current user: public

If you have questions about the server, please let us know.

Query: gi|11497066|ref|NP_051169.1| hypothetical protein (BB_P08) [Borrelia burgdorferi B31], from B.burgdorferi

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# E-value Template Links and tools%idFirst MCGGCLMNGVRKRLSDMSFRMINVFKDPKPLKFYKGTVVKLENDSSYQRVFDKTKYIEFAGVIIDIKPQELAILYDSDMSDIQGYSKLYTYQDLNYEPKDRISIADLVYFEIFSIDSSIGYFTLVLKEFIWTNLast
1 2.000e-40UniRef50_B5RNQ2 Uncharacterized conserved protein n=8 Tax=Borrelia TaxID=138 RepID=B5RNQ2_BORDL  ali  37  5.CSLMQVNPVRTKFAQMAESVISYFEDKKPLRLYKKRYEYNEDTASIDAIIDKDNFQEFTGVLFSINPDSIVSINESNLGDMTCLYTLYTSAQLDFEISDRISEGDNFHFEIISIDGSVGYLTLTLKGV.... 134
2 6.000e-40UniRef50_Q0SLB0 Uncharacterized protein n=100 Tax=Borreliaceae TaxID=1643685 RepID=Q0SLB0_BORAP  ali  85  1......MSGVRKRLADMSVRMINVFKDPAPLRFYKGNVVKLENDDSYQRIFDKSKYTEFIGVIIDIKPQELAMLYDSDISYIQGYSKLYTYQDLNYELKDQISISDLVYFEIFSIDSSIGYYTLVLKEFIWTD 127
3 9.000e-38UniRef50_UPI0009FE4187 DUF1506 domain-containing protein n=1 Tax=Borrelia persica TaxID=44448 RepID=UPI0009FE4187  ali  39  5.CTLMQRNNVRTKFTQMALSVISYFEDKKPLRLYQKRYEYNEETASYETVIDRENFKEFTGVLFSINPDSLVTMNESDLSDITCLYKLYTSAQLDFAISDKISEGDNFHFEIVSIDGSVGYLTLILKGV.... 135
4 1.000e-35UniRef50_A0A142JDP1 Uncharacterized protein n=4 Tax=Borrelia TaxID=138 RepID=A0A142JDP1_BORHE  ali  45  2........STRERLASMADRMIGRFREESYFRFYKGTYSHDDEFESPEINFDKNNYTQFVGIIIDISPQELVKINDSNIYDLENLSKLYTNAEINFEIKDRVSL-EGSFFEIIKIDSSVGYKTLILRGLEW.. 123
5 1.000e-34UniRef50_A0A218PER7 Uncharacterized protein n=13 Tax=Borreliaceae TaxID=1643685 RepID=A0A218PER7_BORT9  ali  43  1......MSSIRDRLSKLASRAISYYRNEETLKLYKGTYAYLEDLASHDVTFNKNNFSEFTGVLFSIKADTLVSMPNINLYDIKSLHKLYTTSNLDFELKDRIS-AKSTFYEILSIDSSIGYLTIILKEVEW.. 124
6 1.000e-33UniRef50_UPI0004679F9D DUF1506 domain-containing protein n=1 Tax=Borrelia persica TaxID=44448 RepID=UPI0004679F9D  ali  45  2........NLRSRLSQMANRMINTFREESLLRFYKGIYSKDEEFEDLNINFNKDTYREFVGIIIDITPQELANIETSNLYDSCQMSKLYTNEELDFEIKDRVSLNDN-FYEIINIDGSVGYKTIILRSLEW.. 123
7 5.000e-33UniRef50_W5SF21 Putative cytosolic protein n=8 Tax=Borrelia miyamotoi TaxID=47466 RepID=W5SF21_9SPIR  ali  47  2........NLRNRLSSMAIRMIDKFSQDSLLKFYKGINSRDEEFASNEITFNKANYTEFVGIIIDITPSELTLIEDSGLSDAEHLSKLYTYENLEFNLKCRVSLCE-EYFEIVKIDSSAGYRTLILRSISWT. 124
8 1.000e-31UniRef50_UPI000A118B36 head-tail adaptor protein n=1 Tax=Anaerovibrio sp. JC8 TaxID=1240085 RepID=UPI000A118B36  ali  19  26....................VIIFSRGWPLMKIGKMRYIQYPSDTVDDYGNACDGWENLCTVWADITPLNGREYFQAMQATSETTYKIYIRYIDGISPKMR-AVHNNQVYEIQAVDQRKGYTTLMCKGVE... 139
9 2.000e-28UniRef50_E6KYB5 Phage head-tail adaptor n=18 Tax=Bacteria TaxID=2 RepID=E6KYB5_9PAST  ali  15  1..............................MNIGKLRHRITLQNTVNDYGAAVTTWKNVATVWADVRPLSGREYFSAQQVQSEVTTQIWLRYLDGIMPTMRVKFG-KRTLEIVSVQERNVSLQLMCKEVI... 105
10 3.000e-28UniRef50_A6VNQ5 Phage head-tail adaptor, putative n=6 Tax=Pasteurellaceae TaxID=712 RepID=A6VNQ5_ACTSZ  ali  14  1..............................MNIGKLRHRITLQNTVNDYGAAVTTWKNVATVWADVRPLSGREYFAAQQVQSEVTTQIWLRHLPGIVPTMRVKFSE-RTLEILSVQERNISLQLMCKEVV... 105
11 2.000e-26UniRef50_U4QX24 Uncharacterized protein n=1 Tax=[Clostridium] papyrosolvens C7 TaxID=1330534 RepID=U4QX24_9FIRM  ali  25  1..............................MKLGKMRYRINPINATDEDGFNQETFTEFATVWADITPVSSKEYFGSDQTVEEATSKIYIRHIPGINTLMRIR-CGSRLFDIISIDDRLGMTTIIAREV.... 103
12 5.000e-26UniRef50_A0A1G9R2J0 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Bacillus sp. OK048 TaxID=1882761 RepID=A0A1G9R2J0_9BACI  ali  20  3.............................PGKLDKRITIIGPSGNQNSYGETEGASPVIATVWANIKPLQGREYFWAKQVHAELTSKVIIRYRQDILPNMRIK-HGKRTLEIININEQNRYLELLCKEVI... 106
13 6.000e-26UniRef50_A0A1X1Q341 Putative phage head-tail adaptor n=2 Tax=Anaerovibrio TaxID=82373 RepID=A0A1X1Q341_9FIRM  ali  22  1..............................MKVGKMRYRITLQKPSEEYANPKDEWTDFKEVWADIVPVSGREYFAAEQAMSETQFKIYIRYLDGVTPKMRV-LNGNVAYEILTVDKRSGMLTLMVKVIV... 104
14 4.000e-23UniRef50_A0A177VZ56 Phage head-tail joining protein n=5 Tax=Bacteria TaxID=2 RepID=A0A177VZ56_9GAMM  ali  13  1..............................MRAGLLRHRVTLQNNANNYGEAVEYWQDITTVWARVSPSAGRELFSAQQFYHEISQTVTLRYRSDVTPSLRL-VFDGRYLEILSVDERNRELILACRE..... 103
15 1.000e-22UniRef50_UPI0004E212AF DUF1506 domain-containing protein n=1 Tax=Borreliella garinii TaxID=29519 RepID=UPI0004E212AF  ali  83  1...............................................QRIFDKNEYTEFIGVIIDIKPQELKMLYDSNMSDIQGCSKLYTYQNLNYELKDRISISDSVYYEIFSIDSSIGYFTLVLKEFIWT. 85
16 3.000e-22UniRef50_A0A0K2L8F6 Phage head-tail joining family protein n=1 Tax=Piscirickettsia salmonis TaxID=1238 RepID=A0A0K2L8F6_PISSA  ali  14  1..............................MRAGLLRHRVTLQNNANNYGEALDYWQDITTVWARVSPNAGRELFSAQQFYHEVSQTVTLRYRPNVTPSLRL-VFDGRYLEILSVDERNRELILACRE..... 103
17 4.000e-22UniRef50_E2P6P8 Phage head-tail adaptor, putative n=7 Tax=Pasteurellaceae TaxID=712 RepID=E2P6P8_MANHA  ali  13  1..............................MNIGKLRHRITQRNRPSEYGAVVAEWHDLHTAWAEVKPISGRELNSANQIHSEATMQIWLRYLPNLDHTMRVKFG-NRLFEIVTIQELDRSLLLHCKEL.... 104
18 6.000e-22UniRef50_A0A0M5JIZ3 Uncharacterized protein n=2 Tax=Bacillus sp. FJAT-18017 TaxID=1705566 RepID=A0A0M5JIZ3_9BACI  ali  17  3.............................PGQLNKRVTFLKLSDKRNGYGEVVDNWKKVATVWANVKPLRGRELYSALQTHSEATTKVTIRYRKDIDATMKIQYGTKELQLVINIDEKNRFLELVCKEV.... 108
19 7.000e-22UniRef50_A0A2E0IZX3 Head-tail adaptor protein n=1 Tax=Salinisphaera sp. TaxID=1914330 RepID=A0A2E0IZX3_9GAMM  ali  12  1..............................MSAGQLRHKQARQETRSDYGEVTLDWTDVASVWAHVAPQSGREYFAAQQVQSEVSTRVTIRYRDDVDATMRVTHRGTTYIEAVLPDDGSGFLTLMCSEV.... 105
20 2.000e-21UniRef50_A0A142BH90 Phage head-tail adaptor n=2 Tax=Endozoicomonas montiporae TaxID=1027273 RepID=A0A142BH90_9GAMM  ali  10  1..............................MNPGRLRHRITLQKARNDFGEVIEEWEELGKCWAEVKPVNGKETFVAQQFVAQSTHEVWMRFRKDIKASDRVIDHHGNVLEIIDIGGRGRQLKLLCRQV.... 105
21 3.000e-21UniRef50_A0A0E0TF70 Phage head-tail adaptor n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A0E0TF70_GEOS2  ali  21  5..............................LFRHRITFQKCDENATNENGFDSQRWQDVKTVWAMIKTLQGREYYEAATTQNENTVRFVIRYTTGINPDMRIKYKD-RTFEILSVDEQNITLTIIAKEVV... 109
22 6.000e-21UniRef50_UPI0005501C0E head-tail adaptor protein n=1 Tax=Clostridiales bacterium DRI-13 TaxID=1449126 RepID=UPI0005501C0E  ali  11  1..............................MRAGELRHRITIQKPQNAAGEDVPNYADWVTVWAAVEPLKGREYQEAQKMRAETSYRIKLRYLAGITPEMQVRLRDGRLLEILNIAEQNRELHLMCVEKV... 107
23 1.000e-20UniRef50_I0GRY8 Putative phage head-tail adaptor n=5 Tax=Firmicutes TaxID=1239 RepID=I0GRY8_SELRL  ali  18  5................................RFKYRIEIQINTPTEDAEGNVEEWQTVHTVWADITPVSSKQYFIANQDAAEVTCKIYIRYLADVTPRHRI-VMKSHAYDIESVDIANGFCTIMAKEV.... 103
24 6.000e-20UniRef50_B8DS60 Phage head-tail adaptor n=7 Tax=Desulfovibrionaceae TaxID=194924 RepID=B8DS60_DESVM  ali  14  1..............................MRAGLLRHRITLQAPMHQGGADTTEWQDVTTVWAAVEPIAGREFFAAAQAQSEVTHRVRIRSRSGVRADMRV-LFDGRVLTILSLDG--GEMHLMCKEM.... 103
25 6.000e-20UniRef50_A0A0F9LBP6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9LBP6_9ZZZZ  ali  18  1..............................MRAGKLRHRVTEVLSSSQDAAGQETWSTFASRWASVQPLTGKELFSARQFHADITHRVRMWYLSGVVPKMRIAF-DSRLFNIIYVDERNKELEILCVE..... 103
26 1.000e-19UniRef50_UPI0004963354 head-tail adaptor protein n=1 Tax=Bilophila wadsworthia TaxID=35833 RepID=UPI0004963354  ali  13  1..............................MRAGMLRHRVTIQRQ--EIVFGKKVWENVATVWASLEAMSGREFFASQQAQSEVTQRIRIRYRPDVTADMRV-IHNGKVFNIVAPDNRGRELVLMCREVS... 106
27 1.000e-19UniRef50_A0A1M6SW57 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Paramaledivibacter caminithermalis DSM 15212 TaxID=1121301 RepID=A0A1M6SW5  ali  11  1..............................MKIGELRTIQENILTPDGYGGFSEVWQDKYTVWANIKPLRGREYFEMKKVQSEITHKITIRFRNDINTSNRIKYKGQIFYSIIDIDNRHRFLEIMC....... 101
28 1.000e-18UniRef50_UPI0009E7F224 head-tail adaptor protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI0009E7F224  ali  14  16................................RHKIEIWDLKHTEENEVGEEVQVPKKLYELWADINPVRGKEYFEAQKIVQEMQYKITTRYREGINPAMLVKWGDKELNSIIDISGKEEHMELMCTEKVKTN 118
29 1.000e-18UniRef50_A0A2S1LYA3 Uncharacterized protein n=1 Tax=Candidatus Borrelia tachyglossi TaxID=1964448 RepID=A0A2S1LYA3_9SPIR  ali  25  17.........................RYEQPMFLLKKTLVKNSENATISTKIDHDHLTKFNGIFLPLNKDETVELFGSKIYVNERYAKVYTLDGLNFRPEEQVLV-EKSFLEIMSIQNEIGYTVLMVRRL.... 123
30 2.000e-18UniRef50_A0A1Q8SUZ7 Uncharacterized protein n=1 Tax=Salinicola socius TaxID=404433 RepID=A0A1Q8SUZ7_9GAMM  ali  10  1..............................MRAGRLRHRVTIQRQKDEVGQPVEGWEDVATVWAEVTGLTGREYIASGGEQSEVSMQILMRYRAGIDETMQVIHGGGETYEIISPDARRRQLTLMCKSV.... 110
31 2.000e-18UniRef50_A0A2N2GKW2 Head-tail adaptor protein (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22 TaxID=2013750 RepID=A0A2N2G  ali  21  2.................................................GAEVYEWIQFAKVWADVSPVSGREFASFKQINSEITTKITIRYLAGVTAEMRV-LFDNRIFEINSIQEKNISLLLMCKEV.... 83
32 5.000e-18UniRef50_UPI0004B692F7 hypothetical protein n=1 Tax=Borrelia persica TaxID=44448 RepID=UPI0004B692F7  ali  26  11......................NIARYTQPMFLLKKNLVRNRVDSSYEIQIDKSSPIKFDGVFF-LSGEHNIELFNSNIFVKEIYAKAYTLDVVDFNAGEQLLV-ESDLMEILSVDHRFRYTVLMLKKL.... 123
33 8.000e-18UniRef50_A0A2G2G6R3 Head-tail adaptor protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2G2G6R3_9PROT  ali  17  10....................................IVIQSSIEIPDSFGGVSKSWNDFKTVRASVKPQSAKEFFSAG-VQAEATHKIEVRYVLGLNPKMRILFGTRVFKSILNIQERNKVLHIICTEV.... 103
34 1.000e-17UniRef50_A0A177VZY5 Phage head-tail joining protein n=1 Tax=Piscirickettsiaceae bacterium NZ-RLO1 TaxID=1810840 RepID=A0A177VZY5_9GAMM  ali  15  2....................................................VEYWQDITTVWARVSPSAGRELFSAQQFYHEISQTVTLRYRSDVTP-LLCLVFDGRYLEILSVDERNRELILACRE..... 79
35 2.000e-17UniRef50_A0A0F8YQD9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8YQD9_9ZZZZ  ali  18  1..............................MRAGKLRHRIELQSAKADDGQSIETFTTYATVWADIKPMRGAEAIEAQQQSGQNWFKITVRYNASINIKDRIAF-KSRVFEVLDFEERKIFQELTCTEIV... 105
36 2.000e-17UniRef50_B5RNF1 Uncharacterized conserved protein n=25 Tax=Borrelia TaxID=138 RepID=B5RNF1_BORDL  ali  23  12......................NMKRYTQPMFLFKKNLIKNRTNFSYEIKIDKTTPIKFDGVFLP-SGESNIELFGSNIFVKEIHAKTYTLDILDFNSGEQLLVGND-IMEILSVNQRFRYIVLMLRKL.... 124
37 3.000e-17UniRef50_F4A0G9 Phage head-tail adaptor n=17 Tax=Bacteria TaxID=2 RepID=F4A0G9_MAHA5  ali  15  1..............................MRAGELRHRITIQSAQDKAGQPIEAWQDVVTVWAKIEDLNGREYLAAKQVANEVTTRITIRWRDGIKPTMRI-ITEQRIFDIQSIDGRKQQLELMCKEVI... 106
38 6.000e-17UniRef50_A0A2I7SD08 Head-tail connector complex protein n=2 Tax=root TaxID=1 RepID=A0A2I7SD08_9CAUD  ali  14  3.............................PGKLNKRITIKKPSPNPDGAGGYDDGLADVATIWANIRPLRGREYWQSQQTQAEVTHSIMIRYRKDIERSHVVSYSGRFFQHIINVDEANRTLILHCVEKI... 105
39 6.000e-17UniRef50_UPI0007739116 head-tail adaptor protein n=3 Tax=Clostridiaceae TaxID=31979 RepID=UPI0007739116  ali  13  9...................................KIVIQKYENAVNDNGFEEEAWVDFKTVWAAISNLYGKEYFEAAAVQAEKTVKFTIRFTKDIDESMRIMFQGKQ-YNITSIDNANKFIEIKAMEV.... 104
40 1.000e-16UniRef50_A0A0C5AE87 Head-tail adaptor n=19 Tax=root TaxID=1 RepID=A0A0C5AE87_9CAUD  ali  13  3.............................PGKLNKRITIKKPSPNPDGAGGYDDGLADVATIWANIRPLRGREYWQSQQTQAEVTHSIMIRYRKDIDRSHVVSYSGRLFQHIINVDEANRTLILHCVEKI... 105
41 2.000e-16UniRef50_UPI0009EBF2FF head-tail adaptor protein n=1 Tax=Bacillus sp. FJAT-29814 TaxID=1729688 RepID=UPI0009EBF2FF  ali  15  4..........RHALYQFVIGVILLTRYRNPGEFRHVISFQKKSGVQNSYGEKSNDWVDVIKSRAGIYPVSGKEFFAAETINSEVTHKVNLRYLSGITPDMRIKFGE-RFFSIISVQEKNIELQLLCKELI... 126
42 2.000e-16UniRef50_A0A150FQZ3 Phage head-tail adaptor n=4 Tax=Clostridiales TaxID=186802 RepID=A0A150FQZ3_CLOPD  ali  18  31....................................................EEGWEEVATVWAAIEPLRGREFFQAQQAQAEVTHKVTIRYRKDVDKSQIIKYADRRLDYIINIDEENKYLEIFCTE..... 108
43 3.000e-16UniRef50_A0A0C1YKC2 Uncharacterized protein n=1 Tax=Noviherbaspirillum autotrophicum TaxID=709839 RepID=A0A0C1YKC2_9BURK  ali  11  1..............................MRAGKLRHKVTIERYSDEIGQPVQTWETVGTFPASVEPINGREYFAASAAQSEVTTKIRMRYQAGILSSDRITHGATVYLSVINPEMRNEELVLMCKS..... 103
44 4.000e-16UniRef50_A0A2C3KU07 Head-tail adaptor protein n=1 Tax=Bacillus pseudomycoides TaxID=64104 RepID=A0A2C3KU07_9BACI  ali  14  1..............................MTPGKKNKRIILQKRSTDYETDEEGWQDVITIWAAVKPLKGREFWQAASVNAENTIRIEIRYRKDITNDMRI-LYDNRILEIIDVDEKHREIHLMCKEV.... 106
45 4.000e-16UniRef50_B4ETF1 Phage protein n=37 Tax=Morganellaceae TaxID=1903414 RepID=B4ETF1_PROMH  ali  11  3.............................PGRLRHTIHIQKSVLAPDAISGNDVIWTDHATVRAAIMPYQGREYFQAQQVQSEATTRIIIRYIADIDTSMRIVWGKRIFISIIDPYERHRELQLMCKE..... 104
46 9.000e-16UniRef50_A0A1B7JCP2 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1B7JCP2_PROHU  ali  10  3.............................PGRLRHNIKIQKPTLAPDAISGNEVIWEDFLKIRASIAPYQGREYFQAQQVQSEASTRILIRYVSGINTSMRVVYGERVFISIIDPKEQHRELQLMCKE..... 104
47 2.000e-15UniRef50_I0BIR5 Head-tail adaptor protein n=4 Tax=Paenibacillus mucilaginosus TaxID=61624 RepID=I0BIR5_9BACL  ali  12  3.............................PAKYNRRIRILQPVRGEDNEGIPVITWIPTISLWAAVKPLRGREYFQAAAINQENTLRVEIRYRTGLTSEMRVQYAGKLYNAILDPDEAHRELHLMCLEV.... 104
48 2.000e-15UniRef50_UPI0008ECFE29 head-tail adaptor protein n=1 Tax=Proteus mirabilis TaxID=584 RepID=UPI0008ECFE29  ali  11  1..............................MNPGRLRHNIKIQKSTLAPGAISGNWEDFLKVRASIAPYQGREYFQAQQVQSEASTRIVIRYVSGINTSMRIVYGERIFISIIDPKEQHRELQLMCKE..... 104
49 3.000e-15UniRef50_UPI000B9E255B head-tail adaptor protein n=4 Tax=Bacteria TaxID=2 RepID=UPI000B9E255B  ali  12  1..............................MKAGKLRHRILIQKKEDEYNEEQEKWVTVCSCRAEVNPLQGKEFFAAQQINNKITVKITMRYRNGISTAMRIIFKKRIFNILVSINEKNRELQLMCEE..... 103
50 4.000e-15UniRef50_O50936 Uncharacterized protein n=22 Tax=Borreliella TaxID=64895 RepID=O50936_BORBU  ali  29  18..........................YSQELFFCKFRVIKDPINASYETRFKSSDTVVFKGMFLLINPEEVVEIEGVNIFDQNSYAKVYTLENLEFEYGDLVKIFDD-VYSILGVQKSLNYNTLVLRS..... 122
51 4.000e-15UniRef50_A0A0U1NRD1 Phage head-tail adaptor n=2 Tax=Bacillus sp. LF1 TaxID=1499688 RepID=A0A0U1NRD1_9BACI  ali  12  4........................FKYKPNLNSGLFRHRIDPEKDVDEAGQPLDEWIPVAETWADIFQLRGRELFSAQQVNAEVTTRITIRYRTGIDRTMK-AVYEGKVFEFLYVDYAKKELQIMCKE..... 115
52 5.000e-15UniRef50_A0A0F9NNN0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9NNN0_9ZZZZ  ali  1..............................MKAGDLRHRVTIQKRANSMNELVPTFSDLETVWAAVEPLSGREFFQAKQANSEVAGKVRIRYMDGILPTMRVKFGNRNLLSIIAPKENRRELILMYTE..... 103
53 7.000e-15UniRef50_A0A0L6JT55 Phage head-tail adaptor n=2 Tax=Pseudobacteroides cellulosolvens TaxID=35825 RepID=A0A0L6JT55_9FIRM  ali  11  20...........................KPLLSIGKLRHRITIQSYSNSFGEEVKVWTDYAVVSASVEPMSGKELFTAQQLHAETTTQIILRYLGGLNTSMRV-LFNNKIYDILHVSERNIAIYLLCKE..... 125
54 8.000e-15UniRef50_A0A0S8G4T5 Uncharacterized protein n=2 Tax=unclassified Acidithiobacillales TaxID=1703362 RepID=A0A0S8G4T5_9PROT  ali  15  1..............................MDAGKLRHKIQLQTASSRSGSKRKSYTVYATIWAAIEPLSGRELEQAHILNRELTHKVTIRYRSGVEAAHRVKFGAR----IFDVNEQNRWLELLCKEL.... 104
55 1.000e-14UniRef50_A0A0D0HTA8 Bacteriophage head-tail adaptor n=4 Tax=Anoxybacillus TaxID=150247 RepID=A0A0D0HTA8_9BACI  ali  19  1................MARRLTNQFKH--------RITIQQQTEEQSENGFLSQEWQDRHHLWAAIKTLRGREYYEAATTQNENTVRFVVRYTAEITPDMRIQY-KGRTFEILSVDECNVTMTIVAKEV.... 107
56 1.000e-14UniRef50_A0A142VBR7 Phage head-tail adaptor protein n=3 Tax=root TaxID=1 RepID=A0A142VBR7_9CHLR  ali  14  1..............................MNIGQLRIIETPTTSQDMAGGVTQTWSTFLTVWASVEPLSGHKLFQAKQANADITGIVRIRYQAGIEPTMRIKYG-SRTLSIVSIGERNIELQIMYKE..... 103
57 1.000e-14UniRef50_A0A0F9BCB8 Uncharacterized protein n=3 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9BCB8_9ZZZZ  ali  11  4..............................MEAGKLRHKIDIQTTKDSYGEDIKTWASFHKSFAEVRPLRGKEYFDTQQIVPEVDNKITIRYKSGIAPTMRVAWG-SRTYDITNPDERNIMLEILAVE..... 106
58 1.000e-14UniRef50_A0A1Y2SAF0 Head-tail adaptor n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y2SAF0_9GAMM  ali  11  1..............................MKAGRLRHRVMIQKNEPEYGSVINHWVDVATVWAEVNAIGGRELVASGAVLSEATVRIWLRYRDDITTTHRIVYQGGKTFAIVAVDAKHTRLELLCKGGVK.. 110
