current user: public

If you have questions about the server, please let us know.

Query: gi|11497090|ref|NP_051162.1| hypothetical protein (BB_P01) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MCDLRKTKLIDKISSLELYKYSIFFRNYIENVAEDCLKNGLILESAAHNVSEVELARLKVQLKNALLNCIISYRFHGIGYVLVKTKDTLIDLEQPVNIELPIGFEYLDYEYVRDLGVDFDHITYKVKSNNKNNSLDAVKIHKSRLIIYENFDYILKRYVPCYTESFLLDIYLFEKIYVEIERRIENHNFLFYKDESLVQLQDALSSATTSLSALTQSNNDRGSGILSSFLRKQNSNNHSKDISNLRNLNDSLSQELARLKSNLNNEGMFYTATPSASLEVIKYDLSYLKEALALIKAKIGADTKEPLTRSFNEQAKGLGNDGKGDRSNYYDFLKGVQEQVENSCNLKLTKYFGLDMKFNSLIMLSEEQKVERDIKLIELYSKYNQLIQSSSFNNEELAMLKEKLFSFLast
1 -21.000[S] COG3567 Uncharacterized protein conserved in bacteria  ali follow..  15  63................AMYRTNWLARKVVDIPATDMTREWVTLQTCMQADALEPMYRLALNVRAKVRDALAWARLYGGAVLFINVHGQDPSLPFDPASVMPGSRLSLTVLDRWRVALGSGQMDQDPLSETYGQP-SVERVDRSRMIAFSGAELP----------------------------WEAFRGNGYWHDSVLQAMYNALSRYDTATQGTASMFFEAVVDVLRI--------SGLSDTLSSDQGTQEVHKRFQLAAMMKSFNRMLLL-DAKDEYTQKTNHFSGVKEVIEQFMMDISGAADIPATRLFGQSPKGMNATGDSDIRNYYDRIKAQQEDELRPVLRVLYAVLDLEIQFNSLWQMSETERASIEKLRAERDQIY---LAHGVIGPDVPC......... 422
2 -4.770[K] KOG3119 Basic region leucine zipper transcription factor  ali follow..  15  2..............................................................................................................................................................................SIVCTLEQKVN-----FFK-----------AAATTKNLLILKNNTD--TNYINNYKQDNPSNNKFPRIQAQSNNSHLQHQQQLQQKLAQLHHYSQQKLSGSDFPYGPRPPTGGKEEKLLLLAPP-KANIAMMNNVRLSNISPTLSMNGSSNEASNLHPLSMYGGSISPQ-NKKDESYWDRRRRNNEAAKRSREKRRYNDM---VLEQRVIELTKENHVLKAQLDAIRDKF... 292
3 -4.390[S] COG4695 Phage-related protein  ali follow..  14  49............................................................................................................YSCINVLSTALAQLPAVVLRRQGDNIKPATD-HPAYYLLHDEPNAWQTSYK--WRETKQAHVCGWGNGYSVIRRVRIGNRWAYSAPEDMIHIRALGSDGRMGISPIRQHAETIGLGLSVQRYGKEFFDGGGRPTGLLTVKGDLQDKSWERLKSFWAKA----LKQSDNKTLLLPADLDYKSISIAPEDAQYLETRKSEIASLYNVPGHMINDLERATFSNISEWVMNWEQEINRKVFTPAERRAGYYVKLNLAALLRGTPKERAEF--------YHYGITDGWLDRNEVRALED..... 375
4 -4.330[S] COG3462 Predicted membrane protein  ali follow..  17  2.....................................................................................................................................................................FQKTVKCFFRIHSIMERRIENLIWV------LVGLVAVVAAVAIITSILFGGRYYNGGYGPYGMMGGFYGMGIIMPIMGIISVILVLIFIYFILEAIRGPSQYDHSENVSRAEEIAK----------RLARGEISEEEYRKIIETIRR.............................................................................................. 134
