current user: public

If you have questions about the server, please let us know.

Query: gi|11497097|ref|NP_051174.1| hypothetical protein (BB_P13) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
2 -6.090[ZUD] KOG2101 Intermediate filament-like protein, sorting nexins, and related proteins containing PX (PhoX) domain(s)  ali follow..  17  1..MNYTFSTNLDNFLFLPNFSGCPFF-WGSEINFEASN---KINQLK--SKIFNKKKSKNKLENEFQFLNFQFFFVQFQKNEI-------------IQPKFQKKNATFFS--------ISVFPFIRHVFRRKKNSKKIHKNATTTQLIMMN 125
3 -5.600[R] KOG2489 Transmembrane protein  ali follow..  17  531....YSIIYVEQRGWYSWVLNML-LLMFGFITMTPQLFINYKLKSVAHLPRMLTYKFINTFIDDLFAFVIK--YRIGCFRDDIIFLIYLYQRWIYRVDPT................................................... 631
8 -5.080[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  27  1MTFSYFISIFTANLSPTFPCR--------------------KVNQLNYFYQLLNLKC---FFRSIFKIGHFPRG............................................................................. 51
10 -4.990[MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon)  ali follow..  16  33.IAEHIINLLKRHHITEVIATL---YLPDVLRDYFQDQMTYAVEEDQPLGTAGCVKNIAELLDETFLVISGDGEAIAFHKQILTRVPNPIEFGVVITDEALEKPSTSEIFSDTVNTGTYIVLEYLPSNTECDFSKDLFPLLLAKDEPMYG. 209

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35