59 1.000e-14UniRef50_A0A0F8YNN6 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0F8YNN6_9ZZZZ  ali  14  5.............................LLGRHRITIEQQDTGTANAGGEIIPTWSDYASVPVEILPQRGREFYQAQQVQAEITHLIRIRYLPGVTSKMRAIFGTRTLLDVRNVDERSREMLLMCKE..... 106
60 2.000e-14UniRef50_E1QK06 Phage head-tail adaptor n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=E1QK06_DESB2  ali  26....................................................EETWADLATVWARVEALKGEEYFAAAQMQNSVSHRVTMRYRADLTPTHRLVFEGRTLIEAVLPDERKSRLVIMCTE..... 102
61 2.000e-14UniRef50_A6M954 Putative head-tail adaptor n=17 Tax=root TaxID=1 RepID=A6M954_9VIRU  ali  10  3.............................PGQFRHKITLMKLVTTQDEIGNTIEEWQPVRTCWAAIKTVNGREYFAAASVQAERTYRFIIRYTPGINETMKIDYQG-RLFDIQSVDEGKKTLTIIATERVAAD 108
62 3.000e-14UniRef50_A0A1H3BTK5 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1H3BTK5_9BACL  ali  11  1..............................MEVGKLRHRVTIQKPTIEGGGWSEGWEDWVKGWASIEPLSGKELLEAQQVASTVTHRIRMRYRAGVQPTMRVLFGD-RIFEVIDPMERGRELELMAEEKV... 105
63 3.000e-14UniRef50_A0A0E9LDS0 Phage head-tail adaptor n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A0E9LDS0_9BURK  ali  13  28.....................................................DELVAVGTVWASVQPLKGREYLAAMAAQSEVTTRITMRYRPGVTPDLKVT-HDGKQYEIESVNSQGVELVLMCKAL.... 105
64 4.000e-14UniRef50_A0A0E9L9L2 Phage head-tail adaptor n=3 Tax=Comamonadaceae TaxID=80864 RepID=A0A0E9L9L2_9BURK  ali  12  1..............................MNAGKLDQRVTVERFTSTVGTPIESWAPLFTCWAEVSPLVGREYIAAQAAVSEVTAKIRMRFRPWMTAEDRV-IHDGTIYNIVSVRSEHRELHLMCKAV.... 104
65 4.000e-14UniRef50_A0A086D7P6 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium MFB021 TaxID=1492922 RepID=A0A086D7P6_9GAMM  ali  14  1..............................MRAGRLRHRVTLMRQGEGRGAPTTDWAEVATVWAEVTGISAREFVASGGEQNQATYQILMRYRRGVDDTMRVEHGNGEVYEIVSPDARRTQLMLMCKTV.... 108
66 4.000e-14UniRef50_UPI00040953DF head-tail adaptor protein n=1 Tax=Desulfovirgula thermocuniculi TaxID=348842 RepID=UPI00040953DF  ali  10  1..............................MNAGELRHRVTFQKRSLDATGGLTAWADYVTVWAKVEDLSGRDYFQAQMLASLVTTRITVRWRPDLDPHMRVRFGDRLFKAILDPDGRRRVLQVMCAE..... 103
67 6.000e-14UniRef50_A0A258ZJH3 Uncharacterized protein n=1 Tax=Gallionellales bacterium 24-53-125 TaxID=1970510 RepID=A0A258ZJH3_9PROT  ali  11  7...............................KLNRRIIIQTVGTTQDAIGEPGGDPTTFATVWASVEDLTGREFIAAGGTQNEAQTKIAIRYLAGVLPAMRVLDG-STAYNIESVLGQKKSLLLMCKRL.... 104
68 7.000e-14UniRef50_A0A0F8ZUL9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8ZUL9_9ZZZZ  ali  13  1..............................MQAGQLRHRVEVQASSNSRGNTTKTWTTEVTIWAGIEPLSGRELIEAQEVVADATHRVKIRYLADVTPKKRFLFGTRELYSVQNIDERNRELVLTCVE..... 102
69 7.000e-14UniRef50_D8GLP7 Putative phage head-tail adaptor n=38 Tax=root TaxID=1 RepID=D8GLP7_CLOLD  ali  11  9...................................KIIFQKLTATTNENGFEVEVWEDYSTVWAAVSNLIGREYFAAAAVQAEKTVKFTIRYLQGITDDMRILFQDKQ-YNITFIDNRNKYIEIKALEVE... 105
70 8.000e-14UniRef50_A0A2D6FK77 Head-tail adaptor protein n=1 Tax=Parcubacteria group bacterium TaxID=2026774 RepID=A0A2D6FK77_9BACT  ali  13  1..............................MRARKLRHRVTIQSNTESRDATRNTYATLKTVWANVGTLSTKEYFSESQRNNEVTSKIRIRYLSTVTTAMRV-VHGSDTYEIINPDGKNCYLDLMCK...... 103
71 1.000e-13UniRef50_A0A1H6XRH9 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Azotobacter TaxID=352 RepID=A0A1H6XRH9_9GAMM  ali  1..............................MRVGSLRHRLTRQTGTDDFGQPLAGWEDIATVWASIEPISGRELLAAQQTQGEITHRIRCRYRDGLSTASRALFKERVFQSVINPRELNASLEILANE..... 103
72 2.000e-13UniRef50_K0HZ48 Phage head-tail adaptor n=10 Tax=Comamonadaceae TaxID=80864 RepID=K0HZ48_9BURK  ali  6................................LDQRVTVERFTTTYDELGQPIETWAPLFTCWAAVEPLTGREYLAAQAAVSEVTARIRMRFRPWMTAEDRV-VHNGTTYGIVDVRSGNRELVLMCKAV.... 104
73 2.000e-13UniRef50_F0SQR0 Phage head-tail adaptor n=1 Tax=Rubinisphaera brasiliensis (strain ATCC 49424 / DSM 5305 / JCM 21570 / NBRC 103401 / IFAM 1448) TaxID  ali  16  2..............................LAAGQLRHLVTIQERSTTRGQVVEDWTDGDTVWAAVQPLSGKELEHAQAIKAQINTKIVIRFHAGVTPASRIKFHD-RLFNVVSTDELNVELICMCEEVV... 107
74 2.000e-13UniRef50_UPI000785DAD6 head-tail adaptor protein n=1 Tax=Collimonas pratensis TaxID=279113 RepID=UPI000785DAD6  ali  11  9...................................KTVIQSPPSGQDDDGNPRTEWLLVGKPYAKKEDLSGRELFAAQAAQSEVTTRFRIRYRTGVTAKMRL-LCDGVIYNIEAVDGRKRELQLMCSS..... 103
75 2.000e-13UniRef50_A0A1B7JLY3 Uncharacterized protein n=6 Tax=Morganellaceae TaxID=1903414 RepID=A0A1B7JLY3_PROHU  ali  14  1..............................MKAGRMNQRVTIQRSPDALSGNEVMWFDIAKVWAEVKGIRGREYFSSQQTQSETTVRVWFRYFPDITTADRLMFSDGNHWDIKSIDKAKGSMEIICEGVE... 109
76 2.000e-13UniRef50_A0A023CJH7 Phage head-tail adaptor n=1 Tax=Parageobacillus genomosp. 1 TaxID=1295642 RepID=A0A023CJH7_9BACI  ali  11  26.....................................HFQEKKTVKDDEGNSVTQWNTVFTVWGSVEGLRGREYLAAGALSSEATYRIRIRYRKGVRPSMRI-LYEERVFEIIDINEEHKEIEIMCKEI.... 119
77 2.000e-13UniRef50_A0A1V5Z576 Phage head-tail joining protein n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5Z576_9BACT :_  ali  15  1..............................MQAGKLRHRIVIQQATVTYGEQALSWSTFATVWAEVKPVSGGESFDMGQDRASVSHEIRIRYLAGVKPNMRVQFTRDEVFKIHSILERGAEMVLSCEE..... 108
78 2.000e-13UniRef50_A0A2E7INY8 Head-tail adaptor protein n=1 Tax=Spongiibacteraceae bacterium TaxID=2026793 RepID=A0A2E7INY8_9GAMM  ali  11  2..............................IRAGKFRNRITIQNFTDAIGAEVKSWATFDAVWAAVEPRSGRELFN-EQFTGEVDTLIRIRYRSGINEKMRIVWG-SRTYQIKAVQARHKELHLMCREL.... 104
79 2.000e-13UniRef50_A0A1H3N7D9 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Thermoactinomyces sp. DSM 45892 TaxID=1882753 RepID=A0A1H3N7D9_9BACL  ali  10  10...................................RIRILDRVITRDDEGSPIEDWTTKVTLWAEVNPLSGREYYQAAAVQSENDVKIRIRYRADISTDMRVQF-NQKLYDIQSVNSEHRELHLTVKEVV... 106
80 2.000e-13UniRef50_A0A0F9R9E5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9R9E5_9ZZZZ  ali  10  1..............................MRSGQLNNRITIQGTKNSVGQKIESWGTLATVWGRVRSLTGSERFAAQQLVVELSYEITIRFRTDINETHRIVLTDGQTLDIQSPDGRRRELKILCKE..... 104
81 2.000e-13UniRef50_A0A1I6URN2 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Marininema halotolerans TaxID=1155944 RepID=A0A1I6URN2_9BACL  ali  15  9.........................RRVKLMKFEKL---------VDGSGNPVEDWVLFMEVWAGVEPIRGREYFAAAAVQSETMIRVRIRYRSGVNAGFRVHYDDRVLDVVGVIDDKHQELELMCKEVV... 106
82 3.000e-13UniRef50_A0A1B7KWY0 Head-tail adaptor protein n=4 Tax=Bacilli TaxID=91061 RepID=A0A1B7KWY0_GEOTM  ali  11  5..............................LFRHRIKLLKMVVTE-DEIGRQIEDWQAVRTCWAAIKTVSGREYFAAASIQAERTYRFIIRYTPGIDETMRIDYQGRQ-FDIQSVDERKKTLTIIATERVTAD 108
83 3.000e-13UniRef50_UPI00082C4737 head-tail adaptor protein n=1 Tax=Alicyclobacillus shizuokensis TaxID=392014 RepID=UPI00082C4737  ali  11  10...................................RITIQQQVTVTDDEGFTTTTWQDVATVWAAVEPMNARVFYEAAAVNAERDTLIRIRYRPGVTQDMRV-VYGQRVFSIVDPEERHREIQLMCREVV... 108
84 4.000e-13UniRef50_D9SSF9 Phage head-tail adaptor n=49 Tax=Firmicutes TaxID=1239 RepID=D9SSF9_CLOC7  ali  15  30..............................................NENGFEIEAWEDYKTFWSAISNLNGREYFAAAVVQAENTVKFTIRYTPNIETTMRILFKDKK-YNITSIDNANKFIEIKALEV.... 114
85 4.000e-13UniRef50_UPI0002C413DF head-tail adaptor protein n=3 Tax=Enterobacterales TaxID=91347 RepID=UPI0002C413DF  ali  18  2.....................................................NTWRDVATLWAEVAPLSAREFIAAQASQGEVTTRITIRYREGVTRKHRILFRGRIYIEGVLPDPRSGYLTLPCSE..... 79
86 6.000e-13UniRef50_A0A0J5FPC9 Uncharacterized protein n=18 Tax=Enterobacterales TaxID=91347 RepID=A0A0J5FPC9_9GAMM  ali  1..............................MQAGRLRHRITLQSFTQPSGQPMQEWQDVSTVWAEVKYISGRELLASGAELSETTVRVWLRYRPDVTSAARL-VFRGQVYDIQAVDPKLTQLELLCKQGVK.. 105
87 7.000e-13UniRef50_A0A0F9J8X5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9J8X5_9ZZZZ  ali  10  1..............................MRAGKLITIQKLAGTLDDLGTEVQTWTDVVSRWASIEPLTGRETFARQQQQAELSHLIRLHYVPDITAKMRV-VCGTRTFDIQAVINKDRYLDLLVTE..... 104
88 8.000e-13UniRef50_A0A2S9GZC7 Putative phage head-tail adaptor n=2 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A2S9GZC7_9BURK  ali  11  6................................LNRRITIQAASTKQDALGQPIDGWSEVATVWAGITDINGREFIAAAAVQNTVQTKIIIRYRAGITPAMRV-LHKDSIYNIEAVLGQNVWLNLMCKEV.... 103
89 1.000e-12UniRef50_E1XA96 Phage head-tail adaptor, putative n=23 Tax=Bacteria TaxID=2 RepID=E1XA96_HAEI1  ali  1...................................MISLQKQVNEQNDYGGIVSKWKTVANIRAAVEPLQGREFFSGAVPLNENTVRIRIRYGTNVDNTMRVKYGNRSLMNIIDSKEAHKELQLICKEL.... 96
90 1.000e-12UniRef50_UPI00037045BD head-tail adaptor protein n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI00037045BD  ali  13  1................................MDKRVAIQSVTRVSDGQGGFTDSWATDATVWANVNPTKGWEKFQAQQTQTPVTHKITIRYRSGITTKQRVLFGSRVFNEALNPDEANAFLEL......... 94
91 1.000e-12UniRef50_UPI000D6BF94B head-tail adaptor protein n=1 Tax=Tumebacillus permanentifrigoris TaxID=378543 RepID=UPI000D6BF94B  ali  13  1..............................MKVGELNRRVTLQKNTVE-------WQDVVTVWAAVDPLSVQATIAARQADQPYTHKITIRYRDGVSTDMRV-IYKRKVFEISAVEESHRFLQLLCVEL.... 94
92 1.000e-12UniRef50_A0A2W4LV29 Head-tail adaptor protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4LV29_9FIRM  ali  18  31.......................................................WQPIATVWAAVEALSGRTYFEAQQSHIQADHRITIRWRRGIEPRQLVRF-DGREFEIQAVLDRTGELQLLCQEL.... 106
93 1.000e-12UniRef50_A0A1G5S2N3 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Acidaminobacter TaxID=65402 RepID=A0A1G5S2N3_9FIRM  ali  12  2..............................LNAGDLNYRITIEQNTSSDGTRVENWVAVVSVWADYQAKSGREFFSAQRFNAEVSALFRIRYRSDVNVKMRIRY-KTRVFEILFMNDTSGELALGCREVV... 106
94 2.000e-12UniRef50_F5SDD4 Phage head-tail adaptor n=1 Tax=Desmospora sp. 8437 TaxID=997346 RepID=F5SDD4_9BACL  ali  11  7................................RHRGTIQEHKKTRVEGGGF-ETQWVDIAAVWFSLEPLSGEEQVIAQQLQATVSHRIRIRYRAGVKPHHRLKMGNRIFNSVIDPDERRRQLEIMASE..... 103
95 2.000e-12UniRef50_A0A2E7DCA4 Head-tail adaptor n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E7DCA4_9PROT  ali  17  2...........................TQTHRIGKLRHIQADGSTRDAHNQITPSWSTISTVWANVEPLRGKGLHDADMVQTEITHKVTMRYLSTVTEKHRI-VHDSRNLQIINVDESDWILELMCKEI.... 110
96 2.000e-12UniRef50_A0A160MAJ2 Head-tail adaptor protein n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A160MAJ2_9BACI  ali  15  8.................................HRITFQQFIESET-ENGFPVEGWEDIITVYAAIRTLKGNEFYEAATTQNENNSRFIIRYRKGISPDMQIQMRDGRTFEIISLNEENKTLTIHAREV.... 105
97 3.000e-12UniRef50_A0A1E4WJY6 Head-tail adaptor protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4WJY6_9PSED  ali  16  1..............................MRAGDLRHRITLQRPEYTTGEMTPSWVEVAKIWASVEPVSVNQFVSAATNQSEVSARIVIRYRKGIDPTMRILHRDK-IYNIEGIDKVSGYLTLPCSE..... 105
98 3.000e-12UniRef50_A0A0F9B6T0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9B6T0_9ZZZZ  ali  11  7..................................KHRVRIQEATEGSADVLNEKTWSDLVTVWGAVLPQSGREFYRAMQVNAEVTHLVSIRYRSDVDETNRLVVGGRTLTSVVNVDEADEELLITCVE..... 104
99 3.000e-12UniRef50_A0A1H3I5Y2 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Thermoactinomyces sp. DSM 45892 TaxID=1882753 RepID=A0A1H3I5Y2_9BACL  ali  10  1..............................MKSGRLRHRVTIQGQEDGLGGTTQRWEGITSVWARVTPLNGNEMAIAQQIQPSTTHRVEMRYRKGVTSHMRLLFQGRRL-EILSVQELQKEIHLLCKEV.... 105
100 3.000e-12UniRef50_A0A0F9QAR6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9QAR6_9ZZZZ  ali  15  5...............................KRQKRVKVQSKQTVRDAAGGAVHTWVTDDTIWAHIAPATGKELYAGEQVKAEVTHKITIRYYSAMTTVKRLLFGTRIFNFIKNIDERNEYQEMLCKEVV... 105
101 4.000e-12UniRef50_K0G566 Phage head-tail adaptor n=5 Tax=Actinobacillus TaxID=713 RepID=K0G566_ACTSU  ali  1.......................MARMVRAGKFDKVIEIQKPISKKSDYGSPIREWQTVKQIRASIEPLQGREYFSGPFQMGENITRVRIRYQPDINRKMRVKYGEQILYSVIDSKERHEEIQLMCKE..... 109
102 4.000e-12UniRef50_A0A1F8PVR6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_52_11 TaxID=1797646 RepID=A0A1F8PVR6_9CHLR  ali  14  12.........................EYPHYIAIERLSAPKTQDESGEELSAD-GYWETLAEGWAKIEPVSGRDYFQNLQVQSALTHKVELRFVDGVTPRDRVSFGNRTFNAIINPEERGRQLELMCSE..... 116
103 5.000e-12UniRef50_U5CG62 Head-tail adaptor protein n=2 Tax=Caldanaerobacter subterraneus TaxID=911092 RepID=U5CG62_CALSX  ali  14  9...................................KIQILSKQTIVDKEGFPKEDYVVFANVWAKVTPTQGREFYQAAAVQAEKDMKFTIRYRKGITNDMQVKYNNQIYKSIIDWNEEHKYIDLICEAII... 105
104 6.000e-12UniRef50_A0A1H8EHN7 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Paenibacillus sp. OV219 TaxID=1884377 RepID=A0A1H8EHN7_9BACL  ali  11  18.......................................QKQSITTNDYGEQIPQWDDVVTVKAGIYPVSGKDYISAVEVNSEITTKVNLRYVPGLSADMRIMFGTRIFIAIINFQEMNKELQVMCKEF.... 109
105 6.000e-12UniRef50_A0A0F9L533 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9L533_9ZZZZ  ali  12  2.....................................TIQKLDGTLDAAGVENQTWVDVATVRAAIEPLRGDERFTAQQEVAQVTTRIRMRFLKDVVAKMRVQFIDTRLYDIINVGQRDREMHLMCKETV... 105
106 6.000e-12UniRef50_B1JZH3 Phage head-tail adaptor n=4 Tax=Burkholderia cepacia complex TaxID=87882 RepID=B1JZH3_BURCC  ali  14  1..............................MKAGRLREVVVLEGEENENGEPLDRWAPIATVSAAVEPLNGREFFASARLNAEVTTRIRIRYYEGLTKWDRVAHGDLRYRSIIDPQSQRKEMVLMC....... 101
107 7.000e-12UniRef50_A0A0G3CLF0 Uncharacterized protein n=1 Tax=Pragia fontium TaxID=82985 RepID=A0A0G3CLF0_9GAMM  ali  1..............................MRIGKLRHRVTLEDVRDPVGQLLSQWGDVCTVWAEVHELSGRERISASAEQSETTALIKIRYRKGITTDMRIVHGSGEIYDILAADDRRTYIDLMCSSGVK.. 110
108 8.000e-12UniRef50_A0A1N6QB81 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Marinobacterium stanieri TaxID=49186 RepID=A0A1N6QB81_9GAMM  ali  11  1..............................MRSGRLNAQVTFEGTKDEYGHPTEDWAPIPGIWANVKPITGRERWANQHMTNTATLAVTIRYRDDIKPEMRIRFGDMRL-EIINVDNRNRELVITCEE..... 107
109 9.000e-12UniRef50_UPI00047305BC head-tail adaptor protein n=1 Tax=Herminiimonas sp. CN TaxID=1349818 RepID=UPI00047305BC  ali  11  8..................................RRITLQQRSTAQDAYGAQVDTWTTLGDLWASIEPLTGRELMAAQAVQSEVSHKITIRYQAQFVAAMRISYQG-RMFNIMDIEEAHKIIEILATE..... 108
110 1.000e-11UniRef50_UPI0008076296 head-tail adaptor protein n=2 Tax=Candidatus Glomeribacter gigasporarum TaxID=132144 RepID=UPI0008076296  ali  1..............................MRAGRLRCRVTLERPVETAGAKKLRWQPVGDFWAAVEPIRGREYFSANQIRDEVDAKITLRTPRDIEITPQLRVHQATLYSIIDVKSAHRTLELMCK...... 104
111 2.000e-11UniRef50_A0A1D9GM21 Head-tail adaptor protein n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1D9GM21_9ALTE  ali  13  2.............................PLNPGKLRHRITIEKPDPATGEMIDGWQLVDEVWAAKRPSSAREFKQSQAGQSEITGEFQIRYRDDVDATMRI-LHKGKVYNIEGVDNESGMEWLTL....... 103
112 2.000e-11UniRef50_A0A0M4G6F1 Head-tail adaptor protein n=2 Tax=Bacillus TaxID=55087 RepID=A0A0M4G6F1_9BACI  ali  14  1..............................MNPGKFRHRIIFQGAVDEEGFPLPDWADVMKAWAMAKTVSGREYHEASATQNERTTRFIIRYRNGLSEDMRVKYQD-RIFEIEAIDEVRKTLTVVCKEAV... 108
113 2.000e-11UniRef50_A0A0C5DRN7 Uncharacterized protein n=49 Tax=Proteobacteria TaxID=1224 RepID=A0A0C5DRN7_9PSED  ali  15  1..............................MQAGKLKHRVQIQSQDPQTGEQTDQWVEFAKVWASIEDLSARDFIAAQAGQSEAKSRVVIRYRKGITAAMRVVLDDGAVCGIVGPSSRKEYLTLLVTS..... 108
114 2.000e-11UniRef50_A0A2G0Q4L8 Head-tail adaptor n=20 Tax=Xenorhabdus TaxID=626 RepID=A0A2G0Q4L8_9GAMM  ali  12  1..............................MRAGRLRHRVTIRKNEASRGEVLNNWVDLATVWAEVKAISRRELVASGAVFSEATVRIWLRYRADVTTANSITFHGGTAFSIMAVDAKYTRLELLCKG..... 107
115 2.000e-11UniRef50_A0A0F5R974 Uncharacterized protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A0F5R974_9BACL  ali  11  3.............................PAKLNRRITIQREAGGTDAEGIPIVGWEDFLTIWAAERALNGREYFAAAAVNAENTVRYEIRRRHDIKPSMRVKDGERILDIIAVMDDPFGQTRLMCKEAV... 107
116 2.000e-11UniRef50_A0A2T5J0D3 SPP1 family predicted phage head-tail adaptor n=2 Tax=Agitococcus lubricus TaxID=1077255 RepID=A0A2T5J0D3_9LACT  ali  1..............................MQAGKLRHRVTFQRLTKSRGLEKQEWVDVCRVWARVSSLSGKYLFAAQQNHSEVTGTIDLRYRKDINAELRAMYEGKIYHAVIDPELRHKELKLMVSE..... 103
117 3.000e-11UniRef50_UPI000832655A head-tail adaptor protein n=1 Tax=Desulfotomaculum intricatum TaxID=1285191 RepID=UPI000832655A  ali  14  1..............................MRTGKLRHIHALTVVEDDIGNQTETWAKVAETWATIEPLKGDERWLAAYAQATTTHRVTMRPGVAVHPSNRI-IFNGRTLEILDIEERGRELQLMCKELV... 106
118 3.000e-11UniRef50_UPI00099043C5 head-tail adaptor protein n=1 Tax=Haemophilus massiliensis TaxID=1461579 RepID=UPI00099043C5  ali  12  1....................MIKAGTYNKVITLQQRNYDKEREVN-NRNTAREPIWEDVATIRASIEPLQGREYFSGPFQMGENIIRIRIRYLVNITNKMRVKYGDRDVYSVIDGKEAHRELQLMCKE..... 109