5 -4.140[DY] KOG0977 Nuclear envelope protein lamin, intermediate filament superfamily  ali follow..  12  39...........................................................................................................EKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGNDIGQIKFKFNDSLVKV-EISEAHSGTIGVEVKVD-DLNDYRHRYEEARREVEREKTTWGGAISQAQAELDT-----------KSRYAAILDEEKRLYAEQDQLYLQLAAAKDELDAAIV--RRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKNELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALEREANTLQIQL... 328
6 -4.090[R] COG5511 Bacteriophage capsid protein  ali follow..  11  45..ALLPALRLGNARADDLVRNNGIAANAVALHKDHIVGHMFLISYRPNWRWLGMRETAAKSFVDEVEAAWSEYAEGMSGEIDVEGKRTFTEFIR-VGVHAFNGEIFVQPVWDTETTVSPKRVDTPGHGMGNRFLRXGVXVDRGRAVAY----HICEDDFPRSGSG----LHIFEPVEDGQTRGANQFYSVMERLKMLDSLQATLQSAIVKAMYAATIESDLDTEKAFEYIAGAPQGQKDNPLINILEKFSSWYDT----NNVTLGGVKIPHLFPGDDLKLQTAQ-ALEQALLRYIAAGLGV-SYEQLSRDYSKVS----SSARASANESWRYFMGRRKFIAARLATQMFSYW....................................................... 412
7 -3.960[W] KOG4291 Mucin/alpha-tectorin  ali follow..  190......................................................................TAYTFNGLGFVLARSVDESNKFEVQGRFEQ------------NYYGEVKATQLTAVAMRGNTTTTIEVRLRPLHARWRYRLDVLADGRRVYFDRE--LKFQHFDGVTVYTPTYLLNQSQVVVQFDAGIGVEVVENEGYMTGRVLPWKFINKTAGLFGNWSFNKLDDFMLPNGQVAQLNLNDLRSIHTNFGIKWMLTD---REVPGVGAALFKREFGRMSGYYA-FQPNYVLDPADFLPANRSYDLERAEELCGECMQCQYDYAMTLNRDLAHFTKNYYDTIVNMQAENAV............................................... 470
8 -3.960[N] COG1815 Flagellar basal body protein  ali follow..  16  26...................................................................................................................................................................................ISQNIANVDTPNYKAKKVNVFDEALSNTRLQAKQTHEKHIAFNRSQGSSPVETIRQTAYNHNGNNV-----DVDLEMTELAKN--------QIYYNALIERVNGNFNSLQTVIR.................................................................................................................. 129
9 -3.920[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  11  66.........................................SLTGAGASFPAPLYASWFTDLNKKYPNLQINYQSVGSGAGVEQFIQGTVDFDVAMKDE---------------------------EIQKVQRGVLLLPVTAGGIVLAYNLP----------VTELNLPRVVYTDILLKIKT---------WDAPEIKAANPNVNLPSQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKPVGVGGKGNEGVTAQIKQTQGAIGYIEYGYAKQNNISYATLENK-KFVKYNDESASQTLAAIQLPENLRAFVPDPDGDGS-----PIVSFSWIMAYKNYPDPVKAKAMEAAIE---------ALTEGQKISGELGYIPLPQAVVQKTATV................. 371
10 -3.880[KT] COG1842 Phage shock protein A (IM30), suppresses sigma54-dependent transcription  ali follow..  15  10...........................................................................................................................................................................LGKSFISQAEESIEETQGVRMLEQHIRDAKAELDKAGKSRVDLLARVKLSHDKLKDLRERKASLEARTLEALS-KNVNPSLINEVAEEIARLENL----ITAEEQVLSNLEVSRDGVEKAVAATAQRIAQFEQQMEVVKATEAMQRAQQAVTTSTVGASSSVSTAAESLKRLQTRQAERQARLD-------AAAQLEKVADGRDLDEKLAEAGIGGSNKSSAQDVLARLQRQQ... 230

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35