDFTKKVKVNENPTI-PIKKGTALGQVEVYQGDKL--------VGKVDLVNTKDINKASYLQMLQRVIDNMI............... 385
333 0.000e+00UniRef50_A0A0P9EPB7 D-alanyl-D-alanine carboxypeptidase (Penicillin-binding protein 5/6) n=1 Tax=Thiohalorhabdus denitrificans TaxID=381306 RepID=A0A  ali  29  25..PEPPGTPAEAAILMDAKSGRILASQNPDKEHPPASLAKLMTAYITFQALEEGRISLEDKVRISKEVWELKG----SQMFLRVGERVSVDKLLRGLVVQSGNDAALALAEHLAGGKETFLRMMNRTARDLGMEGSHFSDPGGLP--------------GDGMVVTARDMAKLARVIVNEYPQYLEMFQQRSLT----HNGITQSNRNRLL----GRMEGADGLKTGHTKAAGYNLVGTVERDGMRLVSVVLGSSSPAQRFDTMQGLLNYGFRFYETRKLYAAGEAV---ETTRVWQGATEELELTLAEPLYVTIPRNSDSDLELRARLESP-LRAPVKEQDEVGTLQVKLGDESL--------ARRPLLAKAEVASGGWIRYLLDAARLQWQGFWEGQKTRF.... 387
334 0.000e+00UniRef50_UPI000684B068 D-alanyl-D-alanine carboxypeptidase n=1 Tax=Thioalkalivibrio sp. HK1 TaxID=1469245 RepID=UPI000684B068  ali  29  50..PAPPQVDARAWYLMDANSGQMLVQSHADEKHAPASLTKMLTSYVVFAEMARGKFNLETQVPVSWNARRMTG----SRMFLEADTLVSVEALLKGLIIQSGNDAAVALAEFISGDEKSFAVLMNRHAARLGMTRSHFTNASGLSETD--------------QYSTARDTAFLASALVRDFPDYYPWHAIREYEYGG----IVQPNRNPLL----GLDPSVDGLKTGYTDAALFCLVASAEREGMRLVVSVLGAKSNADRRRFAKALLDYGFEFYETRLLYSAGQELVD---ARIWKGESDKVPLGIKEDLHITLPRGEHGRIGVKTDLV--RISAPVKADEIQGLIRIS--------HQENIVAERPLIALQDIARGNLWQVAKDQILLLI............... 400
335 0.000e+00UniRef50_UPI0003B6323E D-alanyl-D-alanine carboxypeptidase n=1 Tax=Bavariicoccus seileri TaxID=549685 RepID=UPI0003B6323E  ali  37  31EPANAPSVDAKGALVADLETGKVLVDQNGSERLPIASMTKLITVYLIYQAIEEGQIAWDDTVPISDYVATISNNMELSNVPLSAYEVYTVKELLESVLVYSANGSAIALAELIAGSEEYFVTKMNDLVSGWGINDAILLNASGLPNKYRLEKEDDSLDPDAENEMSARDVATVAYHLLTDFPEVLDITAQPTVDFRADANTIKMHSYNHMLEGYDSYYEGVDGLKTGTTDGSGASFTGTAKKDDFRVITVVIGSSEAEERFHATAQLLDFTFENFKKTTIANAGDPVSHVKSIPVIKGKEKEVGISYGSNVVMMAPIGTVEDLEAVLTTSDGKIEAPIEKGEKLGKVALTVTDDLGFIAGRKSEAESDAVASDSVAKANIFVRAGRVISQFVKDLWSSAREFINAI. 444
336 0.000e+00UniRef50_A0A0S6VT91 Serine-type D-Ala-D-Ala carboxypeptidase n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0S6VT91_9BACT  ali  36  36..........KAAILLEAQTGQVLFEDNAHGKVIPASLVKMMVMLIVLEQIDAGRLSLTDMVTTSTWASKIGG----SQVFLSEGEQFPLGELLKAIAMHSANDAATAVAEHVAGSTDAFVEMMNARAKELGLNDTTFVNVHGLPPAKGQK----------ENYTSAYDMATLGRELLK-HPKVLEWTGAVEDTFRDG--KFVLTNTNR---DLILKYPGVDGLKTGFHSGAGFNVCATVQRDDVRLIAVVMGSNDKADRYKGVVALFNKGFTQFEKVQVLRKGFTVGDPLIIS--KGKDRTATLVASNNVTLLIPKGKKDAIRQEVNIPIPRIPAPVAKGVRFGEVVIYLDDQ--------EITRVDLVTDRDIERGNIFDQMKWWVVNKIS.............. 388
337 0.000e+00UniRef50_A0A174W148 D-alanyl-D-alanine carboxypeptidase n=9 Tax=Firmicutes TaxID=1239 RepID=A0A174W148_9FIRM  ali  34  28........EAGSAILMEKETGTVLYEANAHDKLEPASVTKVMTLLLVMEAIDDGRLKMEDMVTVSAQAASMGG----SQVYLKEGEQMTVHDMLKAVAVVSGNDAAVALAEHIAGSEEGFVERMNRRAAELGMADTTFINCTGLPA--------------AGHLTSAYDIAVMSRALLA-HPGIREFTTIWMDSVRDG--QFQLANTNKLI----RFYEGATGLKTGFTDSALYCLSATAERDGMELIAVVMKCPTSEKRFEGAKALLNFGFA</