119 3.000e-11UniRef50_A0A220MGJ7 Uncharacterized protein n=3 Tax=Brevibacillus TaxID=55080 RepID=A0A220MGJ7_9BACL  ali  15  7...............................RLNKRITIRKQTWIENSMKEKKQTWIDYATVWAAIEPLRGQESLVAQKSESTVTTRIRIRFREGIEPSMMIDYRGISFMYIIHPEFNKRELQLMCKE..... 105
120 3.000e-11UniRef50_A0A2T6NCG5 Head-tail adaptor protein n=1 Tax=gamma proteobacterium symbiont of Ctena orbiculata TaxID=1968598 RepID=A0A2T6NCG5_9GAMM  ali  13  1..............................MISGRLKHAITIEQPTGDRGQPTIVWSTFADVYADIYSVTGKEWFEAHQVNSSVTTKIVIRYLDGVRPDMRVKHGD-TVYNIIAVLNQENPTTLMC....... 101
121 4.000e-11UniRef50_UPI000A346DF0 hypothetical protein n=1 Tax=Gilliamella apicola TaxID=1196095 RepID=UPI000A346DF0  ali  17  1..............................MIIGRLRQRIILQFESYRDPFGQKGWKDVATVWAEVKAVTGKELMLSQQEMSSTTMRVYIRYLNNIDTSYRIKLHNTQYLNIKAVDAKQTYLELLCEG..... 105
122 4.000e-11UniRef50_A0A1Y1RDK3 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 TaxID=1971726 RepID=A0A1Y1RDK3_9BACT  ali  16  1..............................MNTGRLRHRLALQVETQSQGATGESYATDTTVWGALSPVSGREMEQARQISEEITYKAVIRYYSSLTTEYRI-LYDSRVFEIANIQERNIYQILLLKEV.... 104
123 4.000e-11UniRef50_A0A0F9MPL2 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9MPL2_9ZZZZ  ali  15  3............................KEMQIGKLRHIKIQSGTVSQDVAGEETWILEAERWASIEPLSGQERFLEAQIQADVTHKIGVRMAFTVTPKMRVLFGSRIFLSVLNVGERDVKLKLICRE..... 107
124 6.000e-11UniRef50_A0A0Q3TLG1 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A0Q3TLG1_9BACI  ali  18  9.................................GEYRHIITFQDVQNSYGENIKDWVDIEGLIAGIYPISGKEFFAAGAVNSEVTHKVNMRYMPNITPDMRIKYFDNRYFELIAPQEKNVEIQLLCKEVI... 122
125 6.000e-11UniRef50_A0A176JB70 Uncharacterized protein n=1 Tax=Bacillus sp. SJS TaxID=1423321 RepID=A0A176JB70_9BACI  ali  15  3.............................PGQLNSKISIKGLTRTSDNAGGYEDKFEVIKYVWAFIKPISGREYYQAQQSQSVITHTFVVRYDAEIDRTQVIEYQGRKFQYIINVDEQNRYLEI......... 99
126 6.000e-11UniRef50_V4RHQ3 Putative head-tail adaptor n=2 Tax=Lutibaculum TaxID=1358438 RepID=V4RHQ3_9RHIZ  ali  6.........................................PVTADDGSGGTTASWNLVTTLWARVEPLSAVERLTAERLEAAVTHRVTIRHRAGVTHRMRFVLGT-RVLEIRGIEERHRYLELTCEEVS... 96
127 6.000e-11UniRef50_A6F0J7 Head-tail adaptor n=12 Tax=Bacteria TaxID=2 RepID=A6F0J7_9ALTE  ali  11  1..............................MRAGKLRHRITIQKPDPTTGEMGPGWETVKSVWAEKRPSSAREFKQSQAGQSEITGEFQIRYREGIDATMRI-LHKGKVYNIEGVDNESGRQWLTL....... 101
128 6.000e-11UniRef50_A0A1V4X9F2 Phage head-tail joining protein n=1 Tax=Syntrophorhabdus sp. PtaB.Bin184 TaxID=1811701 RepID=A0A1V4X9F2_9DELT  ali  5...............................RLDRRLTLQRRTLTENDYGEAVETWTDLATVWAEKIPVRGAERYAAMQTVAEVEERFKIRYRKDLTPLDRV-VCNGITYDVLGV.................. 87
129 6.000e-11UniRef50_A0A127SE51 Phage head-tail joining protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A127SE51_9BACT  ali  12  5..............................MLAPRLRHRVDIQNQDSNTGAVTDAWTDYDTVAAEIWPMSGREFVAAQSIQAGVNTKITIRYQTGIEPRMRVK-HGSDIYNIKAVDPTLRYITLLC....... 107
130 7.000e-11UniRef50_A0A098SUY2 Head-tail adaptor protein n=12 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A098SUY2_9PSED  ali  10  1..............................MRAGDLRHRVTFEEKTNDPVSNEESWVEFATVWAAIRDLSVREFISAQSTQSEVTCRIVTRYRDGFDAAMR-ARHEGRIYNLHGI.................. 88
131 9.000e-11UniRef50_A0A098F352 Phage-like protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A098F352_9BACI  ali  18  31.................................................GWPTTEWTEYVTVWAGIETQKGRRVFEAAAVQMQDLKKISIRYRADLNDSMRIR-HKGQDYDIFSMDENNEWYTILAREV.... 112
132 1.000e-10UniRef50_A0A1G8IK64 Phage head-tail adaptor, putative, SPP1 family n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A1G8IK64_9BACI  ali  11  3.............................PAKARQRITFLNPPEGTDENGFPNKEWTEHVTVWAELRTLKGRSFYEAAQNQLENSRHFIIRYRKDLNDKMRVRWNGQDHELIENVDGMNREMDVRVKAV.... 105
133 1.000e-10UniRef50_A0A1F2XH69 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A1F2XH69_9ACTN  ali  12  6................................LDRRLTIEQYTEAQDAYGEAIKTWSVLETVWAQVTPVRGSERYVAQQVSGEAETRFRIRYRTDVTDKMRL-YCEDVYYNILEIGRREG-LEIMAKAFV... 104
134 1.000e-10UniRef50_UPI0003068D81 head-tail adaptor protein n=5 Tax=Gemmataceae TaxID=1914233 RepID=UPI0003068D81  ali  11  22.....................................................ESWVDGATVWASIEPYSGYQKFQAMQLQTPVTHKISMRYRPDVATGTRLKYGDRFFSEALNVNEEGRFLAI......... 94
135 1.000e-10UniRef50_A0A2T7SRS9 Uncharacterized protein n=5 Tax=Burkholderiales TaxID=80840 RepID=A0A2T7SRS9_9BURK  ali  14  15......................................IQQPTVAKDALGAPTQTWSDIATVWADIQPISGREARIADRIAAVVSHQITMRYRSEFNSQMRVLFRD-RIFSILNVDEANVSVMLLASE..... 111
136 2.000e-10UniRef50_A0A2H0QI87 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_44_7 TaxID=1973901 RepID=A0A2H0QI87_9  ali  12  9..................................RMRHRITIENTENESGGFTTSWDEVDIVWAEILPIRADEKLRFGKVNAEISHKITIRYLANLTEDMRIDFGGRYFNSIINPQERNEYLEIIAEE..... 107
137 2.000e-10UniRef50_A0A2E0EK80 Head-tail adaptor n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E0EK80_9RICK  ali  13  29.......................................................WNTLTTVWAKVEPLRGEERLQANQLQERITYRIIMRYRDDINARMRVLWGNKVLNSVFNADMHRRYLTLEASE..... 103
138 2.000e-10UniRef50_I4D3F6 Phage head-tail adaptor, putative, SPP1 family n=3 Tax=Clostridiales TaxID=186802 RepID=I4D3F6_DESAJ  ali  1..............................MNPGILRHKINILTTTEGTNEAGDTPSVYKTVWASVSPVSGKDYLEAKKLQAELTYKFILRYTSGVTPDMQIEFKGRIFLDILNPLEINETIEIMAIERVIKN 108
139 2.000e-10UniRef50_A0A240U3T8 Head-tail adaptor protein n=2 Tax=Acidovorax carolinensis TaxID=553814 RepID=A0A240U3T8_9BURK  ali  11  6................................LDQRVTVERLQGGFDELGQPIESWAPLFTCWAAVEPLVGREYLAAAALVAEVTARIRMRYRPGITAADRV-IHDGKVYGITSVHSSRRELVLMCRAI.... 104
140 2.000e-10UniRef50_A0A1X9M6I3 Phage head-tail joining protein n=5 Tax=Bacillus TaxID=55087 RepID=A0A1X9M6I3_9BACI  ali  15  8.............................PARFDKRIQILEYTKTSDGGGGYEEVLIPILNVWANIHPLHGRELYQAQQIQAQVSHKITIRYSNKVNRSH-VVFFNDKYYNIVNVNEANKTLEL......... 104
141 2.000e-10UniRef50_UPI000A1CA2CC head-tail adaptor protein n=1 Tax=Tuberibacillus sp. Marseille-P3662 TaxID=1965358 RepID=UPI000A1CA2CC  ali  14  7..................................KYRIVLQEFKPVDNDGIITEKWVDTKSIWAQKQGVSGREYFAAASVNAEQTVKWHIRYRNDVTPGMRIREGD-VSYDIKSVIDETGELVLMTEAVV... 105
142 2.000e-10UniRef50_A0A1N6KU93 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Singulisphaera sp. GP187 TaxID=1882752 RepID=A0A1N6KU93_9BACT  ali  10  2............................KPGTLRKRVTLQSATEAPSTDGQMIPTWADVGTYWASIRTPTGREVFNAAQIHATLTHVLEMRYIGPIEPTQRFTF-KSRTYDINNVDERNREYVIYVTEVVKAS 108
143 2.000e-10UniRef50_R9J0F6 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium 3-1 TaxID=397288 RepID=R9J0F6_9FIRM  ali  12  9...............................KLNKRITFQKQIETEDAMGQSAQVWEDVKTVWADFYPIRAGEYQEAEQKREEVTYKAKLRYIPGINAAMRIAFRGRYFLNVINVDEGNYRLELECTEYI... 110
144 2.000e-10UniRef50_UPI000BA28E29 head-tail adaptor protein n=1 Tax=Pseudomonas lundensis TaxID=86185 RepID=UPI000BA28E29  ali  1..............................MRAGPLRHRLSYAEIKDELGQPAKEWVDMGKVWAEISIPSGRMYLAASQMQAQVSAEINIRYRKDVKAGQRLR-HNTTLYEIIAPTNHRDMLKLMCKTVTLND 107
145 3.000e-10UniRef50_A0A2G2AQ19 Head-tail adaptor protein n=1 Tax=Sulfurimonas sp. TaxID=2022749 RepID=A0A2G2AQ19_9HELI  ali  12  1..............................MRSGSLRHKITVQSTQNDYGEVFKDWVDLRTVYSTIVPLNAKEFFK-NGVQAEVTHRVEMRYFDGVAPKMQL-IYKTRIFSIINVRELHKTLHLICKEVI... 104
146 3.000e-10UniRef50_A0A089L397 Phage head-tail adaptor n=11 Tax=Bacillales TaxID=1385 RepID=A0A089L397_9BACL  ali  13  1..............................MEAGKLNRRISIPDEKDSYGEPLDVWPEVCKVWAGIHPLNGRDRLTAAQVNADVTTRVVIRDRSGIDRTMMVKYKNQE-FEIIQPDYDRRELQLMCKE..... 105
147 4.000e-10UniRef50_UPI000BB1D35D head-tail adaptor protein n=1 Tax=Clostridioides difficile TaxID=1496 RepID=UPI000BB1D35D  ali  18  5...............................KLNKRITIQIKEQTNDENGFTVNDWIDFKIVWANIKNINGKEFFQAQQAQSKANKKATIRYLKRVSLKYRVKYKENTYNIIYSIQEKNQYIELLLEG..... 111
148 4.000e-10UniRef50_B8FNY9 Phage head-tail adaptor n=13 Tax=root TaxID=1 RepID=B8FNY9_DESHD  ali  11  9..................................RITLQVLSDKTTNENGFEDERYQDHVTIWAAVYPLKGSEFWTAKTTYNKNVVKFICRYIPGVNADMQIKY-NNRIFDIIDVDERHKWLQIMGEEVV... 109
149 4.000e-10UniRef50_UPI000C77430A head-tail adaptor protein n=1 Tax=Clostridiales bacterium mt7 TaxID=1631345 RepID=UPI000C77430A  ali  15  5.............................PGKLNKKISIKKEVSISDGGGGQKADYELIANTWASINTLSGREFWQAQQMQAEVSHKVSIRYRKGIKRT-QVVFFGERKFDIQYIEEANVKLEMYCLE..... 105
150 4.000e-10UniRef50_A0A2A2SR81 Head-tail adaptor protein n=11 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2A2SR81_KLEPN  ali  10  1..............................MRAGKMTIQQFVSHQDPNTGSVTKEWRDVATVWGEIDSVSGRELVAAQAEQSEMTVRIWIRYRKGVTTKNRLTCTEKTIYDIKAVDADRTRLEIMCTG..... 108
151 4.000e-10UniRef50_UPI0009E5A78E head-tail adaptor protein n=2 Tax=Bacillales TaxID=1385 RepID=UPI0009E5A78E  ali  14  1..............................MKIESLRHRIRIQ--QRQILGAAEKWADLVSVWSAIEPLSAKEKIDRADIEQSVTHKITIRYRKGITSTMRV-VYKERIFSIESVTERREMLHLICEEL.... 99
152 4.000e-10UniRef50_A0A0J6I653 Uncharacterized protein n=28 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A0J6I653_9PSED  ali  1..............................MRAGDLRHRCTLLSYKDELGQPSKEWIDLGKLWAEINIPSGRMYMAASQMQAQVSAEINIRYRKDVRAGQRLR-HHATLYEIIAPSNQRDMLKLMCKTV.... 103
153 4.000e-10UniRef50_A0A139SVQ6 Head-tail adaptor protein (Fragment) n=2 Tax=Ventosimonas gracilis TaxID=1680762 RepID=A0A139SVQ6_9GAMM  ali  11  1..............................MQAGKLRHRVEIQRAINQSGANIETWQTIARVWASLEPLSARDFIAAQAARNQITARAVIRYRKQITAGMRLIHASGHYL....................... 84
154 5.000e-10UniRef50_D6XZF0 Phage head-tail adaptor n=4 Tax=Firmicutes TaxID=1239 RepID=D6XZF0_BACIE  ali  11  1..............................MDIGDLRHRITLNVETNENGFEVVTWQEVDEVWAHVANLTARDFFSASRVQMQHTVLFTIRYHPDVDESLRIRFLEK-VYRLTGIDQKNRFMELKALEV.... 104
155 5.000e-10UniRef50_A0A2C8EXE5 Putative Head-tail adaptor n=4 Tax=Pseudomonas TaxID=286 RepID=A0A2C8EXE5_9PSED  ali  11  1..............................MRAGRLRHRVSVQRLTDDIGGWQEVWLEEGQTWAEIRPVSGRAWMAAAQEQREVTAEVVIRPRQGIESGMRIVKGETLFLEAALLDYSRCELKLMCKSV.... 103
156 5.000e-10UniRef50_UPI0009FA42BF head-tail adaptor protein n=1 Tax=Hyphomicrobium sp. CS1GBMeth3 TaxID=1892845 RepID=UPI0009FA42BF  ali  12  5................................IGEMRHRLALQQPHAEAGGTTRTWALVAEVWGAIRPLSGNEVVEADGVHGQVSHEIWIRHRTGVVPEMRFALG-ARVFEIIDVNEQRRFLRCLAEE..... 105
157 5.000e-10UniRef50_K5A2T7 Bacteriophage head-tail adaptor protein n=9 Tax=Paenibacillus TaxID=44249 RepID=K5A2T7_PAEAL  ali  11  7........................FKYSPKLNTGRLRIVIQKKGGSKDYPIPNQPWKDVITVWASRETLRGREFFAAAAVQHEKTIRFKIRYREDIKAGMRIME-KGRIYEI..................... 98
158 5.000e-10UniRef50_K2JDT3 Phage head-tail adaptor n=1 Tax=Oceanibaculum indicum P24 TaxID=1207063 RepID=K2JDT3_9PROT  ali  13  10...................................RRLRIERKAVSRDYLAEVVSWQEVATVWASKRDLSGREFFAADAVQSEVTTEITIRWRAGIGPELRLVL-DGAAYDIESVTEIGRREGLLLR...... 101
159 6.000e-10UniRef50_A0A1H4J341 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Terriglobus roseus TaxID=392734 RepID=A0A1H4J341_9BACT  ali  12  7................................LNRRITIQSQATTQDAYGQQVNTWDDLLTCWASIKAVTSKEVYAASGYTSQVSHKITIRYTVAISSKMRV-LYETRLFHIQAINEGREQLDLLCLEV.... 106
160 7.000e-10UniRef50_A0A1J0EK51 Uncharacterized protein n=1 Tax=Pseudomonas frederiksbergensis TaxID=104087 RepID=A0A1J0EK51_9PSED  ali  15  1..............................MQAGKLRYIEKPVDVRDKLGGFIRTWVEVSREWVDIESVSGKEFMAAQAPQAQTIYKITLRYRADLVSSWRIREGVK-LYEITAVDSRRRRIELMCK...... 101
161 7.000e-10UniRef50_A0A2E7K2Y1 Uncharacterized protein n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E7K2Y1_9RICK  ali  11  24......................................IETPVEVSDGMGGTVRNWQLLAEAWAEISPLRGREALAQFQLESQISHRIVLRWRANLDASMRV-VHGGRVFNILNVNEADRMLEVLAEE..... 115
162 7.000e-10UniRef50_A0A0F9LHW5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9LHW5_9ZZZZ  ali  16  3......................................IESSADAQDEYGEESKVWANEESVFASIQPLRGQELLEFQQINAELTHRIIIRHTSNATVAKRIKFGT-RIFDINNIDERNTMQELLCKEKV... 96
163 7.000e-10UniRef50_A0A1X7N042 Phage head-tail adaptor, putative, SPP1 family n=4 Tax=Azospirillum TaxID=191 RepID=A0A1X7N042_AZOLI  ali  12  7................................LDQRIRIERPDNTPNGRGGVVKGWAEVATVWARVRPVSGRELAASGQIEAAAVYRIAIRRRTDVTAGCRIVWQGK.......................... 81
164 8.000e-10UniRef50_A0A0F9EJ76 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9EJ76_9ZZZZ  ali  13  26.....................ISEEEEEMAIRAGQFRVIIQVQATGKDAWGEKSTWSTVATVWASVVPVRGAERVAADQKEGVLTHKVNMRYRSDVSPLNRITFDGGRVLDIENVGNRGAELEIQCLE..... 139
165 8.000e-10UniRef50_C3X7X2 Putative phage head-tail adaptor n=1 Tax=Oxalobacter formigenes OXCC13 TaxID=556269 RepID=C3X7X2_OXAFO  ali  11  8...................................RRVIIEKMVEVKDEFGASLQWIEYCTVWASVSDMTGREFIAAQSIKNEVTTRIIIRKRSDINIKIRIKF-EGETYDVIAIADKNTMMTLMCKK..... 101
166 9.000e-10UniRef50_D3V359 Putative head-tail adaptor n=208 Tax=root TaxID=1 RepID=D3V359_XENBS  ali  1..............................MNIGRLRHRIDIQGRSPSGGVVNERYT-VATVWAEAKFISGRELVAAKTVLSESLVRFWIRYRADIDTTMAVVFQGKTYIQAAMPDNKLTLLELLCQEGVK.. 105
167 9.000e-10UniRef50_A4WB25 Phage head-tail adaptor, putative n=105 Tax=Enterobacterales TaxID=91347 RepID=A4WB25_ENT38  ali  10  1..............................MQAGRLRNRVTILNFTDSTGQPVEKWEEGKTVWAEVKGISGRELVAAGAENSVATIRVWIRFRRDITAASRLRVETGPFKAILNIDARGIQLEILCK...... 107
168 1.000e-09UniRef50_A0A0S7ZA15 Uncharacterized protein n=1 Tax=Gemmatimonas sp. SG8_23 TaxID=1703356 RepID=A0A0S7ZA15_9BACT  ali  12  3...............................RIGTLRHRILDSVSRNEIGGKVDNWIDVATVWGEVQELRGREYLASREFHAEITARIFIRYRPGLEPLRWRAVHDGRTYDIHHVIDRAG............. 99
169 1.000e-09UniRef50_UPI000A277EB1 head-tail adaptor protein n=1 Tax=Kiloniella majae TaxID=1938558 RepID=UPI000A277EB1  ali  13  1..............................MRIGKLRERISLQLAGDGGGGQVETWNEVAKVWANVKPLSGREQIIANKETGTTLYRITIRSR-DISSSWRVVWGTKTLNEILEGDSSQQFLT.......... 97
170 1.000e-09UniRef50_UPI000DA1E4AC head-tail adaptor protein n=1 Tax=Salinicola peritrichatus TaxID=1267424 RepID=UPI000DA1E4AC  ali  1..............................MRAGKLRHLVTIQNFSNQYGEVITEWIDGPRIRASVEPLRGREYFAAAQVNAETTYRVRCRYHPELNATSKRLTVQGMMFEILDVELKHEWMEIIC....... 105
171 1.000e-09UniRef50_A0A1Q8UX33 Uncharacterized protein n=1 Tax=Bacillus pseudofirmus TaxID=79885 RepID=A0A1Q8UX33_BACPF  ali  12  11.....................................IIQTKVKIPDDGGGYEEDWIDGEKVWSKVTPLSGVSLYRAKQMNAEITHEVKLRYRELSKEENRFKYKSDRILEIINVDELNEELLVTCKEVI... 106
172 1.000e-09UniRef50_UPI000494E227 head-tail adaptor protein n=1 Tax=alpha proteobacterium Mf 1.05b.01 TaxID=1282876 RepID=UPI000494E227  ali  12  22.................................................GGATESWTELATVWAAMHPKSGQEREAADRLGTRATTDITIRYRGDVTTDMRFR-HGGRHFNIRAVDGRRRWLKCTCEE..... 102
173 1.000e-09UniRef50_I3DCK3 Putative phage head-tail adaptor n=42 Tax=Pasteurellaceae TaxID=712 RepID=I3DCK3_9PAST  ali  15  4....................MIKAGKYNKVITIQRRN--KEKEKARNYGETRKTEWEDVATVHASVEPIQGREYFSGPFQLGEDIIRIRIRYLPNINRRMRVKYGE-RLLEINAVKEEHKELQLMCKE..... 111
174 1.000e-09UniRef50_A0A235FA52 Uncharacterized protein n=1 Tax=Fictibacillus aquaticus TaxID=2021314 RepID=A0A235FA52_9BACI  ali  13  39.................................................GNNVPSYTTAFTVWGSMEGIRGREMVASGALSGEVTYRIRIRYRKDIQTDMRIQQGD-RFFEIIDMNEEHKEIEIMCKEL.... 120
175 1.000e-09UniRef50_A0A0A1H6L9 Phage head-tail adaptor n=2 Tax=Burkholderiales bacterium GJ-E10 TaxID=1469502 RepID=A0A0A1H6L9_9BURK  ali  8...............................RLNQRITIQAMTRVRGPLGGHDETWSDFAVVWAEVTDLSGREIFNAKAMGSAVTKRITIRYRTDILAAMRVVFSDGSMARIEWI.................. 91
176 1.000e-09UniRef50_UPI000A00540D head-tail adaptor protein n=1 Tax=Syntrophorhabdus aromaticivorans TaxID=328301 RepID=UPI000A00540D  ali  11  61...............................RLDRRITLQRKTVVENSYGEPIETWVDLATVWAEYLPAGGVERYAATQMVAEADTRWRIRYRADVTPVDRLSYAGRIH........................ 138
177 1.000e-09UniRef50_A0A0C5ED33 Uncharacterized protein n=8 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A0C5ED33_9PSED  ali  13  1..............................MLAGKLRYIERPVDVRDQYGGFIRTWEPVGREWADIESISGSEFIAAQAPQSQTVFRIRIRYRDDLVSSWRIREGGK-VYEITAVDARRRRIELMCK...... 101
