current user: public

If you have questions about the server, please let us know.

Query: gi|11497068|ref|NP_051171.1| hypothetical protein (BB_P10) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MIFTLDMVLNHLTQIFKGFKAYATENNFECDIINTYNHPYLSKITAASSNIIALKFDGTENLFDHNYRAGVFYENALEFSINFQIYIIAIVLNAKDFDANSRMLMLYSMLSDFLHNKAHKYNLPSLQPDYINKINFYIYPTSNMQTVGLINLGTKYSNHAYSASIAFNASVKAIEILKEEYEIAARYNLast
1 -6.070[O] KOG0855 Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes  ali follow..  13  71............................DLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF-------VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE........ 215
2 -5.550[P] COG3131 Periplasmic glucans biosynthesis protein  ali follow..  12  158...............FAGFRVFKAPELARRDVVSFLGASYFR----------AVDDTYQYGLSARGLAIDTYTDGQEEFP-DFTAFWF------DTAKPGDTTFTVYALLDSASVTGAYKFVIHCEKSQVIMDVENHLYARKDIKQLGIAPMTSMFGNNERRVCDTIHPQIHDSDRL........... 304
3 -5.040[M] COG1970 Large-conductance mechanosensitive channel  ali follow..  17  1............MSIIKEFREFAMRGNV--KIVSSLVADIIMPPGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDF-VAFAIFMAIKLINPAAAPAPTKEEVLLTEIRDLLKEQNNR.................................................................... 135
4 -4.890[R] KOG0511 Ankyrin repeat protein  ali follow..  11  333.QLTLPNCEFEVAEIILRY--YADNTDIPVDVLLLADILLEDRLKTIASTIITIQQYNVFDVLYLSWEIGV--ERLEQFAAKFIAIHLQELYKDPE-------------IKRAIMLSSQRISLRQETDTIELDIRYYLLRKYSFEDVELFENQDDLEYLKQVGYLEYRKDMGMLDNILADLELDV... 513
5 -4.790[R] COG4122 Predicted O-methyltransferase  ali follow..  11  42..MQIAPEQGQFMALLVQLLG--AKKTLEVGVFTGYSSLIVALALPAEGKLVACDINEEFTAIAQRYWQKAGVDHKIDLYLAPALETLDKLLVAGEAETF-----------DFAFIDADKSNYD----------NYYERSLQLIRSGGVIAIDNVLWSGKVADPEIQDNRTQKIRAFNHKLLQDQRIT 204
6 -4.660[S] KOG2490 Predicted membrane protein  ali follow..  238LIRKIDVSRLYIIRAQASIRFYVLYNVLEIRLCCALGQDVLDCLFSNHILSFNFWNPAGWMTFFYYFAISLAYMVLHTLVLLYQIITLNVTVNSYSNAVLALLMS--AVFKKFEKENLFQLTCSDVVERFQITIMVIIIFLRNLAELYTTSSLDQPLLTFKRLKTLLAPFFWVIELFVDKHAFIIKFN 438
7 -4.570[S] COG1584 Predicted membrane protein  ali follow..  14  51VILSMGIFYGGLGQVIAGIEEWKKGNTFGATAFTSY---------------------------------GLFWLTLVVIVL--PKFGDNFAGLALTPTDFAAYLFLWGLFTLYMFIGTLKATRALQVVFLSLTILFFLLAAGNYMGNPAIIKIAGYEGIFVGFSAIYAAMGQVLN............. 191
8 -4.520[L] COG5527 Protein involved in initiation of plasmid replication  ali follow..  11  87.............SRFKQAVENMQKQAFFKIKEKKEHGFEFENIV-----IPYVKWTDYHDEVTIRF-SPEIMPYLINLKKNFTQHALSDISELNSKHS----IILYRWLSMNYNQYEHYSYKGGRREEQVEAYRNPSISIRELRE--MTDIVNEYKLFA-----DLEKWIKPLEEINDHTSFTVTYD 247
9 -4.500[S] COG3602 Uncharacterized protein conserved in bacteria  ali follow..  83...........AVGLTAAVSGALTQAGISANVVAAYYHDHIFVPAADAKRAVEV...................................................................................................................................... 125
10 -4.430[W] KOG3544 Collagens (type IV and type XIII), and related proteins  ali follow..  10.............................FFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTA.. 167

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35