178 2.000e-09UniRef50_A0A1N6D729 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Halomonas meridiana TaxID=29570 RepID=A0A1N6D729_9GAMM  ali  1..............................MRAGRLRDRLTLQDVKDAIGGTRKDWFEVGTVWCEVRGVSGKAFLSASAEQAEVTAEILMRYRPDVQSGMRL-VRGAEIYTIVTPDPKRRQLLCMCTQGVK.. 105
179 2.000e-09UniRef50_B2JL17 Phage head-tail adaptor n=3 Tax=Burkholderiaceae TaxID=119060 RepID=B2JL17_PARP8  ali  10  1..............................MQAGRLRYRLTFEKPVDETGEVVDQWVKAFTVWGSLEPLSGREYLSASEFRAGITTRVRVRWRSDLDPAMRIR-CDEVTYDIAAI.................. 88
180 2.000e-09UniRef50_A0A2M6VU13 Uncharacterized protein n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A2M6VU13_9BURK  ali  9................................LNRRITLQRQSTAQDSYGGPVRTWTDLGTFWAEIQPLSGRELESSQRMASEVSHQIVVRYQAIFADTRQVALYRSRIFNILNDEERNVLVTLLASE..... 111
181 2.000e-09UniRef50_A0A127R0R5 Phage head-tail joining family protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A127R0R5_9BURK  ali  13  11....................................................................LSGRELFAAQAAQSEVTTRFRIRYRTGVTAKMRL-LCDGVIYNIEAVDGRKRELQLMCSS..... 72
182 2.000e-09UniRef50_A0A2N6VVN5 Head-tail adaptor protein n=1 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2N6VVN5_BACME  ali  15  1..............................MNAGKLDKRITFQHFTLKDGFSNEVWEDFKTVYAMVRTISGREFYQAASVQNEYTTRFVIRYSAGIDENMRILYR-NRTFEIVSINERDETLTIMVKEL.... 105
183 3.000e-09UniRef50_A0A1G8NHK4 Phage head-tail adaptor, putative, SPP1 family n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1G8NHK4_9PSED  ali  1..............................MQIGKLRHPIDIQKPEYESGEMYETWVRVAREWARAEGISGKEFVAAAAEQSSTTVRVTLRYREDLTTSMRFKHVGK-IYNIKAIDNDHKLLVCMCEE..... 103
184 3.000e-09UniRef50_A0A1M4UYP1 Phage head-tail adaptor, putative, SPP1 family n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1M4UYP1_9RHIZ  ali  13  6............................EPGWIAHRIIIEQPARTADDAGGSVTTWSMLAAVWAAIEPVRAAVDTGSDRLGSVITHRVTIRHRDDVVAGMRIRHRGRLLATVTDPDERRRFLLIEARE..... 107
185 3.000e-09UniRef50_A0A2N2MUZ1 Head-tail adaptor protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-5 TaxID=2013728 RepID=A0A2N2MUZ1_9CHLR  ali  17  8................................LSQRITIQQPTVTYDAYNTEIQSWQTFATVWSLKKCQITREFYSAQKVNAEATDLFIIRFMQGITTKMRISY-NGRIYNILGVDDQGGK-----REIIW.. 100
186 3.000e-09UniRef50_A0A2N5GVJ7 Head-tail adaptor protein n=1 Tax=Bacillus sp. T33-2 TaxID=2054168 RepID=A0A2N5GVJ7_9BACI  ali  17  6...............................FRHRITIQKLEEGSTNENGFDSSNWKDVMTVWAATETLSNYEFYEAATTMAKNTLTFIIRYKPDLNSDMRI-VFKERDFEIVSMNEENRLLLIVGREVV... 113
187 3.000e-09UniRef50_A0A1V4IF15 Phage head-tail joining protein n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4IF15_9CLOT  ali  11  30........................................................QDYKTVWAAVTTLYGLEYEEAKKLREELTYRIVTRYFSDVNDEMLIKFRNKTFLDILNTDSTDNQLILMCREKVDT. 107
188 4.000e-09UniRef50_A0A0K1XGK9 Uncharacterized protein n=1 Tax=Oblitimonas alkaliphila TaxID=1697053 RepID=A0A0K1XGK9_9GAMM  ali  14  1..............................MRAGRLKHRVMIQKQVPETGAMNLSWKNWKSLWASIEHLSVKDSFAAQAAGAETVARVVIRAGPKIEPGGRIIHGDHVFSVIGAIPDAIRYLTILVKE..... 105
189 4.000e-09UniRef50_UPI00064A85D4 head-tail adaptor protein n=2 Tax=Enterobacteriaceae TaxID=543 RepID=UPI00064A85D4  ali  10  8..................................RRVTVQNYVSRQSPSGQVIKEWKDLCTVWADIADVSGKEIIASGAIMNQITTRIWIRYRPDILAGYRLLWRSGMAYSVDAVDKDHTRLELLCKG..... 107
190 4.000e-09UniRef50_X0WGD7 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0WGD7_9ZZZZ  ali  12  1..............................MNIGKMNRRIRIETAKDSFGQPIKTWVELKSVWANVWPVSNIERFEAAQVNRQVELRMHIHYRTDVTEQMRI-LYDGDYYDIQGIKE................ 89
191 4.000e-09UniRef50_A5F9K3 Predicted bacteriophage head-tail adaptor n=5 Tax=Clostridium TaxID=1485 RepID=A5F9K3_CLOK5  ali  3.......................YSNQAQTAQLNNRIILQKYVTVTNDNDFSIKEWQDYKPIWAAAKNLHGEEYYAAGEEQSKKTAIFTIRYRRDIDESMRIKFGKDRIYEITFIDD................ 104
192 5.000e-09UniRef50_UPI000476B831 head-tail adaptor protein n=1 Tax=Acidobacteriaceae bacterium KBS 96 TaxID=1267535 RepID=UPI000476B831  ali  13  15....................................RVTLLQQTAGTDASGAIVTWTPFVTTWAAIDPVRGTDVIRAGQDTTQLYLTITIRWQTGILPSMRVQGNNGTYIAIENPGERNILLVLNC....... 106
193 5.000e-09UniRef50_A0A011PAU1 Putative phage head-tail adaptor n=7 Tax=Betaproteobacteria TaxID=28216 RepID=A0A011PAU1_9PROT  ali  12  9..................................RKRITLQQQSPSLDYGQQTVTWTDVATVWASLEPSVGRELMAAQAVSLDQPTTITIRWQPAFVAAMRVAY-NGRIFNIHSVEERNTLLTLLASE..... 110
194 5.000e-09UniRef50_A0A1C6J6L6 Bacteriophage head-tail adaptor n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6J6L6_9FIRM  ali  16  8...............................KLNKRITVMCLQDAEDEMGQSKKKLQVKAVVWGTLYPVRGAEFYELQKIQSRVTHKCYLRYREDIDTNSILVYAGKQYTSVLDVGLEHKMLEIMCCE..... 106
195 5.000e-09UniRef50_A0A1H0PFN2 Phage head-tail adaptor, putative, SPP1 family n=15 Tax=Rhizobiales TaxID=356 RepID=A0A1H0PFN2_9RHIZ  ali  13  9.................................GKLAHELQLERAVDDVNGSVEEWREIATLWAHIEPAGAATVLFGEQSLTEVTHRITMRSRDDLQSGMRLR-RGSRFFQLITIDETGRY--LICR...... 105
196 6.000e-09UniRef50_A0A2W4RSU7 Head-tail adaptor protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4RSU7_9PROT  ali  12  4..............................LRIGALRRRLRLEAPSYEGGGAIVAWNPVTTLWAEVIPLSGGEELRADGLQSIAKYEVRIRYRADISPEMRF-VFDGRVLEIQDIEGRRRWLSCLCEEL.... 107
197 6.000e-09UniRef50_A0A0J5FXE0 Uncharacterized protein (Fragment) n=2 Tax=Xenorhabdus khoisanae TaxID=880157 RepID=A0A0J5FXE0_9GAMM  ali  1..............................MRAGALRHRVTLQNFTQPSGQRMQVWQDIATVWAEVKYISGRELMASGAVFTEATVRIWLRYRADITTANRIFYQGD.......................... 80
198 6.000e-09UniRef50_B0VTV2 Putative head-tail adaptor n=72 Tax=Proteobacteria TaxID=1224 RepID=B0VTV2_ACIBS  ali  10  34................................RHRVTIQHYTEGGRDDDGFPIEGWSEYKKLWAKVTPLSAKDLIAAQADQSEVVARMKIRYREDITTKMQVLW-KGRIFSIKS................... 115
199 6.000e-09UniRef50_A0A0Q5HK98 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q5HK98_9BURK  ali  6...............................RLNKRVALQQLVAGKDASGAPTEVWANVITIWAGIRDLTGRQYVAAGGTQNAVQTEIEIRHRAGIVPAMRV-VHGTDVYDIEAVDQQGRALKLMCKK..... 107
200 6.000e-09UniRef50_A0A2D9CAF3 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D9CAF3_9BACT  ali  15  5................................IGKMRYRVKVENATNTRDAGSQSYSPVTFIYANIKPTNANSTYRQGMVQEKVTHEVTIRYMNNISTNSRVSYGSRNFNGIVNVDERDRFLKLLCEE..... 105
201 7.000e-09UniRef50_A0A1B9N5T3 Uncharacterized protein n=6 Tax=Gilliamella TaxID=1193503 RepID=A0A1B9N5T3_9GAMM  ali  11  1..............................MKAGRLRNEVTQIKRTDELGQLVNEWVDVCTVRAEIRDVSGKEYQSSQAEQVQTDCKILIRYRNDITADMR-ALCNGTYYDIKAVDVKRTRLELPCQK..... 102
202 8.000e-09UniRef50_A0A2A4S739 Head-tail adaptor protein n=1 Tax=Rhodobiaceae bacterium TaxID=2026785 RepID=A0A2A4S739_9RHIZ  ali  14  2................................IGRLRHRLVLEXLSTSXGGVADEWQEVATLWAALSPTRGFEEXRGGKPEAQMGHKILIRYRPDLVPTMRFREGT-RIFEIQNIEERSAYQEVRCVE..... 102
203 8.000e-09UniRef50_W8ECU9 Head-tail adaptor n=2 Tax=unclassified Siphoviridae TaxID=196894 RepID=W8ECU9_9CAUD  ali  1..............................MDINRLRHRVTIEGTTNDGGGNRPNWVPIATVWAEVRPANGSEVTIAEKRGQELTHIVTIRYRPGIDTKHRINFKGRIFHYIINKEERNIELEIHCRE..... 105
204 8.000e-09UniRef50_A0A1M5WGM7 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Desulfosporosinus lacus DSM 15449 TaxID=1121420 RepID=A0A1M5WGM7_9FIRM  ali  14  1..............................MKSEELRLQLTIETSTDTAGGQILSWATFATVRAAKKHSSSREFYAAQKINSEITDLYTIRYRTGINAKMR-GICDGKTYDILDPDGKRREIYILCKVVE... 105
205 9.000e-09UniRef50_R6MQB9 Phage head-tail adaptor n=2 Tax=Firmicutes TaxID=1239 RepID=R6MQB9_9FIRM  ali  17  69...........................................................YGVRAYVSPATGREYDESQKIRAETTYNVVTRYFNGIESNMKILYGAKVFVSVLDINESHRELKIVCSEV.... 140
206 9.000e-09UniRef50_UPI000A01B465 DUF1506 domain-containing protein n=1 Tax=Borrelia hispanica TaxID=40835 RepID=UPI000A01B465  ali  57  1.........................................................................MYDLNISDVKGLSKLYTNADLNFEIKDRISL-DDTFFEIIKIDSSVGYQTLILRNIKW.. 57
207 1.000e-08UniRef50_L5N065 Phage head-tail adaptor n=3 Tax=Bacillales TaxID=1385 RepID=L5N065_9BACL  ali  9...............................KMNRRITIQEKQTVVDPEGIPTESWADVATLWAAREPLGAREFFSAAAINAEKTVRYAIRYRPGILPSMRVDKQDGLTYEIKAV.................. 95
208 1.000e-08UniRef50_A0A1N7G4G6 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Moraxella cuniculi DSM 21768 TaxID=1122245 RepID=A0A1N7G4G6_9GAMM  ali  13  1..............................MKAGVLRHRIQPTTTRSATGMVKSSHEPVKTIWGQFSHLSAKDVLTAKAAGTDVQARLTIRYQTGIDHTMQVEHGGQR-YEIVGADNRTGYLTLLLKEVS... 107
209 1.000e-08UniRef50_A0A2D7X324 Head-tail adaptor n=1 Tax=Marinobacter sp. TaxID=50741 RepID=A0A2D7X324_9ALTE  ali  17  1..............................MGIGSMRHIQAQSRANDSAGGVRRTYSTLATVQGKIEPTXGNTNFFGDQIEGRTTHKITIRYRSDVTTKHRISYSDSKIFKILNIGTRDRYLEMLCTEGVAT. 109
210 1.000e-08UniRef50_UPI0008FD8482 head-tail adaptor n=2 Tax=Enterobacterales TaxID=91347 RepID=UPI0008FD8482  ali  1..............................MRAGGLKHRITLEQSQGPLGEPIKRWVDYATIWAEVKGISGRELLATGSLSSEATVRIWIRYRSDVKQGHRVKY............................. 77
211 1.000e-08UniRef50_A0A2D9BMP7 Head-tail adaptor protein n=1 Tax=Marinobacter sp. TaxID=50741 RepID=A0A2D9BMP7_9ALTE  ali  11  1..............................MNIGKMRHRALQPTQDPVTGEMGEGWADLATVWGSIDSVTGREFMAASAEQATTTHRITIYYRDDLKPDMRL-FSAPVEYQIKAINNDRSLISIMCEVME... 105
212 1.000e-08UniRef50_UPI000BBC317C head-tail adaptor protein n=1 Tax=Clostridium cochlearium TaxID=1494 RepID=UPI000BBC317C  ali  14  3..............................MNPGKFRHRVTIQKYIPVDGLTTTKWTDWRTVWASINSLFGREFWEAKQCNMENTINITIRYSKDFKDLDRIKW-DNKIYNINFIDNENKTLTIKCTEV.... 110
213 1.000e-08UniRef50_UPI00057CB7AE head-tail adaptor protein n=2 Tax=Clostridium TaxID=1485 RepID=UPI00057CB7AE  ali  11  43..............................................................WAEINPVRGREYLENKKLQAELTYKVTIRYTNQINTDMIIRFKNKLLNDIINPYESNRWLEIMCVEKVENN 115
214 1.000e-08UniRef50_Q5P0B9 Phage related protein (Head-tail adaptor) n=303 Tax=root TaxID=1 RepID=Q5P0B9_AROAE  ali  10  3..............................LNAGRLRHRVTIQAPTPETGAMTTTWTALATVAAAIEPLSVKDYIAAQTLKSKVAVRIVIRYRADLKHDMRLIGPDGTLY....................... 86
215 1.000e-08UniRef50_A0A0C3HZ02 Uncharacterized protein n=10 Tax=Halomonas TaxID=2745 RepID=A0A0C3HZ02_9GAMM  ali  10  1..............................MRIGKKRDQVVLEGDRTDSGATPEGWQPGGKVWAEVEQLRGRTLFAAQEANAETTARIRMRYRADIAAALRLRHGGMTYLEGRPIDGRRTELELMCHE..... 109
216 1.000e-08UniRef50_UPI000372C41B head-tail adaptor protein n=2 Tax=Brachymonas chironomi TaxID=491919 RepID=UPI000372C41B  ali  11  27.....................................................EGWETVGTFWAAVLPLTGREVIAADAVTAIGDVRIIMRYRPGITPADRLTHKGKQ-MNITAVIDRHRTLELLCKVV.... 104
217 1.000e-08UniRef50_A0A202BD19 Uncharacterized protein n=2 Tax=Chromobacterium TaxID=535 RepID=A0A202BD19_CHRVL  ali  11  5...............................RLDKRVVFQKQVKGRDSAGQPTNTWQDLPAVWANVLFVSGREYISADRQQQESVASIRIRKRP-VTASMRVRFSG-EVYEISAVDQSGEYLDVAVKVI.... 102
218 1.000e-08UniRef50_A0A1E8PU28 Uncharacterized protein n=2 Tax=Janthinobacterium lividum TaxID=29581 RepID=A0A1E8PU28_9BURK  ali  12  8...................................KRVRIQERGPELDRSVAPSNWIDVMTVWASVEPMTGRERMLAQANHSELTHTVTIRYQTQFADAMKMTVYGTRIFNIQSVDEAHRWLNLSCSE..... 111
219 1.000e-08UniRef50_A0A2G2CXQ9 Head-tail adaptor protein n=1 Tax=Sphingopyxis sp. TaxID=1908224 RepID=A0A2G2CXQ9_9SPHN  ali  11  1..............................MRAGRLNKRVTFQAPTDSYSDRKTEWGDIATQWAAVEPLNGREFFQAQGENSSVEVRIRVRYLAGMTPKCR-AVYRGTAYNIVSIDERHAELVIMC....... 104
220 1.000e-08UniRef50_A0A1V5IBV7 Phage head-tail joining protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5IBV7_9BACT  ali  12  7................................LNKRIEIQSKTSTADGLGGYSDVWATTKRAWAAIWPLSASDVIEGMKTSAQVTHRVRIRYQSGITSAMRIKFG-SLYFSIINPNMANEYLDILCKE..... 105
221 2.000e-08UniRef50_A0A1S1UBG3 Uncharacterized protein n=4 Tax=Janthinobacterium lividum TaxID=29581 RepID=A0A1S1UBG3_9BURK  ali  6...............................RLNKRITLQVLAAGQDEAGQPLPDWMNVIKLWAEVRDVSGREFVSAGATQNQVLTTITIRYRVGVLPKMR-ALHGTDVYRIEAVLGQDRTLTLMC....... 106
222 2.000e-08UniRef50_R6NTN9 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=R6NTN9_9FIRM  ali  13  76.............................................................VWANVAPQTGREYEESQKIRAETTYNINVRYFPGITSDMKIMYGVKVFNSVLDINERHTNLKIVAAEV.... 145
223 2.000e-08UniRef50_A0A0F9J6P5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9J6P5_9ZZZZ  ali  17  8....................................RRIIIEENSPAQDQFGSLTWTTFATVWARVAPVTGKEAFLSDQVSASADTLFRIRFLKGLNVHMRI-VYNSENYNIKNI.................. 87
224 2.000e-08UniRef50_A0A2E5BRM1 Head-tail adaptor protein n=2 Tax=Rhodobiaceae bacterium TaxID=2026785 RepID=A0A2E5BRM1_9RHIZ  ali  20  27......................................................SWSEQATVWADIRARRGGERDQADRPDARLQLQVRIRYRRDVSTAMRLRDGT-RVFNILSLDGRERFLTCVCEE..... 102
225 2.000e-08UniRef50_A0A1S1V4N3 Phage head-tail joining protein n=1 Tax=Andreesenia angusta TaxID=39480 RepID=A0A1S1V4N3_9FIRM  ali  10  21..............................................NEAGEKVQIPSTVGIVWAKVIPIRGREYTEAKKIRPELQYRVTVRYRKDIHPSM-ILEWEGRVLKIIDIAGRHTYMELNCVE..... 104
226 2.000e-08UniRef50_A0A2E2X2E4 Head-tail adaptor protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A2E2X2E4_9RHIZ  ali  18  40......................................................TWVNVAGLWGAVAPVSVRPGEKAAVAAATLTHRVTIRVRDDVLRGMRFSWQGRVLFEVVSPDESGVYLTCQCREM.... 116
227 2.000e-08UniRef50_A0A088F713 Putative head-tail adaptor protein n=1 Tax=Idiomarinaceae phage 1N2-2 TaxID=1536592 RepID=A0A088F713_9VIRU  ali  14  14..................................KIEIRSRQVTGSDPMGGDIIEWVTHAEPWAKMKPMTGREQYRADKLNAEGMTQVIIRYRDDLDETMKVVYRDVEYQSIINVEERDEWTELM........ 106
228 3.000e-08UniRef50_A0A135HYQ3 Head-tail adaptor protein n=4 Tax=Rhizobiales TaxID=356 RepID=A0A135HYQ3_9RHIZ  ali  13  27................................................IGGYRETWEEIATLWARIEPVSTVRYFGA-QPLEEITHRITMRFRDDIASGMRLR-KGGRCFTILTVDESGRYCLARVRE..... 108
229 3.000e-08UniRef50_D6CTJ9 Putative Phage head-tail adaptor, gp9-like n=3 Tax=Burkholderiales TaxID=80840 RepID=D6CTJ9_THIA3  ali  11  13.................................YRHRISILARTPGAEDALGQSGPSAWTGISAMVEDLSGRELLAAQQVHGEVTSRIFLRYRAALAPGMRVVFGADVYLAVLRMDAVNVELALLCSK..... 113
230 3.000e-08UniRef50_A0A0F9R695 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9R695_9ZZZZ  ali  13  24...................................LRYRELAEPSFGDVDID-EAFSDHIDVWAKVVSRSGTEMFGGVTSDIPITHTVYIRYESAVNTTMWVELGDGTLLDILDLDEENEFLKLVCSK..... 118
231 3.000e-08UniRef50_UPI00096ECD76 head-tail adaptor protein n=5 Tax=Paenibacillaceae TaxID=186822 RepID=UPI00096ECD76  ali  13  14...............................KYNKRITILLPEGEQDEWGQPLDTASEVCKIWSAIQPLRGQDRAAAAQVTADVTTRIRIRYREGIDRTMVVRYKETE-FEILYIEFNRRELQLMCKE..... 114
232 3.000e-08UniRef50_A0A174QRL9 Bacteriophage head-tail adaptor n=1 Tax=Anaerostipes hadrus TaxID=649756 RepID=A0A174QRL9_ANAHA  ali  15  8...............................KMNKKIYICTPRTTQDEMGQDIMTYEKGKRIWATVKSVRGGEYYDALKLSPEVSYIIYTRYRKDIHP-DTILMYHGKKLEVADIEEEQVMLEIQCTE..... 106
233 4.000e-08UniRef50_UPI000BBBE59F head-tail adaptor protein n=1 Tax=Clostridium cochlearium TaxID=1494 RepID=UPI000BBBE59F  ali  13  14..................................KRITIQKFSTTQNENGFDIEDWIDYKTIWASINNLWGKEFYAAKAVNAENTVEFVVRYLENISTKEYRIFWSNRAFDITFVDN................ 99
234 4.000e-08UniRef50_UPI000CFD70E3 head-tail adaptor protein n=3 Tax=Rhizobiales TaxID=356 RepID=UPI000CFD70E3  ali  12  1..............................MRAGKLTIRRFGEIGRDEFNAPIVDWHDVTTVWAQQRPERGSERFAAAQVNGTSVMTFHIRYRGDVTVKDRL-LYEGREYEIVAPPREIG............. 93
235 4.000e-08UniRef50_UPI0006B52903 head-tail adaptor protein n=3 Tax=Clostridia TaxID=186801 RepID=UPI0006B52903  ali  12  2............................QFGKLNKRITIQRADKKEDINGITKAGWYDLKTIWCSMNGLSGKEYWTAKSYNAENTVVFIIRYGKDLTVKDRI-IYKGRAFNIVHVDNKNETLKIKATEVI... 107
236 4.000e-08UniRef50_I6R1H4 Phage head-tail adaptor n=1 Tax=Marinomonas phage P12026 TaxID=1176423 RepID=I6R1H4_9VIRU  ali  11  7...........................TPGMLRHKIEIRELQEVE-DDYGGQVSTWVTVWTKKAFVKPVSGYERLRSAQLQASQTHVVYMRWFDGLTAKHQIKFGD-RLFQIKNVEERNRWLEVTCDE..... 108
237 4.000e-08UniRef50_A0A0J6GFQ1 Phage head-tail adaptor, putative, SPP1 family n=14 Tax=Pseudomonadales TaxID=72274 RepID=A0A0J6GFQ1_PSEDM  ali  20  1..............................MRAGDLRHPIVIQHQTTQTGEVVTAWVELARVWAAVDPLSARDLIAAQASQSQASGRITIRYRPGVLPTMRI-LHRGQIFTIIGPDRNSGYLTLVV....... 104
238 5.000e-08UniRef50_UPI000CF2FFAA head-tail adaptor protein n=1 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=UPI000CF2FFAA  ali  13  25.................................................GGDREVWSTFAETFAKVEPLVGREFIAAQAEHSELTAKVTMRWRADVNQLHRVMIRG-EAYGIISAQNQNRELLLYVKRL.... 106
239 5.000e-08UniRef50_A0A150L6F8 Uncharacterized protein n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A150L6F8_9BACI  ali  12  7..................................KHRIEIQEKKTVKDTKLPTETFVTVYSCWAEIEQPTGRRFFEAAVAHLEYAVFFHIRYREGIKPGMYVKFDDTTYLEQVRPDHRKRTTTLQCKEVV... 106
240 6.000e-08UniRef50_A0A2E5TFH5 Phage head-tail joining protein n=1 Tax=Alcanivorax sp. TaxID=1872427 RepID=A0A2E5TFH5_9GAMM  ali  10  1................MAVSPIG-----EPVRAGRLRHRGALQRRVPGRDALPDQWEDVETLPMEIRDLEGRELLAAGAEHAEVTTEILMRFYPGVTAAMRVVHGNGEVYDIQAPDTKRRQLQLLC....... 115
241 6.000e-08UniRef50_A0A1U7CNJ1 Uncharacterized protein n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CNJ1_9BACT  ali  11  5.................................GQRRTRLTYQEPTYSVGQQIETWADVASVPARLSPLNAKETYWARQIHSETTHEANIRFHSGVKPTGRFKVGTDRILNIVGIDDENRHIELTIQVVE... 107
242 6.000e-08UniRef50_UPI000665F578 head-tail adaptor protein n=1 Tax=Clostridium botulinum TaxID=1491 RepID=UPI000665F578  ali  17  10...............................KLNKRISIGHIGSIVNENGFPETKFLEDYKAWASISNLYGKEFYEAAAVQHEDDVKFIIRYNPNITYKNVIKYKED-IYNIVHIDNSNRWLVIKAK...... 107
243 6.000e-08UniRef50_D8JVN8 Phage head-tail adaptor n=7 Tax=Hyphomicrobium TaxID=81 RepID=D8JVN8_HYPDA  ali  13  2...........................KAPVRAGDLRHRIRPERTSDGAGGSTTEWTPIAEVWAAIWSRSADENFTLDRVAGTATHDVWIRHRGDVRPEMRIRFG-VRIFDILGV.................. 91
244 6.000e-08UniRef50_A0A0L6PEQ0 Head-tail adaptor n=78 Tax=Proteobacteria TaxID=1224 RepID=A0A0L6PEQ0_ECOLX  ali  1..............................MNIGRLRDRVTIQTLKQTRDITLETWVDGHTLWASVNMISSKEAISSGAELATGTVRIWIRYRKDINATSRIKVNTGRVLNIIGPDAARTRLEILCRE..... 108
245 7.000e-08UniRef50_Q2SDM3 Bacteriophage head-tail adaptor n=1 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2SDM3_HAHCH  ali  1..............................MRAGRLRRRVTIQANQDEYGETVQGWRDLATRWAGVEPLSGREFLAASGPRAELTARIVLRWEPGLASQDHRAIYQGRVYDIINTREENKEWVLMC....... 105
246 7.000e-08UniRef50_A0A1E8CG00 Uncharacterized protein n=1 Tax=Pseudohongiella acticola TaxID=1524254 RepID=A0A1E8CG00_9GAMM  ali  1..............................MRAGRLRHRLQLQTRDLDSGEFIDSWQTQVTVWAEIEPANASEFIESSATQAQITAKITIRFRPGLDSANWRGEHKGTIYKFEGPDPRSGYLLIMA....... 105
247 7.000e-08UniRef50_UPI000B4A7097 head-tail adaptor protein n=1 Tax=Bacillus cereus TaxID=1396 RepID=UPI000B4A7097  ali  14  5.........................RYKRPLNAGKMNKQIILEYKTAETKDEESEWEEFTKVWAEPKTPFGSEIFQGNAEFVIKLINFTIRYREGVNSAMRVRYGG-RLYEIIDIDEQHKEICLICEERSWQN 124
248 7.000e-08UniRef50_UPI0009F96110 head-tail adaptor protein n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI0009F96110  ali  11  21.............................................TDDDGFPRKEWTPYVTVWAELQTLKGKSFYEAASTNLENYRHFRIRYRNDLNDRMRVSWNDIDHELIENTDGMNRFMDVRVKAV.... 107
249 8.000e-08UniRef50_E0MPJ7 Putative phage head-tail adaptor n=1 Tax=Ahrensia sp. R2A130 TaxID=744979 RepID=E0MPJ7_9RHOB  ali  21  34.......................................................FQPVATVWAALEPKRHDERLLAQQIDEQGSHIITIRFRPDVATGWRFVEGD-RSFEIVAIDERHRYLQCHTKEV.... 109
250 9.000e-08UniRef50_A0A0P9T7U7 Uncharacterized protein n=1 Tax=Pseudomonas syringae pv. lapsa TaxID=199201 RepID=A0A0P9T7U7_PSESX  ali  19  2..........................................................WDKVPAAVEPLSARDFIAAQVSQSEATARMVIRYRAGVLPTMRILYRGDT-YDIKDPDSGLEYLTLVAKGV.... 77
251 9.000e-08UniRef50_A0A2D8YM93 Uncharacterized protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2D8YM93_9RHIZ  ali  12  46................................FREKITIQVSSLVQDNRGGGVKQWSDVATVWAQIKTYSNREMFQSAQLRAKNEFLITIRYTPDITTGMRVIWFNLEILAITNVDALNWTMELYCRR..... 149
252 9.000e-08UniRef50_J7SWK9 Uncharacterized protein n=21 Tax=Xanthomonadaceae TaxID=32033 RepID=J7SWK9_STEMA  ali  15  3...............................RAGKYRHRIELQDYGPVRGGDVKQWRRWADVPAEVVPLSGREFTAASAEHGQVTARIEIPYLPGVVPTMRV-VFDGHVYAIRAVATARGHITLMV....... 103
253 9.000e-08UniRef50_UPI000B9E232F head-tail adaptor protein n=1 Tax=Bordetella genomosp. 5 TaxID=1395608 RepID=UPI000B9E232F  ali  23.................................................GQPLQEWTDVATVWANVRVMSGREVGAAGSVESIASASVRVRYRKDFSAGMRVLVGD-IPYNVVAPDEQRRFLDLAC....... 101
254 1.000e-07UniRef50_A0A0K8JFM2 Uncharacterized protein n=6 Tax=Sporomusaceae TaxID=1843490 RepID=A0A0K8JFM2_9FIRM  ali  16  26....................................................ETEYVSRAALWAKIMPVTAKTTDQYEQMTPEILYRIIIRYRRDVAVTDRIQYGSREFEQIVDIEEKHAYLRLECREVV... 106
255 1.000e-07UniRef50_UPI0009E0AF0D DUF1506 domain-containing protein n=1 Tax=Borrelia duttonii TaxID=40834 RepID=UPI0009E0AF0D  ali  42  23..........................................................................NASNFSDITCLYRLYMSAKLCFELSDKISEGDNFHFEIVFIDGFVGYLTLTLKG..... 78
256 1.000e-07UniRef50_A0A229H2S7 Head-tail adaptor protein n=1 Tax=Moraxella sp. VT-16-12 TaxID=2014877 RepID=A0A229H2S7_9GAMM  ali  12  2..............................MRVSELRHRITQQTSVNAGGERLAEWTQVKKLWANITYLSVKDVLASQAAGSQITARCVVRYTKDITSDMRIIYQDHVFQPIPDPKTGREYLTLMLQSASY.. 109
257 1.000e-07UniRef50_A0A2S5H4E5 Uncharacterized protein n=1 Tax=Brevibacillus laterosporus TaxID=1465 RepID=A0A2S5H4E5_BRELA  ali  13  4........................FKYEPRLNTGKLNHRIDIQHYTSDEGTVIMGWTSFVTLWSAIRPLFAKEKIDRFDINQSATHLFTVRFRPDIKSTMRVIYRNK-IYDIQSISEHFQKLELTCEE..... 113
258 1.000e-07UniRef50_A0A2N5LNT2 Head-tail adaptor protein n=1 Tax=Psychrobacter sp. MES7-P7E TaxID=2058322 RepID=A0A2N5LNT2_9GAMM  ali  17  20............................................ASPMGGSSSTSWTPTHTLSANVTPLSVKDVINAQAADSETRARCVLRYRTDITSKMRIEHRGN-MYAIDDDDSGLEYITLMLKSV.... 108
259 1.000e-07UniRef50_A0A1G8UKE9 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Rhodanobacteraceae TaxID=1775411 RepID=A0A1G8UKE9_9GAMM  ali  12  8..............................IRSGDLRDRVTLQNKQSPTGQPTETWVDAFSAWADMDPLTGRELIAAQQVQSSVTHNCTMRYRKEFNPKMRL-VYEGRFFNIMDQDSRKRAVVLQIEE..... 115
260 1.000e-07UniRef50_A0A0J6WRJ3 Uncharacterized protein n=3 Tax=Veillonellaceae TaxID=31977 RepID=A0A0J6WRJ3_9FIRM  ali  14  3.............................PGTLDRKVQFIRYQDVDNEVGADSQKPVVIFSTWARIEPARGREYYEAQRVKDANPFKITIRYHTNVDDSMTIEYHQQQ-YDIQTI.................. 87
261 1.000e-07UniRef50_V5SEU0 Head-tail adaptor protein n=14 Tax=Alphaproteobacteria TaxID=28211 RepID=V5SEU0_9RHIZ  ali  12  6................................FGEMRHRLGLEEPVDTAGGATRVWSLVAEVWGAVEPLSGSERIEANGIQGRVSHEIWVRHRAGLGPHMRFKMGT-RIFEIRAIDSGERRRVMRC....... 102
262 1.000e-07UniRef50_A0A1V5NYF1 Phage head-tail joining protein n=1 Tax=bacterium ADurb.Bin374 TaxID=1866937 RepID=A0A1V5NYF1_9BACT  ali  11  1...................................MRHRIEIQQASDGMGGFTETWGPVCTVWASMRQESGKELVNADKVQATRRVQYGIRYRTDIAANMRI-LHGSRTLNIIAVLDPAGTFELIAEEV.... 99
263 1.000e-07UniRef50_UPI00050FF8C4 head-tail adaptor protein n=4 Tax=Burkholderiales TaxID=80840 RepID=UPI00050FF8C4  ali  11  1..............................MRIGKLNRRVRIERRSAERGQELDAWVEVDTVWADVLMLTGKEAISAESEVASASASIRIRYRLDIDNGMR................................ 75
264 1.000e-07UniRef50_A0A0Q5H859 Uncharacterized protein n=1 Tax=Massilia sp. Leaf139 TaxID=1736272 RepID=A0A0Q5H859_9BURK  ali  230...............................RLNKRVALQQLVAGKDASGAPTEVWANVITIWAGIRDLTGRQYVVAGGTQNAVQTEIEIRHRAGIVPAMRV-VHGADVYDIEAVDQQGRALKLMCKK..... 331
265 1.000e-07UniRef50_A0A1G6CFD0 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Bauldia litoralis TaxID=665467 RepID=A0A1G6CFD0_9RHIZ  ali  10  4.........................RDFGPGRLCHRVVIESAAGAPDGAGGEAVTWDTYATVWARIAPVSSGERIVAGHLSGVVTHTVTMRYRDDIAGGMRILYRGRRLLAVGDPDETRRFIV.......... 103
266 1.000e-07UniRef50_K2NMJ3 Phage head-tail adaptor n=13 Tax=Proteobacteria TaxID=1224 RepID=K2NMJ3_9RHIZ  ali  24.............................................SDGAGGFTESWREVASLLAMIEPVSPGAFFGAGQDHETVTHRITMRFRNDVRSGMQLARSGRNFLNAYDPDETGRYLVCRVRE..... 108
267 1.000e-07UniRef50_A0A2G2M6Z6 Uncharacterized protein n=1 Tax=Alkaliphilus sp. TaxID=1872455 RepID=A0A2G2M6Z6_9CLOT  ali  12  1..............................MNIGKMRHRITVEHAVNDFGAITLTWTALFTTWAKITPKTVKESMASAGLIVETLVEISLRYREGLTTKHRVVHKGKTYKGIINVDQADKELILTGREVI... 105
268 1.000e-07UniRef50_A0A0H4A748 Uncharacterized protein n=4 Tax=Viruses TaxID=10239 RepID=A0A0H4A748_9CAUD  ali  14  14...................................KIEIQRLQEVADDLGGFSTQWVTLKTKRAKVVPMSGRELIHADKIDATAVSRFVIRFDADIIESDRIVLKGKEYNSIINIEEENRFNEIMA....... 106
269 1.000e-07UniRef50_A0A0F9CRX2 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9CRX2_9ZZZZ  ali  15  1..............................MRSGRLRHRLSLQSPTHSVGTIVTTWGTVATIWGSIEPLRSREFYDSALINSDIKAQVITRYTNDVEPNYRFVFGTRVFLAVLNIMERNKEMHFGVKE..... 105
270 2.000e-07UniRef50_A0A0B6X5A6 Putative head-tail adaptor n=3 Tax=Xenorhabdus TaxID=626 RepID=A0A0B6X5A6_XENBV  ali  11  2.........................................................DVTTVWAEVRAISGRERLASGAVFSEATVRIWMRYRDDVTTANIILYNGGTAFDIVAVDAKCTRLELLCKG..... 78
271 2.000e-07UniRef50_UPI000991146C head-tail adaptor protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI000991146C  ali  17  15...............................FRHRITFLKLESLKDELGQEIGKDWIEYKKAWAMIKTLKGSEYVNAGSERATITSRFVIHYTEGITAEMRIKY-NNRIFDIIEPDEADKTLTILVKE..... 114
272 2.000e-07UniRef50_A0A2D0JN44 Head-tail adaptor n=3 Tax=Xenorhabdus TaxID=626 RepID=A0A2D0JN44_9GAMM  ali  13  1..............................MDIGRLRHRIEIQNQTPAGSVIKERYT-VATVWAEVKFISGRELVASKAVLSESLVRFWIRYRADIQPAMDIVFRQKT-YTIQAVMPDIIYCYLI........ 97
273 2.000e-07UniRef50_Q0AG20 Phage head-tail adaptor, putative n=2 Tax=Nitrosomonas eutropha TaxID=916 RepID=Q0AG20_NITEC  ali  14  5............................KSGRLRHRVVIKQRVDTQDVQGNITESWELYRTVWAAIEDLSVRDFIAADAAQSQITTQITIRYLPTFDPRMRI-HHGNVVYEPVGV.................. 91
274 2.000e-07UniRef50_A0A1F3B3D8 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium RBG_16_58_9 TaxID=1797287 RepID=A0A1F3B3D8_9BACT  ali  1..............................MRIGPYRHRITISRKTNSYGEDVSDYTTFGPFWAEVTALRGRELESARQTWAEARFRVRMRHQPGVTVEDRITWGT-RTLDILDAEGRQREIVMYCRELV... 110
275 2.000e-07UniRef50_UPI000624B7BB head-tail adaptor protein n=1 Tax=Moraxella bovoculi TaxID=386891 RepID=UPI000624B7BB  ali  11  1..............................MNASQLRHRVTQQSTINELGEHITEWLPTKKVWAAFTPLSVKDVIAAQGTGSRMVARCTIRHQVGITSGMRL-VHQDQHYAITGPDPRGGYLTLMLETV.... 106
276 2.000e-07UniRef50_A0A081J3Y9 Head-tail adaptor protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A081J3Y9_9BURK  ali  16  33.......................................................WVEVAKVWANIRHMSGSETIRAGAEVSTVRVSIRIRYRAGINAGMRVVHVGQVYIEAPLPDSTRRWLDLACK...... 105
277 2.000e-07UniRef50_A0A0M2R7D1 Uncharacterized protein n=1 Tax=Kiloniella litopenaei TaxID=1549748 RepID=A0A0M2R7D1_9PROT  ali  15  5...............................RLRERISLQELSLVSDGGGGQTETWGEVAKVWANVKPLSGREQITADKEASTTLYRIKIRSR-GISSSWRVVWGSKILNEILEGDSSERYL........... 96
278 2.000e-07UniRef50_A0A1V6GS00 Phage head-tail joining protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin070 TaxID=1852927 RepID=A0A1V6GS00_9BACT  ali  13  1..............................MNPGKLDTLVAIRRATETRAANVKTWADLAQVWASFEPISGREAVMAQQLQAVVSLKATIRHGSGVTVKDRI-VNGSITYEVTRVADSG.............. 91
279 2.000e-07UniRef50_G3ENA2 Phage head-tail adaptor n=1 Tax=Psychrobacter phage Psymv2 TaxID=1071177 RepID=G3ENA2_9CAUD  ali  11  1..............................MRAGKIRHRITTSGRSASGAMLPTTWTAWIVLWASFEPLSVKDILTAQAAGSEVEARCMLRYRSDIDSTMQVEHRGKR-YSIDGPDARSGYMTMMLKSI.... 107
280 2.000e-07UniRef50_A0A1V2YD03 Uncharacterized protein n=1 Tax=Epulopiscium sp. Nuni2H_MBin001 TaxID=1884656 RepID=A0A1V2YD03_9FIRM  ali  11  3.............................PARLNNRIMIERQQFITDKFGISTKDFISYKTIWATINNLSAKEWWNAQNYGAENTLEITIRYSPDIAITDRIKW-NNRLFNINSVDNKNESIKIRVTEVI... 107
281 2.000e-07UniRef50_A0A0F7REH2 Phage Head-Tail Adaptor n=141 Tax=root TaxID=1 RepID=A0A0F7REH2_BACAN  ali  16  6.............................PSKLNKRITIQQEITNKKDEEGNPSEWEDVVTVWARAKTPFGKEIFAGNTENAVRTVNFFMRFRRGIDSKMRV-LYDDRLFEIVDVDEQHKETCLVCEE..... 112
282 2.000e-07UniRef50_A0A0J6EFW2 Head-tail adaptor protein n=87 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J6EFW2_9BACI  ali  11  5...................................MRYRIKFQEKKEGGRLPVEDYETVVECWAKAEGLKGREYYAAAAVQKEHTVEFTIRHREDIDKHMRI-LFQNQSYEIESIYSRKNFTTIKAKAVE... 102
283 2.000e-07UniRef50_A0A2X1MVW9 Putative head-tail adaptor n=1 Tax=Escherichia coli TaxID=562 RepID=A0A2X1MVW9_ECOLX  ali  15  2..........................................................FATVWAEVKGISGRERMTAGAETAQATVRVWIRFRVDVTASSRIRVLTGAYLDIVGPDGKRTRLEILCK...... 77
284 2.000e-07UniRef50_UPI000417FEE0 head-tail adaptor protein n=2 Tax=Alicyclobacillus contaminans TaxID=392016 RepID=UPI000417FEE0  ali  14  27...................................................NLDSWVDVATVWASVEPQTLREFVGSGANEVEKIVVVRIRYRPDVTEQNRVMY-NGHVYRIEAVDDQHRELQLYCSEV.... 108
285 2.000e-07UniRef50_UPI00094EBF04 head-tail adaptor protein n=1 Tax=Caecibacter massiliensis TaxID=1852378 RepID=UPI00094EBF04  ali  16  2............................QTGRLNKRIQIIGQVKTKDEHGFDTMEEAVLFTCWAEIKSARGKVLYDMERKDSTEYVTITIRWRPNVTHDMKVKYQDHTYRNIVDPYMRHEALELYCTE..... 103
286 2.000e-07UniRef50_A0A231UUF0 Uncharacterized protein n=1 Tax=Notoacmeibacter marinus TaxID=1876515 RepID=A0A231UUF0_9RHIZ  ali  7............................EFMDAGKLRTRLVLEAPPDEAGGQDVQWHAVGEFFAHVEPVGARQTTEGEAERQEITHRVTLRHRNDVSPAMRL-LRNGHAMRVETVDGSGRYLVCGCKEME... 113
287 2.000e-07UniRef50_I9BV28 Phage head-tail adaptor n=1 Tax=Ralstonia sp. PBA TaxID=795666 RepID=I9BV28_9RALS  ali  15  3............................APKLRHRITIERMVETQDPNTGAITEAWTVFEGVPADVLPMSSGEVLKAGAAQSTARYRFVIRYLPGLVGKMRV-VHDGLYFNII.................... 87
288 2.000e-07UniRef50_A0A2D9CCP0 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D9CCP0_9BACT  ali  11  5...............................RLDRKIVIESQTFSTNSIGEYTASWSTYHTTFANVQRGTGNEKVEADQVTSTSKVKFKIRFFDGIDESMRISY-NSKYYDILDIQELGRE............ 93
289 3.000e-07UniRef50_V5M4T7 Uncharacterized protein n=203 Tax=root TaxID=1 RepID=V5M4T7_BACTU  ali  11  3.............................PGKLDKLTFQVKDDEAKSPDGDPIEDYKDSFTVWGSFIFLKGRKYFEAATANSEIQGETEIRYRADVNADMKIKY-KNVMYDIVSV.................. 88
290 3.000e-07UniRef50_W5SWX9 Putative cytosolic protein n=1 Tax=Borrelia coriaceae Co53 TaxID=1313292 RepID=W5SWX9_9SPIR  ali  51  5..............................................................................LSYIKSLHKLYTTSNLEFELKDRISDSNM-FYEIVSIDSSIGYLTIILKVIEW.. 56
291 3.000e-07UniRef50_UPI000678D948 head-tail adaptor protein n=1 Tax=Lachnospiraceae bacterium MC2017 TaxID=1408324 RepID=UPI000678D948  ali  14  2............................KPVNIGRMRIEFCRMEETEDAGQTIVSPVPFLKVWADISEKNGAERSVADKLRAENYFKITVRYIEGITTDMLVLW-KGRLLEIINLYERNKVLELECTE..... 106
292 3.000e-07UniRef50_A0A060P616 Phage head-tail adaptor n=5 Tax=Burkholderiales TaxID=80840 RepID=A0A060P616_9BURK  ali  12  8..............................MAAGPLRHRVQLQAPVVQIDDEITDWTDQGTVWAAVEPVSGREWLLSAEFREGTTTRIRIRWRDDIDSTWRVIHARKSGQTIYNIDESMSELHLMCSS..... 117
293 3.000e-07UniRef50_UPI000D3C8596 head-tail adaptor protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI000D3C8596  ali  13  1..............................MRAGKMRHRKLVVDHRNPLGEVIYRLDDVAEVWAEVRAVSAKEYIQMGVENVEIDIRVYIRYRPDVERGDRIIYGDVFVVKAVLPNARMNMLELLC....... 106
294 3.000e-07UniRef50_A0A1R4EFB3 Phage head-tail joining protein n=3 Tax=Moraxellaceae TaxID=468 RepID=A0A1R4EFB3_9GAMM  ali  16  9.......................................................WEHVLTLSAAFEPLSVKDMLAAQAASSEAKVRCTLRYRHDVDSKMRVG-HRGRMYEIDDANSGLEYMTLMLKEV.... 86
295 3.000e-07UniRef50_A0A0F8VW04 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8VW04_9ZZZZ  ali  12  28...............................................DDGGTDQVWMTLAGWWASVEPVSGDEFFQGEQTEGRVTHRVTMRHFDGLTSKDRI-IHKGRALNILDVEERGAKTVVMCRE..... 113
296 3.000e-07UniRef50_A0A090MF57 Uncultured bacterium genome assembly Metasoil_fosmids_resub n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A090MF57_9BACT  ali  9................................FRRRVTLQLRSTARDSYGQTIETWTDQGTYWARIMPTRARDILVNNQLKPQVTHTVWLRYLGAMVASHRLLLDGDRVLNIIDVEERHRVYEITCQE..... 111
297 3.000e-07UniRef50_A0A2G1QS78 Head-tail adaptor protein n=2 Tax=unclassified Phyllobacteriaceae TaxID=102274 RepID=A0A2G1QS78_9RHIZ  ali  16  8.............................PGRFRTYLVLEAPDLEPDGEGGLTGGWSETAGIYALVEPVSAARRFAGDRFVEETTHRVTLRHRAGVLPGMRFRCRE-RLFAIRTVDETGRYLVCLAVE..... 108
298 3.000e-07UniRef50_A0A1X7MXS1 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Azospirillum lipoferum TaxID=193 RepID=A0A1X7MXS1_AZOLI  ali  12....................................RIRIEAKTRVEDEGGAAEGWALVATVWAQVWPVSGRERAEAQQVEATTMMRFKVRRRAGLDAGMRIVWQGRAH........................ 85
299 3.000e-07UniRef50_G8MD27 Phage head-tail adaptor, putative n=28 Tax=Burkholderiaceae TaxID=119060 RepID=G8MD27_9BURK  ali  16  8...................................RRVRIERNGGGFDDGQPIDGWTEVATVWGNVRMLTGKETLTSDADVGTASASIRIRYRTDITNGMR-AIVDGVVFNI..................... 84
300 3.000e-07UniRef50_A0A1I1JUN8 Phage head-tail adaptor, putative, SPP1 family n=4 Tax=Bacillus sp. UNCCL81 TaxID=1502755 RepID=A0A1I1JUN8_9BACI  ali  11  4...................................KITIQSPPSGRDSTGQTVNVWNDVRTVWASKEFLIGKEFYAANQTQNSVEVKFRTYFYSGMNKTMRI-VHGNDTYEVISVSD................ 84
301 4.000e-07UniRef50_K6DIF5 Phage head-tail adaptor n=1 Tax=Bacillus azotoformans LMG 9581 TaxID=1131731 RepID=K6DIF5_BACAZ  ali  13  9...................................KIVIQSFSEKKDELGQILKEWTNTYNLWVMIRTIQGTEYIEASATQNQDTTRFVIRFMKNIEPTMRI-VYKNKIYNIISVDEADKTLTIIAKS..... 103
302 4.000e-07UniRef50_F0PVI6 Phage head-tail adaptor, putative n=434 Tax=root TaxID=1 RepID=F0PVI6_BACT0  ali  16  4........................FQYKKPLNTGNRIIIEQPEVIKDELNQEVENWQEVKKAWAMIKTVKGSEYIEASASQSTRIYRFVIPYTTGITELMRIKMKD-RIFDIIEPDEMYQTLTIIAKE..... 115
303 4.000e-07UniRef50_UPI000893BFDA head-tail adaptor protein n=1 Tax=Burkholderia sp. JS23 TaxID=1770053 RepID=UPI000893BFDA  ali  10  9..................................RVRIEQRTDAADPETGQPRDEWVPVAEVWANVLLLTGKESVQADAEVASATASIRIRYRTDITNGMRAVLVDDVVFDILT................... 96
304 4.000e-07UniRef50_A0A0R6PHN1 Coat protein n=52 Tax=root TaxID=1 RepID=A0A0R6PHN1_9CAUD  ali  15  1..............................MRASQLRHSIKVHQKTISRGAVTSKWAHILTLYAQFTPLSVKDVITGQAAGTDITARAMIRHRDDIDHTMRI-EHGGRMFEIVGADNGSGYLTLMLKGV.... 106
305 4.000e-07UniRef50_T9A5L8 Uncharacterized protein n=122 Tax=root TaxID=1 RepID=T9A5L8_ECOLX  ali  1..............................MQAGRLRTILNVTTARSPSGHPVETVTEGATVWAEVKGISGREIISGGAETAQATVRVWMRFRRDVTATSRLKVLTGAFKAILGIDARATRLEILC....... 106
306 5.000e-07UniRef50_J7Q8F3 Phage head-tail adaptor n=11 Tax=Methylocystaceae TaxID=31993 RepID=J7Q8F3_METSZ  ali  4..............................LPIGALRHRVTLEDAPDGAGGFSRSFTPVINLWARIAPSGVREAFVEQRAEQATNHVVTIRWRDDVTKDMRFAYRGRRIQSVLDLDERRRYLVCQCEEIS... 108
307 5.000e-07UniRef50_A0A2G3DY84 Uncharacterized protein n=1 Tax=Pseudobutyrivibrio ruminis TaxID=46206 RepID=A0A2G3DY84_9FIRM  ali  12  15......................................IMKYEDTVDEYNRNAQELVTHATIWAEIKPMRGFEFLDYYREKNKVQTKITCRYRDDITEKMVVKFNGKEITAIIDIEDQHTALEIMVQE..... 106
308 5.000e-07UniRef50_A0A178MX51 Uncharacterized protein n=1 Tax=Magnetospirillum marisnigri TaxID=1285242 RepID=A0A178MX51_9PROT  ali  14  5...............................RLDRRVTIQALTTSSDALGGVTETWADLATVWAQFLPGAGKEAYSAAAVHAEAQARFRIRWRSDVTTVHRV-IYDGKAWDILAVDEIGRREGLELK...... 99
309 5.000e-07UniRef50_A0A2A2HBL8 Head-tail adaptor n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2HBL8_9GAMM  ali  10  1..............................MRAGRLRHRITIQKKEDDFGGEKIIWTDIGNVWAEVKNVRGQDLTIFGNVIKETIIRVWMRYRPDITIDNLIVYKGSSRFSIILVDPRHSRLELICKG..... 107
310 5.000e-07UniRef50_A0A1H6W8N9 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Cribrihabitans marinus TaxID=1227549 RepID=A0A1H6W8N9_9RHOB  ali  15  1..............................MAAGKLDRRITLQRATTDDGFSSDSWSDIATVWASATPVRDAEKIAAGQVLATIMYRFEIRFVADLGPADRV-IFDGKDFNILGV.................. 91
311 5.000e-07UniRef50_Q65KG0 Phage related protein n=17 Tax=Bacillus TaxID=55087 RepID=Q65KG0_BACLD  ali  21  6................................FNKRITFLRFTETTNGEGFEIKEWLPVATVWSAVKTVQGREFYQAGAVQADRTARFVIRYSKRMKSDLRISYAG-RTFEIINDDERNVTFTLVTKEV.... 108
312 6.000e-07UniRef50_A0A1H3LZG9 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Thermoactinomyces sp. DSM 45892 TaxID=1882753 RepID=A0A1H3LZG9_9BACL  ali  13  3..................................KLRFRITLQKQTDEQGNVVTSWSDMGTVWSSYNPNRWREFFSGDATISESYARFTARYRTDITPANRL-VFENKIYDIVNVDSKKKYVWIIGK...... 101
313 7.000e-07UniRef50_A0A0F9HBW5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9HBW5_9ZZZZ  ali  16  24.................................................GGEERYYIPYATVWAGFDTLSGKERLAAQQVGATLSHEVTIDYDPEVTPEDQILLGD-RTFDIKNVDEGNKELRIRCTEV.... 107
314 8.000e-07UniRef50_A0A1Y1J311 Phage protein n=20 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y1J311_COMTE  ali  11  23.......................................................WVEVTKLWASVEPLSAREFIAAAASQSKVTARIVTRRDSRVTAAMRL-VHAGRIYNIEGV.................. 81
315 8.000e-07UniRef50_G4Q4J4 Uncharacterized protein n=9 Tax=Negativicutes TaxID=909932 RepID=G4Q4J4_ACIIR  ali  15  2.............................PMKTGKRIEILGKQAATDAYGFDTQTDVVVYRCWASIEPARGKVFYEMERKADTEYSKITIRWRPGVTHDMKVKYQ-NHLYDIDTIVDRHEALELYCME..... 105
316 8.000e-07UniRef50_W8U656 Uncharacterized protein n=1 Tax=Peptoclostridium acidaminophilum DSM 3953 TaxID=1286171 RepID=W8U656_PEPAC  ali  10  3.............................PGILRHRITIQKHSAAENEIGEKTVGYQDDYSLWARVEPASARDIERLGKTETEVSHKILIRHKAGITSSNRITF-KGRIFDIVGIGEQNKTLSIFCVE..... 103
317 9.000e-07UniRef50_UPI0006968B96 head-tail adaptor protein n=1 Tax=Azospirillum thiophilum TaxID=528244 RepID=UPI0006968B96  ali  7................................LDQRVTIQAEAETPDGRGGYTKGWSAVATVWARVRPLSGRERQNAQQTEASVSYGVVIRRRTDVTTACRLIW-NGKVMNIRFVGE................ 90
318 9.000e-07UniRef50_A0A1I6SY08 Phage head-tail adaptor, putative, SPP1 family n=4 Tax=Bacillus TaxID=55087 RepID=A0A1I6SY08_9BACI  ali  13  4........................FQYKQPLNTGDFRIIEQPVTIKDDLGQVIEDWKELKKAWAMIKTLKGSEYIAASSSQVTLIYRFIIPYTLGITEEMRINL-KGRIFDIIEPNEENKTLTIIAME..... 114
319 9.000e-07UniRef50_A9D3X2 Phage head-tail adaptor, putative, SPP1 family n=9 Tax=Rhizobiales TaxID=356 RepID=A9D3X2_HOEPD  ali  8.............................PGRLNARLRLETPADVADGQGGVGEGWVTVTGLWGRVEPLRARPREEAGAAIAPVSHRVTIRHRDDIRHDMRFVFRGRFLNAVHDPDESRRYLICDCEE..... 108
320 9.000e-07UniRef50_UPI000BA595F9 head-tail adaptor protein n=1 Tax=Bacillus licheniformis TaxID=1402 RepID=UPI000BA595F9  ali  15  2...........................................................VECWAKAEGLKGREYYAAAAVQKEHTVKFTIRHREDIDKHMRI-LFQNQSYEIESIYSRRNFTTIRAKAVE... 74
321 1.000e-06UniRef50_A0A261U5Q2 Uncharacterized protein n=3 Tax=Bordetella TaxID=517 RepID=A0A261U5Q2_9BORD  ali  13  9....................................RIAIQEEITTPDGGGGVKTWQTVFSVWAHWKHQSMYERLQAMQLQSGVVHRLVVRYRDDITPKHRILYKGNAYQAVVNVNELNDKMELQVEE..... 103
322 1.000e-06UniRef50_UPI000B4B8BBB head-tail adaptor protein n=1 Tax=Rhodomicrobium TaxID=1068 RepID=UPI000B4B8BBB  ali  4...............................RIGRLRHRLTIERAEDGGGGAAVSWEEVAEVWGLVEATGGKEVVGADRVTGTAAVLIMIRHRADVVPAMRFR-RGSEVFHILAVDGRGRFLSCLC....... 103
323 1.000e-06UniRef50_A0A1I1DIJ9 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Comamonadaceae TaxID=80864 RepID=A0A1I1DIJ9_9BURK  ali  15  5...............................KLNKLITLQRLTEGQDEIGQPVTDWADVAKVWANVRYLSGIQTIKSDAPVSIAKASIRIRRRTDVVAGMRALLGE-TVFEIKAVDEQGREFVLVC....... 101
324 1.000e-06UniRef50_A0A2T0XEB6 SPP1 family predicted phage head-tail adaptor n=1 Tax=beta proteobacterium MWH-P2sevCIIIb TaxID=323426 RepID=A0A2T0XEB6_9PROT  ali  11  1..............................MRSYQLRHRIQRRTRSLDYGQPHEYWVDYLSVRAHIRPVSGKESVGALSVNSSLTHTIAVRYKPAFMASYRVHFGE-RVFNIESVEERNRWVILNCIE..... 108
325 1.000e-06UniRef50_A0A2S1XFX5 Head-tail adaptor protein n=1 Tax=Azospirillum sp. TSH58 TaxID=664962 RepID=A0A2S1XFX5_9PROT  ali  4.........................RKTGAGDLDQRIAIQRPDVVEDEGGGRSQGWTDFAWVWADAWPVGGQERAAAQQVEAATMVRFKIRRLFGLDTTMRVIWQGKAH-NIRAIADAGRFLTI......... 104
326 1.000e-06UniRef50_U3R2H0 Uncharacterized protein n=19 Tax=Betaproteobacteria TaxID=28216 RepID=U3R2H0_RALPI  ali  12.....................................TIQRRATGQDEIGQPVETWADVSTVWANIRHTSGMEAIKAGADVSIVRASIRIRWRTGIDAGMRV-VHGATVYDIKAV.................. 88
327 1.000e-06UniRef50_A0A2H4JCB1 Uncharacterized protein n=1 Tax=uncultured Caudovirales phage TaxID=2100421 RepID=A0A2H4JCB1_9CAUD  ali  12  1..............................MDIGEMRDRIILQKKKEQQGPNLDKFEDYKSIWSKVKFLKDREFWQAKASNSETVVEFTIRHREDLDKTMRI-VYDKRNFNIIPVDNKKMYLIVMASEVV... 104
328 1.000e-06UniRef50_R9BV40 Phage head-tail adaptor, putative, SPP1 family protein n=3 Tax=Firmicutes TaxID=1239 RepID=R9BV40_9CLOT  ali  13  1..............................MNIGQLRHRIEIQDNFDKEGFPIENYITIKKAWADVNDLYGKEYWNSKQTISENITVFHTRYYKNVDSDCFILFKGQR-YEIIEPPDNVKYL........... 97
329 1.000e-06UniRef50_X2GV02 Head-tail adaptor protein n=11 Tax=Bacillaceae TaxID=186817 RepID=X2GV02_9BACI  ali  18  27................................................NGWPSQDWTPYKKLWAEVKSQKGYKVFNSDATQWQGKRIVGIRYRNDIHEEMRVEIAGK-FYEIESLDERNQWLTIIVTEV.... 109
330 1.000e-06UniRef50_A0A2P5KWK0 Head-tail adaptor protein n=2 Tax=Hyphomicrobium sp. TaxID=82 RepID=A0A2P5KWK0_9RHIZ  ali  12  1..............................MRIGDLRHRVRIEARPDDGGGARETWSLLDEVWAAIEPAGGAERVDADQLSGRVTHLIRMRAGPAVRLDMRIVW-EGRMFEIIDVGERKRWTEISAEE..... 104
331 1.000e-06UniRef50_UPI0003FCF44A head-tail adaptor protein n=1 Tax=Bacillus cihuensis TaxID=1208599 RepID=UPI0003FCF44A  ali  15  9..................................RLTFNRNEEVSDGAGGFEKS-LVPIKTVWANVRSARAREFYQAAQSQVEITHVVTIRYDASINRT-QVITFDGKQFEIQFVMEKERFLEL......... 98
332 1.000e-06UniRef50_I3UCP9 Phage head-tail adaptor n=1 Tax=Advenella kashmirensis (strain DSM 17095 / LMG 22695 / WT001) TaxID=1036672 RepID=I3UCP9_ADVKW  ali  11  1..............................MDIGKLKHRITIQKQSGPTGQPILSWETVAITWAQVQGISGREFFASSTEQAGTTWKIIMRYIPGLKSSYRVLL-DDQIFNINGI.................. 87
333 1.000e-06UniRef50_A0A1S7M6P4 Phage head-tail adaptor (Modular protein) n=2 Tax=Rhizobium/Agrobacterium group TaxID=227290 RepID=A0A1S7M6P4_9RHIZ  ali  24............................................TDDDAGGREETWQDAFSAWAVVEPMAGREIYVNAQLQSRVDARITIRYRADLSAKNRVKVGT-RTYNITAVRNLSG............. 103
334 2.000e-06UniRef50_A0A1E3VYR6 Uncharacterized protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1E3VYR6_9RHIZ  ali  12  10.....................................................TSWAGVADLWAALTPTGGSEGVEAGRIAGKRAYEIVLRYRAGVRPAMRFRLG-SRIFEILTVGERHRWLRCLCEE..... 86
335 2.000e-06UniRef50_A0A151QIU4 Uncharacterized protein n=1 Tax=Limnobacter sp. CACIAM 66H1 TaxID=1813033 RepID=A0A151QIU4_9BURK  ali  12....................................ITIQAKVKAQSPSGAVTHVWQNIPQVWAEKFDRSGVQGFVSNQDLSKVTARFRIDYREDVVAEMRV-VCKGKYYNILDITGQNEYLELMC....... 106
336 2.000e-06UniRef50_A0A1W1YR02 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Papillibacter TaxID=100175 RepID=A0A1W1YR02_9FIRM  ali  10  6...............................KLNRIIALQRRTVAHDEYNAETETWADESVIWAEAITSGGREFYAAQKLNAETSVVFRIRHTRNINTQMRVRWGG-RYFAILSPTGRREEILISAKEVV... 106
337 2.000e-06UniRef50_W8T264 Uncharacterized protein n=1 Tax=Peptoclostridium acidaminophilum DSM 3953 TaxID=1286171 RepID=W8T264_PEPAC  ali  14  2..................................................................KKLHGKEYFAAKAVQAENTVKFTIRYIAGIDQTMKILFQGK-AYNITSIDNKKRYIEIQAMEVV... 67
338 2.000e-06UniRef50_A0A2E6PUC4 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6PUC4_9FLAO  ali  15  12..................................RHKVIIQQVTSTTDAGGGRAAWSNYKTVFAHVEQLSAQVKFDQGVVDERGLYRFTMRFLTGVDTRNRLSF-DNKIFNIINLDERKKYLVIRAKE..... 108
339 2.000e-06UniRef50_A0A2E1EKP6 Head-tail adaptor protein n=3 Tax=Parvibaculum TaxID=256616 RepID=A0A2E1EKP6_9RHIZ  ali  16.......................................QSPQRTPDGAGGANITWTSGATVWAKVEERRGQERLAGGRLAAHAALTLTIRYRSGITTEMRVLWKE-RVLNITSPDGRKRFLELTCEG..... 106
340 2.000e-06UniRef50_A0A250DLD1 Head-tail adaptor protein n=2 Tax=Variovorax boronicumulans TaxID=436515 RepID=A0A250DLD1_9BURK  ali  13  1..............................MRAGKLRHLIEIQSTRDAAGGVVKAWVPFATVWADVSYLNGLEVVRADAPAAMVRASILIRALPGVVASMRV-LHDDKVFDITAVDRTNRQFVLACEQ..... 104
341 2.000e-06UniRef50_UPI000C1B87A2 head-tail adaptor protein n=1 Tax=Miniphocibacter massiliensis TaxID=2041841 RepID=UPI000C1B87A2  ali  1..............................MNIGRLKHRIKLEFTQDDWGNSEEELVEIGEVWAYVTNLHGEEYFAAAQLQLHKEVKFIIRYNPEVDEDTTITFRDKN-YDITFVDNGNEYMEI......... 99
342 2.000e-06UniRef50_UPI00068A40FA head-tail adaptor protein n=1 Tax=Janthinobacterium lividum TaxID=29581 RepID=UPI00068A40FA  ali  15  2............................SALKLNKRVFVDRPTVTQGDDGGDIAAWLLVGEVWASIAPVGGREAARAGQIIGSTETRIVIRWSPDINATWRIRRGD-VIYNISRVVNSNREIELTC....... 104
343 3.000e-06UniRef50_I0GWR2 Phage related protein n=1 Tax=Selenomonas ruminantium subsp. lactilytica (strain NBRC 103574 / TAM6421) TaxID=927704 RepID=I0GWR2_SEL  ali  18  24.................................................GFDSTKPVKLYSRIAAIQPVRGSQFFISQLTANKENVKITIRYRRGITESCTVTYHNHVYQSIVDPDMAHESLELYCVE..... 105
344 3.000e-06UniRef50_A0A1M5PVN3 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Tepidibacter thalassicus DSM 15285 TaxID=1123350 RepID=A0A1M5PVN3_9FIRM :_  ali  8................................LNKRISIVEIQQMQDEYGFATEQETEVCKCWAKVSNMSGREVFKAGADYSKVKIRFLIRYRKDINTDMKIRF-NNKLYNIVYINNNNKFVELIAEVV.... 108
345 3.000e-06UniRef50_W0HJA4 Uncharacterized protein n=6 Tax=Enterobacterales TaxID=91347 RepID=W0HJA4_9GAMM  ali  13  2............................EPGRLRHRVTVQRESDAKDAYGQSVG-WETVYTLPADIRAISGRDFIAASAERTTVTTKIFIRYHADIRPTCRLVHGRGEVYRIIAPDRHCRRLELLCEE..... 107
346 3.000e-06UniRef50_A0A1T5A0I3 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Acetoanaerobium noterae TaxID=745369 RepID=A0A1T5A0I3_9FIRM  ali  11  13..............................MVYNKKITIQKKTTARNEEGIYIDTWMDYVSVYAYAKKLYGKEYFAAAVVNAQDSLKVYVRYISDISTTNLRMIFENQTYDIKNIDD................ 106
347 3.000e-06UniRef50_A0A2D8XIG0 Head-tail adaptor protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D8XIG0_9RHIZ  ali  26.....................................................ESWTELAIIWAAMHQKSGREREAADRMGARATTEITIRHRAGVTTDMRFRLGT-RHFNILDVEGRRRWLKCACEE..... 102
348 3.000e-06UniRef50_UPI000830B8C3 head-tail adaptor protein n=1 Tax=Azohydromonas lata TaxID=45677 RepID=UPI000830B8C3  ali  11  13.......................................HKRQSGQDAAGQPVQTWVVAAGVWADVRHLSGLEAIKAGADTSTTRGSVRVRWRTGIDAGMRV-VSGSTTYEIKAVNRRGGYIDLACEAV.... 104
349 3.000e-06UniRef50_A0A149VWB9 Phage head-tail joining protein n=6 Tax=Betaproteobacteria TaxID=28216 RepID=A0A149VWB9_9PROT  ali  8...............................FLDQRVTIQTLTVVRGTLGGHDETWSPLATVWAQMMDMTGREIFQAKAMGSAATVLITIRFRTDVRASQRILFSDGSLARIEWIRHRKERLELYC....... 104
350 3.000e-06UniRef50_A0A1G9I5N8 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Natronincola ferrireducens TaxID=393762 RepID=A0A1G9I5N8_9CLOT  ali  15  1..............................MKIGEMRERINFKKKKETDGQNLTDYDDYCTVWAKVDYLKGKKLWSAKAANVETNAEFVIRYRKDIAADMLINF-DNKDFEITSIDIKRTYLVIYGKDIE... 104
351 3.000e-06UniRef50_A0A1V5GYR1 Phage head-tail joining protein n=1 Tax=Deltaproteobacteria bacterium ADurb.BinA179 TaxID=1852872 RepID=A0A1V5GYR1_9DELT  ali  10  6................................LDRRIIIQGKTSVPDGHGEMIETWHDLATVWARRLPLRESEGFAARQTGASVECKYRIRFRRNISPLNRLMDTGNRVYDIVSPIGRNEGLDLLA....... 103
352 3.000e-06UniRef50_A0A256C0E7 Uncharacterized protein n=3 Tax=Wohlfahrtiimonas chitiniclastica TaxID=400946 RepID=A0A256C0E7_9GAMM  ali  1..............................MRAGQLRHRITLQNQTSNNGFQEIVWQDYKDVAAKVEPLSGNAVISANAEHSKVVARIQLRFDAKITAKMRVIFRD-EHYKIAAV.................. 86
353 4.000e-06UniRef50_A0A0F9G6P5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9G6P5_9ZZZZ  ali  6................................LDRRIVIQTATVAPDAAGQLIETWVDLATVWAKRKDLKGQERFAAQQRLATRTTVYRVRWRSGLGEKLQVLD-EGSIYEVVGVERRQGWAELSC....... 100
354 4.000e-06UniRef50_A0A2N6B8Y7 Head-tail adaptor protein n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2N6B8Y7_9RHIZ  ali  11  1................................MGRLRHRVTPVTTDDGGGGATTNWSPVATLWGAIEPASAAEIDAYDRLEGRITHRVVIRHRSDVAGGMRLT-HEGRVFRILDPDETGRWSETLAEE..... 101
355 4.000e-06UniRef50_A0A2M9PE73 Head-tail adaptor protein n=1 Tax=Amaricoccus sp. HAR-UPW-R2A-40 TaxID=1985299 RepID=A0A2M9PE73_9RHOB  ali  13  12..................................RITIRRVVSETKNGVGGKNQTWGDLKTVWAQVKPISDGERWRAQQVGAIATHRFTIRWGVGVTVLDRIRF-DGREFEISGVKE................ 95
356 4.000e-06UniRef50_A0A239RR88 Putative phage head-tail adaptor n=2 Tax=Moraxellaceae TaxID=468 RepID=A0A239RR88_ACIJO  ali  10  31.......................................................WLDYKELWAKVTHLSGKDLIAAQANQSKVIARLKIRYREDINTEMSVIYKGKRYQALEDVGSGNEYITFLLSE..... 107
357 4.000e-06UniRef50_A0A1F8UXW3 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWF2_36_10 TaxID=1797682 RepID=A0A1F8UXW3_9FIRM  ali  1..............................MQAGDLNTRITIQHDTSD-GTTTPSWATFCIIMANKKGLTGKTFYQAAAVQAESDIIYTIRYRKDITAGMQIIDCNSTL-TIVDVNNRKQWLEIHAKEV.... 101
358 5.000e-06UniRef50_UPI000BFD8AE9 head-tail adaptor protein n=2 Tax=Bacillus cereus group TaxID=86661 RepID=UPI000BFD8AE9  ali  10  3.............................PGKLDKLTFQVKDDEAKSPDGDQVESYKDSFTVWGSFIFLKGRKYFAAAAANSEIQGETEIRFRADVNADMKMKY-KNVMYDIISV.................. 88
359 5.000e-06UniRef50_A0A227JTA5 Uncharacterized protein n=1 Tax=Phenylobacterium zucineum TaxID=284016 RepID=A0A227JTA5_9CAUL  ali  15  18...................................RITIQDQNAAIDTDGSELTTWTDIATVWARLEPDSVVEDIIGGRGQTRRKWVCTIRYRTDITTRMRVSWRGRVVIGIVNVGERRKYLTL---ELVETN 117
360 5.000e-06UniRef50_I2IP80 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Burkholderia sp. Ch1-1 TaxID=243261 RepID=I2IP80_9BURK  ali  5...............................KLDRRITIQRRTNSKNASGGNVAGWADVDTVWAGVNYLSGME--RSATVHADARTVFTMRYLSGIDETMRV-LYGSKLFNIRFVNDQHKTLILTC....... 104
361 6.000e-06UniRef50_UPI000C070376 head-tail adaptor protein n=2 Tax=Clostridium TaxID=1485 RepID=UPI000C070376  ali  13  1..............................MNIGQLKHRIELESTYDKEGFPIEEYVTFQKAWADVNDLYGKEYWNSKQNISENITVFHTRFYKNIDTDCFI-LFKGHRYEIIEPPDNIKYL........... 94
362 6.000e-06UniRef50_A0A2E1CUV0 Uncharacterized protein n=1 Tax=Kordiimonas sp. TaxID=1970157 RepID=A0A2E1CUV0_9PROT  ali  11  1..............................MNIGDLRERVTLEQTTADGGGGYSQSWESVGVFARVRPLTAREVAQAGQEIAQSRYEVTMRYRDGVTTAMRLQWQGR----ILNIDERRRFLTMACLEGEVT. 107
363 6.000e-06UniRef50_A0A075MJV4 Phage head-tail adaptor n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A075MJV4_9PROT  ali  13  2..........................NPKFTQLNKRITFQIYKLARDDMGGSIYTWHDGISVWAAVTPQKGNVKHRAHVDLKEGHYSIVIRYNENITENMRIKF-NRQIFKIEKIINHNIFQIIYCRE..... 105
364 6.000e-06UniRef50_A0A1B2DVB1 Uncharacterized protein n=1 Tax=Paenibacillus ihbetae TaxID=1870820 RepID=A0A1B2DVB1_9BACL  ali  11  11..................................RITIQHYTTVEVDDEGIARKDWVPLATVWASYAATGAREYFQAAAINAEKRIQYRIRYRKDILPKMRV-VDDGKTLEIITV.................. 92
365 6.000e-06UniRef50_A0A2S4HGF4 Uncharacterized protein n=1 Tax=Zhongshania sp. ZX-21 TaxID=2067667 RepID=A0A2S4HGF4_9GAMM  ali  11  1..............................MRAGPMRFVATLQNPSDEYSTVGGYAVTATGVRVGIRNVSGKETHAAKQTGSEVGVELNTRYRSDITGASRFVVG-ATTYEVLYVNNRNRELRLPCKVVS... 105
366 7.000e-06UniRef50_A0A1D3R866 Phage head-tail adaptor n=6 Tax=Bacillus cereus TaxID=1396 RepID=A0A1D3R866_BACCE  ali  11  1.......................................MKEDGYKDELGQWISEWQPFAKLWSRIFTVSGREYFAAASVQNETTLRFVIRPNFEITPNEEIEFKGKRYASVLNDDFQNRTLTIIAK...... 91
367 7.000e-06UniRef50_A0A0T6VIS2 Uncharacterized protein n=3 Tax=Pseudomonas TaxID=286 RepID=A0A0T6VIS2_9PSED  ali  10.............................................SDGMGGWQEGWSTIATEWAAVDSVSGDEYFSAAQLQTLLSAKVTMPYRADLTTEWRLIYHGKQYNKAILPNNDMSEMTLLC....... 91
368 7.000e-06UniRef50_A0A2H0QZA8 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_39_49 TaxID=1973900 RepID=A0A2H0QZA8_  ali  11  11..................................QMRHVITFQSTTDNAGGNTVGWTDFMSVWAKIEDISGAEKNFSGQLNDTRSYRITVRYIGGVTTDMRV-LFDSRAFNIINVNERNEILQIFAEE..... 116
369 7.000e-06UniRef50_UPI000A27125A head-tail adaptor protein n=1 Tax=Clostridium massiliodielmoense TaxID=1776385 RepID=UPI000A27125A  ali  11  34...........................................................KKVYARIEPLRGKEYIENRKTEAEQIYKVTIRYRKDVNTEMFIKYKNRLFNAIINPYEMNERLELICTE..... 104
370 7.000e-06UniRef50_UPI000C81D2CE head-tail adaptor protein n=1 Tax=Citricoccus massiliensis TaxID=2045010 RepID=UPI000C81D2CE  ali  14  2............................RPIRPGKYRYIQNMESIRNTDGEWVDEWVDFKKKFADKVPLNSKDYFEAKASNAVLTVVWKTRYDESITGSMRIKNKDGSIKEVYDIQG................ 95
371 7.000e-06UniRef50_A0A2S2DFV1 Head-tail adaptor protein n=1 Tax=Massilia timonae TaxID=47229 RepID=A0A2S2DFV1_9BURK  ali  12  5...................................RITLQRREAGEDRIGQPTQTWVDLAAVWAHVKFQTGAEAIRANAETSVVKASIRIRARQDVDAGMRAKF-KTWLFEIKAPDRDPRFMFLVCEAV.... 101
372 8.000e-06UniRef50_UPI0006708380 head-tail adaptor protein n=1 Tax=Dakarella massiliensis TaxID=1506471 RepID=UPI0006708380  ali  10  7...............................NFNRRVTIQYLSSEADDWGQPKKEWLDLCTVWAWIKAPTGSEYQSESGDISRSQYSIRIRYRSDVTAKMR-AVCEGTIYDIRSV.................. 94
373 8.000e-06UniRef50_A0A069A8M7 Putative phage head-tail adaptor n=5 Tax=Clostridioides difficile TaxID=1496 RepID=A0A069A8M7_CLODI  ali  12  6................................LNRKITIQIREERKDENGFTINEWLDFKTVYSSIKNLYGKEFLQAQALNSKASKKIKIRYIKELDIEYRV-VYKNIIYNILYIDEANKYMEIMLEG..... 111
374 8.000e-06UniRef50_A0A0F9RZH1 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9RZH1_9ZZZZ  ali  1..............................MRAGQLRHRIKIQQNDGKAAGDVPDWTTIEPVQARVESLTGQEKIEGGQNRGEATHRVTLRHRTDVTEKHQLLWESQTLIEAIIPADRPTEIVLLCKRV.... 110
375 8.000e-06UniRef50_A0A011VNX3 Head-tail adaptor protein n=17 Tax=Proteobacteria TaxID=1224 RepID=A0A011VNX3_9RHIZ  ali  21  31....................................................SEQWHEVATVFARIEPLAAQSRFGADTMLETVTHRIALRKRAGIEGGMR-FRRGGRLFEIVTVDESGRY--LVCR...... 105
376 8.000e-06UniRef50_D0S8Q4 Putative phage head-tail adaptor n=38 Tax=root TaxID=1 RepID=D0S8Q4_ACIJO  ali  14  8................................LCHRVTIQHKTTTYDEYNYETEAWIEYKKLWSKLEFLSVKDGLTAKAAGSETTARLKLRKRDDIDSSMRV-LFDGQTFQIVSPDNENGYMTLELSLVE... 109
377 9.000e-06UniRef50_A0A104NGL5 Uncharacterized protein n=13 Tax=Burkholderiales TaxID=80840 RepID=A0A104NGL5_BURPY  ali  1..............................MRTGKLRIDRLDPDAQDEYGQAVPAWKSLGTVWASIAQQSGLATISGGAEVGEMKVSIRLRYRTDLHEGMRVTL............................. 78
378 9.000e-06UniRef50_Q3HQT3 Gp73 n=41 Tax=root TaxID=1 RepID=Q3HQT3_9CAUD  ali  12  29.....................................................DDWVTHDEVWASVRFVSGKEHVISGAVRSSAIASIRIRFREDIDSEMRIRYGD-QLYDIVAVNRRKGSLDLPVK...... 103
379 9.000e-06UniRef50_A0A0F9C4F6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9C4F6_9ZZZZ  ali  21  2....................................................VTTWATVATIWGSIEPLRSTEFYDSALINAESTIKIVTRYTSDAKPNYRFVFGTRVFLAIQNIMERNKEMHFGVKE..... 81
380 9.000e-06UniRef50_A0A2W4NB85 Head-tail adaptor protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4NB85_9PROT  ali  18  44.......................................................WQPIATLWSEIRPISAKEVFRADASYGLWMYEIRIRFREDVRPEMRF-ICGPRIFYIHAVWDKIGFLSCICKERE... 120
381 1.000e-05UniRef50_UPI0006D12E28 head-tail adaptor protein n=2 Tax=Lysinibacillus TaxID=400634 RepID=UPI0006D12E28  ali  10  10..........................EQKKLNTGEMRNRIEVQETVNENGYPVEDWQTKHHLWAKIKTVKGSEVIKAAAEVNTETYRFIVRYTEGLNAKQRI-VFKNRIYDIQAVDELQNTQTIIA....... 114
382 1.000e-05UniRef50_A0A1J0GW94 Head-tail adaptor n=1 Tax=Alteromonas phage PB15 TaxID=1913113 RepID=A0A1J0GW94_9VIRU  ali  17  14..................................KVDLYRLEKVATPTGGFTQS-WVKVATLWAAIKNMSGTELVHADQLGATSYSDFTIRYRSNINETMKFVYRGTDY........................ 87
383 1.000e-05UniRef50_I7ZE65 Uncharacterized protein n=1 Tax=Hydrocarboniphaga effusa AP103 TaxID=1172194 RepID=I7ZE65_9GAMM  ali  17  29......................................................TWTPVIELWAEVKPMSVTGLLAAQALQSQATYVITIRYRTDIDRKMRVRLRDDMIFAIEAPDDRSGWVTLHCSQ..... 109
384 1.000e-05UniRef50_V5PRM4 Head-tail adaptor protein n=10 Tax=Burkholderiales TaxID=80840 RepID=V5PRM4_9BURK  ali  16  8....................................RRVRIEQRAGTGTLTDPKRWAPLATVWANVKMLTGKESLLADSDVGEATASIRIRYRTDLDNSMRLKFVDGQPVDIFNIQKPLEYTDLACTE..... 110
385 1.000e-05UniRef50_UPI000DAC7D8D head-tail adaptor protein n=1 Tax=Rhodobium orientis TaxID=34017 RepID=UPI000DAC7D8D  ali  10  2...........................TRPPTIGELHHRLTPERTPDDAGGATVSWVTVADVWAAIAPASATETDIAGRLDGIVTHRVTLRRRADLVGGMRF-VAGTRVLKILDPDARGRWTECLAEE..... 107
386 1.000e-05UniRef50_A0A0L0QN40 Uncharacterized protein n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A0L0QN40_VIRPA  ali  11  2...........................TNPAKYRCRITFQRKENVQDGEGNWVPGWVDTDTVWAAIKDLRGKEIIEAGANSVKITTRIYIRYREGLSEDMRIKYG-ARIFDI..................... 86
387 1.000e-05UniRef50_A0A1G8ETS5 Head-tail adaptor n=1 Tax=Aneurinibacillus thermoaerophilus TaxID=143495 RepID=A0A1G8ETS5_ANETH  ali  12  9..............................MRIGKMNKRITIQRLQTTVAGAQETWTDVATRWA---------YFDNRQS-----LRIVIRYLSGIESGMRVLYGNKIFEEVKDIEERSKEVHLIVKEV.... 97
388 1.000e-05UniRef50_A0A136P0K3 Phage head-tail joining protein n=1 Tax=Chloroflexi bacterium OLB13 TaxID=1617414 RepID=A0A136P0K3_9CHLR  ali  11  2............................QAGLLRKRITFQQRLITRNSYGEQVITWGDVVTVWADVRPLTERDEGRANQVQATIMYDIDIRYRTGLDPTMRI-LYEGQALDIHSI.................. 92
389 1.000e-05UniRef50_A0A2H4JC00 Uncharacterized protein n=1 Tax=uncultured Caudovirales phage TaxID=2100421 RepID=A0A2H4JC00_9CAUD  ali  1..............................MRAGPLRHRVELQSETQQSGGGRKTWAMYGEAWAGIDTPSGRTSTVAQQLQATVTVEITMRPRKDLKAGHRIKLTDTTYVEAVLPDNVFSMLRVLCSTL.... 105
390 1.000e-05UniRef50_A0A1V5QMR4 Phage head-tail joining protein n=2 Tax=Betaproteobacteria bacterium ADurb.Bin341 TaxID=1852821 RepID=A0A1V5QMR4_9PROT  ali  6................................LNRKISIRKSTSTSDAYGGQIPTWSTFNDAWARVRPLSMREMWQADQVSSPIDTEFLIRYATGITPSMLV-YYDGKEYNIHSV.................. 88
391 2.000e-05UniRef50_UPI0009FA1D87 head-tail adaptor protein n=1 Tax=Nitratireductor basaltis TaxID=472175 RepID=UPI0009FA1D87  ali  15  33..................................RLTLQQRQETDDGAGGFA-SLWQNLDPVWARIIPVEGIVAHSAANLGHAITHWIYIRMNNSVRPGMRF-VKGARIFDVDTVDETGRY--LVCKVVE... 127
392 2.000e-05UniRef50_A0A228II99 Head-tail adaptor protein n=1 Tax=Burkholderia sp. AU17325 TaxID=2015348 RepID=A0A228II99_9BURK  ali  19  1.........................................MSGRDPDTGQEIDAWTEYASVWGAVLQINGKERITGGTSVDIGSASIRIRYRDDVTNGDR-AVAQGVIFNIASVVASREYTDLVCTE..... 89
393 2.000e-05UniRef50_A0A1S6ILW1 Uncharacterized protein n=1 Tax=Jeotgalibaca dankookensis TaxID=708126 RepID=A0A1S6ILW1_9LACT  ali  15  31......................................................EYVEFGSAWAHVSNLHGDEYYSALGLSLEKELKFTIRYRDDISEDTAITFRDN-VYNITFIDNRNRFMEL......... 102
394 2.000e-05UniRef50_A0A0F9ELX4 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9ELX4_9ZZZZ  ali  10  1..............................MRAGPLRHPVTTTETDDDDGVLVVTDQEVEDAWISIEPLRGREAIEAKQLNPTLTHKVRKRHGEVITPDC-WFVHEGRTFNVINVDERDEMDELLCGEAV... 105
395 2.000e-05UniRef50_A0A2U1SG77 Head-tail adaptor protein n=5 Tax=Methylocystis TaxID=133 RepID=A0A2U1SG77_9RHIZ  ali  4..............................LAIGALRHRVTLEDAPDGAGGFSRSFTPVVNLWARIAPSGVREDFVEQRAEQAATLVVTIRWRDDVAKDMRFVYRGRRIQSVADPDERRRFLICACEEI.... 107
396 2.000e-05UniRef50_UPI000B897422 head-tail adaptor protein n=1 Tax=Desulfuromonas thiophila TaxID=57664 RepID=UPI000B897422  ali  13  40........................................................TSVCTTRAAIWPTSAREARENMREGVTVTHNIRIDYRPGINETMRV-LFDGRSFEIVNPEEANLYLDLLCEEL.... 114
397 2.000e-05UniRef50_UPI00068AF6CD head-tail adaptor protein n=1 Tax=Pseudomonas sp. C5pp TaxID=1586081 RepID=UPI00068AF6CD  ali  19................................................TGQPKKAWVQFATPWAEAVAVSGRQYLAADAERSEITMQFIMRSAPHLRAGLRVTRNDGQAYDVVAP.................. 85
398 2.000e-05UniRef50_A0A1F4JUX5 Uncharacterized protein n=5 Tax=Burkholderiales TaxID=80840 RepID=A0A1F4JUX5_9BURK  ali  14  1..............................MKLGKLRIEVSQMAQDPNYGTPVAAWVPFATVWAQVQDVSKAESQTSGMRVASRPARIRTRYLVGVTTGMRVLSRGNRVLQIVS................... 92
399 2.000e-05UniRef50_A0A2S0M4M0 Head-tail adaptor protein n=2 Tax=Megasphaera TaxID=906 RepID=A0A2S0M4M0_MEGEL  ali  17  7................................LDKRVHLLGYKDVKNSNGFYEQQFVDLVGVYARIEPARGKEQYEADKDASTYMLKVTIRYRKGIDENTVVQYGDNLYNVITAIDPYMRHLELMV....... 107
400 2.000e-05UniRef50_A7GEE3 Putative phage head-tail adaptor n=6 Tax=Clostridium TaxID=1485 RepID=A7GEE3_CLOBL  ali  15  11...................................RITIQKYTTTQNENGFDIEEWDDYKTVWASMNNLWGKEFYAAKATNSENTIEFIVRYLKNINTKERIKTIKDRYFDITFIDNKNKWLKIKAIEVI... 122
401 2.000e-05UniRef50_A0A1X4MXR1 Uncharacterized protein n=2 Tax=Thalassospira sp. MCCC 1A01428 TaxID=1470575 RepID=A0A1X4MXR1_9PROT  ali  14  4............................QPGDLNESIVFQAVSTVPDAIGGQVQSWATVAPSWARITPLSARDQVVAMQTGNSTQYRADLYQRRDITADMRILRNDGTVLEIVLIERNTAFMAVLCK...... 105
402 2.000e-05UniRef50_A0A1M3BV25 Uncharacterized protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A1M3BV25_9BURK  ali  13  77............................................................TNWAVVEPLAGRESFAVDAARSEVTARVRMRCRPGLTGKDRV-VHERTIYNVVSVDARSEHREPVL....... 142
403 2.000e-05UniRef50_A0A1N6XC61 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Pseudacidovorax sp. RU35E TaxID=1907403 RepID=A0A1N6XC61_9BURK  ali  10  1..............................MDIGKLKCQVQLQSATDEAGQPIHTWQALATVWADVRFPGGLEAIRADAQLTVTRASVRIRYRTDVDAASCRLLFKGAVYDIQAVDEAHRYLDLVC....... 102
404 2.000e-05UniRef50_W5SB34 Putative cytosolic protein (Fragment) n=1 Tax=Borrelia hermsii YOR TaxID=1293576 RepID=W5SB34_BORHE  ali  31  2........STRDRLASMAERMIGRFREESYFLFYKGHIRMMMSFESPEI.................................................................................... 42
405 2.000e-05UniRef50_A0A1E7S5A7 Phage head-tail joining protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1E7S5A7_BUTME  ali  11  3.............................PGKLNKRITFLLPPGGTDVDGFPQTEWRPGKDTWANVETENGRGFFGANAEMHANKAVFKCRYFKGLQRDWRVAY-DGRQFQIVNENGAGRFYVILCEEV.... 104
406 2.000e-05UniRef50_A0A1V5ILS0 Phage head-tail joining protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5ILS0_9BACT  ali  17  27.....................................................TTWNDAQTVYAAIWPISAKETVQAMGQAMTITHRVRMRYRANIRSNWRIK-HGNRYYNIVSIINPNKWLDILVKE..... 103
407 2.000e-05UniRef50_A0A1Q9AIF1 Uncharacterized protein n=2 Tax=Rhizobium rhizosphaerae TaxID=1672749 RepID=A0A1Q9AIF1_9RHIZ  ali  19.........................................PVEAPDGQGGVSIAYQTAGALWARIEPVQARWEEAGNEAGAERTHRIWLRHRDDLKAGDRLRLGARTLLSLHDPDETRRMLVAEARELV... 109
408 2.000e-05UniRef50_V5MI55 Uncharacterized protein n=56 Tax=root TaxID=1 RepID=V5MI55_BACTU  ali  10  2............................KPGKLDKLAFQVKDEEAKSPDGDPIEDYKDSFTVWGSFIFFKGRKYFEAASANSEVQGETEIRFRADVNADMKMKY-KNVMYDIISV.................. 88
409 2.000e-05UniRef50_A0A168W012 Uncharacterized protein n=1 Tax=Fictibacillus phosphorivorans TaxID=1221500 RepID=A0A168W012_9BACI  ali  15  1..............................MNEYPHTIIFQQKTKIPDSGGFTEDWATFKVVEALVQPLSGSKYFLAQQIQSKINYKIFMDFDSEINFKFRINYNGK----ILKID................. 83
410 2.000e-05UniRef50_M5IN78 Uncharacterized protein n=2 Tax=Campylobacter showae TaxID=204 RepID=M5IN78_9PROT  ali  13  3..............................................NEYGEVEKGYADLAKVWASIEPISANEKYLRNQENMQITHKIEIRFLKSIGVTTQILFNERKFKSVINPLEKNEKLILLATE..... 86
411 2.000e-05UniRef50_A0A1I1BM46 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Delftia tsuruhatensis TaxID=180282 RepID=A0A1I1BM46_9BURK  ali  11  6.................................YKRRFLIQQRAPGVDDGQPLDDWQDVIAVWGNIRAPSGLEFVAAAQEVSRVQYSIRTPYRPGLTAGMR-AVGAGVVYEI..................... 89
412 2.000e-05UniRef50_A0A261S6C2 Head-tail adaptor protein n=3 Tax=Bordetella TaxID=517 RepID=A0A261S6C2_9BORD  ali  12  8...............................RRVRLQHPQQRENPANEADL---EWVEFASAWASIRHTSGLKALIAGADRPIVRASVRLRYRRDVSMGMRLVHGDDHYVEAVLPDERREYVDLVCR...... 102
413 3.000e-05UniRef50_UPI0007DFCFB0 head-tail adaptor protein n=7 Tax=Clostridium TaxID=1485 RepID=UPI0007DFCFB0  ali  11................................LNKRISIQKYTTIQNDNGFDIEDWQPYKTVWASMNNLWGKEFYAAKSTNSENTIEFIVRYSKDLE.................................... 75
414 3.000e-05UniRef50_A0A0E1FN01 Head-tail adaptor protein n=68 Tax=Pseudomonadales TaxID=72274 RepID=A0A0E1FN01_ACIBA  ali  14  9................................RHRITIQKAIQTQDQNTGKLITSWSNFATIWAEVTDLSTRDVIAAKAANSAIQARAKVRYTKQVDSTMRV-LFDGYYYKIRDPDSRREYLTI......... 107
415 3.000e-05UniRef50_A0A133QNN0 Putative phage head-tail adaptor n=35 Tax=Staphylococcaceae TaxID=90964 RepID=A0A133QNN0_STASI  ali  22  27........................................................KTIAKPWADIKTIRGNEFLGSGLTASEIPVRFIIRYREGINSKQRIKWKDLD-FNIESVQNDNG............. 89
416 3.000e-05UniRef50_UPI0009BEE095 head-tail adaptor protein n=1 Tax=Burkholderia vietnamiensis TaxID=60552 RepID=UPI0009BEE095  ali  13  9...................................KISLQRKSSGQDELGQPVDVWTEYALVWGSVRQLTGKEKVAGGTQVDTGTASIRIRYRTDVNNGDR-AIAQGHTFNIASV.................. 87
417 3.000e-05UniRef50_A0A127EHT1 Uncharacterized protein n=5 Tax=Clostridium perfringens TaxID=1502 RepID=A0A127EHT1_CLOPF  ali  10  3...............................RFRERITFQTLTTTTNENGFQSENWVDYYTCWSDLKSMNGREYFESLANNTELIVSFRCRYLNNLDTKKVRILHKNKTYDIYNVQDSNSFIEFKCKSIS... 107
418 3.000e-05UniRef50_T0G5Z3 Uncharacterized protein n=3 Tax=Sphingomonadales TaxID=204457 RepID=T0G5Z3_9SPHN  ali  16  10..................................RIRIERKVVTPDPLYGTETVTWTEFATVWAEVQPSRAERLADS-IVIANRPARIRMRHLAGITPDMRVIIGT-RVLQIVS................... 90
419 3.000e-05UniRef50_UPI00096EF387 head-tail adaptor protein n=1 Tax=Sphingomonas montana TaxID=1843236 RepID=UPI00096EF387  ali  13  2..........................GDRPNLASRMRHRITVNRSSDGRGGYDDEWQPIATLYAEVTSLASREALIAQAMQGVSSYKIVVRYGADVRVSDQI-LHDGKTLNVRSADDPDG............. 97
420 3.000e-05UniRef50_S9S5B8 Phage head-tail adaptor, putative n=1 Tax=Salipiger mucosus DSM 16094 TaxID=1123237 RepID=S9S5B8_9RHOB  ali  15  1..............................MKAGKMVHVIEIQTTVNDAGTPKKTWSKLATLRAELIEQSTEEFLHNAGDTSVMTLAFRTRYLAGITDEHRVSF-DGQAFDIEKIVGRRRGLELRCKAVS... 104
421 3.000e-05UniRef50_A0A0N8GM78 Uncharacterized protein n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A0N8GM78_9CHLR  ali  15  4..........................NDKPINPGELRTPITLKKRTVTTGFKTEVYTNVATVYARWQNAHGREVWTADMAGAIAPATVLIRYLADIDESW-VVDKNGEIFEIVSIDERNEYLEIKVKRL.... 111
422 3.000e-05UniRef50_A0A2V2FVM1 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2FVM1_9FIRM  ali  13  45..............................MKAGDLKHQITIERPKYSTGNRRTKWLPVITCMAKITDVSGRDFFAAQAYQAQDVVTFGVRWLDSIDKECRI-IHDGRVYHIEQINHKRDFLHVKAREI.... 148
423 4.000e-05UniRef50_A0A1E4DTX8 Uncharacterized protein n=2 Tax=Hyphomicrobiaceae TaxID=45401 RepID=A0A1E4DTX8_9RHIZ  ali  11  10..................................RSRIQIQRATTVTSSGFTTEVWHNYQALWSRVRYQSGREFLQAGQVSSSHVAVFSIRWRNDLKPYDRI-IHEGKVWNITAI.................. 89
424 4.000e-05UniRef50_A0A072WV61 Phage head-tail adaptor n=14 Tax=Firmicutes TaxID=1239 RepID=A0A072WV61_CLOBO  ali  13  1..............................MEFYKMDRRIEFISKTDEDGFPTDEWQTVRKCWCRIRGLRGKEFYSASAVQSEDDKVFNCRYFKGLKSNMKIKYNDK-IYDITSINEKHEEYEIHAKEV.... 105
425 4.000e-05UniRef50_A0A0Q5MQ45 Head-tail adaptor protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q5MQ45_9BURK  ali  11  28.....................................................ESWDEVAKAWASIRNLSGLGAIKADAQAAVVKTSIRIRYRADVAAGMRV-LHGTTVYDIKAVDEAGRHVDLVCEVVS... 106
426 4.000e-05UniRef50_A0A0C3M8J8 Head-tail adaptor protein n=7 Tax=Clostridium botulinum TaxID=1491 RepID=A0A0C3M8J8_CLOBO  ali  14  26..........................................ENAIDEDGYPIEGEKTIKPVYANIKSLRGSEFYQASQVNAQDNKIFYINYFPGLNAKAQIEY-KNEIYEIINIDEANMEYEIRAKLV.... 115
427 4.000e-05UniRef50_A0A009JQS9 Phage head-tail joining family protein n=22 Tax=Acinetobacter TaxID=469 RepID=A0A009JQS9_ACIBA  ali  14  9................................RYRITIQKPIQTQDQNTGKLITSWSNFATIWAEVTDLSTRDVIAAKAANSAIQARAKVRYTKQVDSTMRV-LFDGYFYKIRDPDSRREYLTI......... 107
428 4.000e-05UniRef50_A0A2B9ATI4 Head-tail adaptor protein (Fragment) n=1 Tax=Bacillus cereus TaxID=1396 RepID=A0A2B9ATI4_BACCE  ali  16  1.......................................................WQEVKKAWAMIKTVKGSEYIEASASQSTRIYRFVIPYTTGITELMRIKM-KSRTFDIIEPDEMYQTLTIIAKE..... 76
429 4.000e-05UniRef50_A0A2D9C9F7 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D9C9F7_9BACT  ali  13  1..............................MKIGKLDRRITIERATNDYGERAETWTTLATVWAEISRGGGNESIQSDQVYAVQRVRFIIRYVSGVRPSDRVSY-NGQLYQIEAVQE................ 93
430 5.000e-05UniRef50_A0A011N3J9 Bacteriophage head-tail adaptor n=1 Tax=Candidatus Accumulibacter sp. BA-92 TaxID=1454003 RepID=A0A011N3J9_9PROT  ali  17  2...........................................................ATVWASLEPSVGRELVAAQAVRLDQPTTITIRWQPSFVAAMR-AVYNGRTFNIHSVDERNVLLTLSASE..... 77
431 5.000e-05UniRef50_A0A2N2GKB6 Head-tail adaptor protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-6 TaxID=2013756 RepID=A0A2N2GKB6_9DELT :_  ali  15  7................................LNKLIDIQAQTKASDSMGGFTTTWTTLAAVAAAIWDATSNERNQANATTLIITHRVRIRYRSIFRSAWRLKFG-NRYFSIVSVGEKNEYLDLFCKE..... 105
432 5.000e-05UniRef50_UPI0009FF3DDA head-tail adaptor protein n=1 Tax=Kaistia granuli TaxID=363259 RepID=UPI0009FF3DDA  ali  11  39.............................PGQLSSRIVLERPVRTADGAGGATVTWEAVATLWAAIESVAAGESLAADRLSTRVTHRIRIRFRADIEGGLRIVYRG-RILRIADPDDQRRFLVL......... 135
433 5.000e-05UniRef50_A0A2A4R592 Phage head-tail adapter protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2A4R592_9RHIZ  ali  16  11.................................FRRRVTLQEETETPDCGGFTTGWVSVSDIWAQITPVGSASISRADNVDQEVTHTVMVRKTGNLQQGMRL-LFGSRIFLINSVDETGRYTQCDVRE..... 108
434 6.000e-05UniRef50_A0A0J5GP34 Uncharacterized protein n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A0J5GP34_9BACI  ali  14  21..........................................................ITEAWADIRTMQGREFNSATIAGNVGVSRFIIRYMPGLSARMRVQY-KGVTYSIKSLDEQNRTITII........ 89
435 6.000e-05UniRef50_A0A0S4KJE5 Phage protein n=4 Tax=Janthinobacterium sp. CG23_2 TaxID=1706231 RepID=A0A0S4KJE5_9BURK  ali  16  31.......................................................WTEFAKVWADIRHTGGMEAIKAGAVTTTVQASIRLRQRAGLHAGMRV-LHDGTIYKVQAVDKEHRHIDLVC....... 103
436 6.000e-05UniRef50_A0A238ZTJ2 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Anaerovirgula multivorans TaxID=312168 RepID=A0A238ZTJ2_9FIRM  ali  11  3.............................PGRLNKRIEVWYKVKELNDLKQTVQKDKFKTKLWAAIIPQTGKSFSAADTKQAEITHKIEVRYRNDLKSNMHIKYRGRRFKYILDPYEKHEKLEIYVSEVV... 106
437 6.000e-05UniRef50_A0A0D1NNJ1 Contig0024, whole genome shotgun sequence n=6 Tax=Bacillus cereus group TaxID=86661 RepID=A0A0D1NNJ1_BACTU  ali  10  3.............................PGKLDKLTFQVKDEEAKSPDGDPIEGYKDSFTVWGSFIFLKGRKYFEAAAANSEVQGETEIRFRADVNADMKIIIF............................ 79
438 7.000e-05UniRef50_A0A2E1XW30 Uncharacterized protein n=1 Tax=Phyllobacteriaceae bacterium TaxID=1871068 RepID=A0A2E1XW30_9RHIZ  ali  14  28.....................................................STWSDIRTVWASMKYDKADEQFNAGQRYAQRIVTFTTRFSHDITALDRVR-CLNVTYEILGVTE................ 90
439 7.000e-05UniRef50_A0A2S8IYA2 Head-tail adaptor protein n=14 Tax=Burkholderiaceae TaxID=119060 RepID=A0A2S8IYA2_BURCE  ali  12  43..................................RVRIEALDPDAQDAYGQPKEAWVKVCEVWADIMGKSGSQVMRSDQPVGEVKTSIRVRYREGLHEGM................................. 108
440 8.000e-05UniRef50_UPI0009DE5DD8 head-tail adaptor protein n=3 Tax=Aeromonas TaxID=642 RepID=UPI0009DE5DD8  ali  16...............................RLNKRVTILEREQGTNDWGEPVEIWTPVLTCWANVRYVTGREIIEGGLVFSEQTITVVMDYSSLILPKHFIEADGKRFIQAVAPDATDKYMNVTAKQ..... 113
441 8.000e-05UniRef50_A0A0C5UVA0 Head-tail adaptor protein n=5 Tax=Xanthomonas oryzae TaxID=347 RepID=A0A0C5UVA0_9XANT  ali  11  3...............................RAGKYRQRIALTTVKDGFGDAVQLWQTWEEVPAEVVALSGKEFIASGADQAQLTARIAIPYLPGVTSDMRV-EHDGQVYVITAVDASGRHLTLMA....... 103
442 8.000e-05UniRef50_A0A0J1FRU9 Phage head-tail joining protein n=1 Tax=Desulfosporosinus acididurans TaxID=476652 RepID=A0A0J1FRU9_9FIRM  ali  11  28........................................................VDVATFRAAYVPNNGRMYPGAGQIHTETDCEFRMRYSPLPQPGMYVRFNNNTYY-IQTVDDEGGELRIICK...... 100
443 8.000e-05UniRef50_Q5XZ94 Uncharacterized protein n=1 Tax=Borreliella bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) TaxID=290434 RepID=Q5XZ94_BORBP  ali  76  1......MSGVRKRLADMSTRMINVFKDPETLR..................................................................................................... 26
444 9.000e-05UniRef50_B9K2S6 Bacteriophage head-tail adaptor n=2 Tax=Rhizobium/Agrobacterium group TaxID=227290 RepID=B9K2S6_AGRVS  ali  11  1..............................MRAGKLRITLLRETETGRDALNQPEWVGIKTVWAGKTVNKGTEVVQAQQMSGTRPLTFRIRHRPGLSLKDRVRY-DGALYEIKDIRE................ 90
445 9.000e-05UniRef50_A0A2S4LX77 SPP1 family predicted phage head-tail adaptor n=7 Tax=Burkholderiaceae TaxID=119060 RepID=A0A2S4LX77_9BURK  ali  12  10................................LNRLMAIQQRSTTRDSFGQQVEAWTTIKSVYAYIEALSGSERAAAQSISTDVSHRFTVRYDPRVAATYRI-VYASRIFDILNIDESNRSIELLASE..... 112
446 9.000e-05UniRef50_UPI000C7B7107 head-tail adaptor protein n=1 Tax=Halobacillus sp. Marseille-P3879 TaxID=2045014 RepID=UPI000C7B7107  ali  15  11......................................IKIQGKSSDEPQYDHDGYPTTYSVRAKVKPVSAQEYHKAKADQTENITRFIIRYRKGVDDSMKV-IYKDRVYEIESVNEANITLTIMGREVS... 112
447 1.000e-04UniRef50_B2JU95 Phage head-tail adaptor n=6 Tax=Burkholderiaceae TaxID=119060 RepID=B2JU95_PARP8  ali  14  10................................LTRGISVQTRTTQRDSFGQQVLGWIELKQVYAAIEALTGSEREAAMSISTDISHRITVRYDPKTVATYRI-VYGTRLFNVLNIDEANRVVELLCTE..... 112
448 1.000e-04UniRef50_N8VAR1 Uncharacterized protein n=7 Tax=Acinetobacter TaxID=469 RepID=N8VAR1_9GAMM  ali  10  1..............................MKAFNLKHRITIQYEDPRTGKQISQWTDLATLWAEVTDLSTKDQIAAKAAQSTIQARAKIRYSKQISSSMRVKF-EGYYYRIADPDSRREYLTL......... 106
449 1.000e-04UniRef50_R5EAT0 Phage head-tail joining n=5 Tax=root TaxID=1 RepID=R5EAT0_9FIRM  ali  12  5.................................DKKIRIIAFTSTTNEHGFSTEEWRPIHSLWAYYRQLSGSEFYASAMVNAAEEVVFTVNHRTDVTTEMLVEYGGK-FYDIKRIDNYEGYTSLYCK...... 102
450 1.000e-04UniRef50_A0A2N0VSW1 Uncharacterized protein n=8 Tax=Macrococcus caseolyticus TaxID=69966 RepID=A0A2N0VSW1_9STAP  ali  10  13..........................NEKVGRLDKRITVIT-TNDVSEDGWNNSEETVFHKCWAQLVDIRTRDYNSAVQVGTENQIYFRIRFKEGITTDMSIRYKD-EHYSIVDMDERLPYMYIVAKR..... 115
451 1.000e-04UniRef50_T2GD24 Putative phage head-tail adaptor n=1 Tax=Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) TaxID=1121448 R  ali  11  2..............................LRAGQLRHPVMVQANTPTQDAGGEAWADVGLAWADIDDVRGQESRLAMENQGYVTHKIKIRPFAGLTIKHRILWG-SRVLNISHIDD................ 90
452 1.000e-04UniRef50_A0A0F9G137 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9G137_9ZZZZ  ali  14  1..............................MDTGKLRHTVEIQERVDTYAPDGVTWSTVATRKAAIKPATAEEFLEADRTGSVAPRTLVMRYYSGTLTPAQQLLFDGKTYGIQSVDERNRTMEVRCKEV.... 104
453 1.000e-04UniRef50_A0A2L0VRB1 Uncharacterized protein n=2 Tax=Sphingopyxis sp. MG TaxID=1866325 RepID=A0A2L0VRB1_9SPHN  ali  58..............................MRAGDMDRRVTLQTTQDEYGEEIQTWTDLATVFAEVRQQGGQEYLAAATTLAERRVVFFLRWFPGLTVEDRVSY-DGLLHNIKEVRE................ 146
454 1.000e-04UniRef50_A0A2N9XAL7 Uncharacterized protein n=2 Tax=Snodgrassella alvi TaxID=1196083 RepID=A0A2N9XAL7_9NEIS  ali  11  1..............................MRAGLLRTRITPVSNKDANGAVIHDWAEFGKLWADVRNKSGIETIKADKVTGIVRVSIRVRYNTKLNNAMRV-IVNNVIYNIKAVMNSREYTDLICETV.... 104
455 1.000e-04UniRef50_A0A068T590 Phage head-tail adaptor n=55 Tax=Rhizobiales TaxID=356 RepID=A0A068T590_RHIGA  ali  10  33.......................................................WEVTATLWARIEPLSVVVAEQAAAEAGTISHRIWTRFRDGISAGQRFRKGGRIFLLVRDPDETRRYLVCQCEE..... 107
456 1.000e-04UniRef50_UPI0009E6639F head-tail adaptor protein n=1 Tax=Janthinobacterium sp. CG23_2 TaxID=1706231 RepID=UPI0009E6639F  ali  16  86.......................................................WTEFAKVWADIRHTGGMEAIKAGAVTTTVQASIRLRQRAGLHAGMRV-LHDGTIYKVQAVDKEHRHIDLVC....... 158
457 1.000e-04UniRef50_E6U1J8 Phage head-tail adaptor n=2 Tax=Bacillus TaxID=55087 RepID=E6U1J8_BACCJ  ali  13  1..............................MNSGKLRPISIKEEQSISDGGGGQTTQDVLIVWGNIATLSGREQWQAQQMEAQVSHKVTIRYRNGIKRT-QFVLYKERKFEIQYINESNTWLELYCIE..... 104
458 1.000e-04UniRef50_A0A2T3DMC4 Head-tail adaptor protein n=3 Tax=Acinetobacter TaxID=469 RepID=A0A2T3DMC4_9GAMM  ali  16  29.....................................................EQWTEFTRLYGDFQPLSSRDLIAAQAVQVKTTARLVTHFIDGINSTMRVVIHG........................... 81
459 1.000e-04UniRef50_A0A1Q6JJZ4 Uncharacterized protein n=1 Tax=Clostridiales bacterium 59_14 TaxID=1897049 RepID=A0A1Q6JJZ4_9FIRM  ali  15  1..............................MKAGDLKHRITLEDTTDARGNRRTVWQPFATCMASMADVSGRDFYAAQAYQAQDTVTFGIRWRDALNKECRIDHMGQK-YQIEQI-NHLGY............ 92
460 1.000e-04UniRef50_B0CKS3 Phage head-tail adaptor n=51 Tax=Rhizobiales TaxID=356 RepID=B0CKS3_BRUSI  ali  14  33.....................................................ETWSEIAMVWGRIEPVSTTQKDFGARPQPEVTHRILMRFREDISTDKRLCKAGRIFRSVHDPDESGRYLICLARE..... 109
461 1.000e-04UniRef50_A0A0T7H1K6 Phage head-tail adaptor, putative n=5 Tax=Rhizobiales TaxID=356 RepID=A0A0T7H1K6_RHIGA  ali  14  5...............................KLDKTITIQRAGLTVDDYGTETEGWNDVATVRAQLVQASTEEFMRSFGSSSEIAVVFRVRYRDDLTPSDRVTYQGQAYKEIKELGRREG............. 95
462 1.000e-04UniRef50_A0A1B9N8T4 Uncharacterized protein n=4 Tax=Gilliamella apicola TaxID=1196095 RepID=A0A1B9N8T4_9GAMM  ali  11  2............................QTGRLINRIVFQQKTKEKDELGQITEKWNDVITLWGAITDQTGREFNSSQQSVSNCTITVRKYKNAVITPDMR-ACHNGIIYDIKAVNEKQTHLQLPCQK..... 104
463 1.000e-04UniRef50_A0A2A5F5H2 Uncharacterized protein n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2A5F5H2_9RHOB  ali  13  5...............................RLDRMIAIERFTGTKSPLGGTKKTWPEYMKAWASVTPVSDGERFRADAASATITDRFVINWNAKITVKDRISYGG-RYYDIHGIKE................ 92
464 2.000e-04UniRef50_UPI0005BC4149 head-tail adaptor protein n=1 Tax=Pseudomonas putida TaxID=303 RepID=UPI0005BC4149  ali  1..............................MRAGPLKHRSKPHLESNRSGGATKTWLPVGKVWAEITMPTGRVEPVAEQLTATITAEIRVRPRSDFAAEWRITERRVTYQEAVLLDNDRTMMRLLCSSV.... 103
465 2.000e-04UniRef50_A0A1M4Z6C6 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Tissierella praeacuta DSM 18095 TaxID=1123404 RepID=A0A1M4Z6C6_9FIRM  ali  12  7..................................KDRITLQRKKEQEGSVIDLDDYEDYIPLWSEARFLKGRNFYAARAANVKTDVEFIIRYRTDIDETMGIKF-NNRFYEIEGIDNNSMYLVVKAYEV.... 103
466 2.000e-04UniRef50_UPI00068A091E head-tail adaptor protein n=1 Tax=Clostridium akagii TaxID=91623 RepID=UPI00068A091E  ali  12  8.................................HKITIVQNINRPTDENGTPLENWQPFKKPWSRKEGLNARLFYAAAASQSETDTIFLIRYFKGITPDMKIVDNEGTYL....................... 89
467 2.000e-04UniRef50_A0A0M3VQL5 Uncharacterized protein n=15 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0M3VQL5_9STAP  ali  21  33..............................................................WADIKTIRGNEYLGSGLTASEIPVRFIIRYKEGITAYQRIKWKDLD-FNIESVQNDNG............. 89
468 2.000e-04UniRef50_A0A2D4VKD0 Head-tail adaptor protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D4VKD0_9RHIZ  ali  8...............................RIGKLRERVTMERAPDGFGGAGVSWSDVATAHAEVISFKGREHAHDGRTETRAPCRVVMRYREDVTSAMRIRWRDRLLQSVIDPDGERRWLALDCIE..... 109
469 2.000e-04UniRef50_A0A2G2J7U6 Uncharacterized protein n=1 Tax=Robiginitomaculum sp. TaxID=2030823 RepID=A0A2G2J7U6_9RHOB  ali  2................................IGKLRTRIGPQTTPDAFGGVQTSWVSYGQAWAHISPLTARETDRNGRPSTLKNYRIIIRWQRDFPERIRVMWGERILRMVTSPDTRRERLHLMCEE..... 102
470 2.000e-04UniRef50_R6Q6F7 Phage head-tail adaptor n=1 Tax=Firmicutes bacterium CAG:466 TaxID=1263025 RepID=R6Q6F7_9FIRM  ali  16  22............................................EKNSIGQKKWEETKVKAVWAEVKPQTGSLLSGAESTLSRTTHKITVRYDSSITPGMWFMAGGQR-YEILYI.................. 93
471 2.000e-04UniRef50_I0R7R4 Putative phage head-tail adaptor n=1 Tax=Lachnoanaerobaculum saburreum F0468 TaxID=1095750 RepID=I0R7R4_9FIRM  ali  14  1.......................MIKGINPGRLNKRVNILRYKETEDELANIISTLSLYKKVWAEIRPLRGNEQLEHYKTTNKLVYKITIR-NMNVTEKDVIEYQGRQFLYIVNPLEASYYLELMCTE..... 106
472 2.000e-04UniRef50_A0A1M7ZMV0 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Pseudoxanthobacter soli DSM 19599 TaxID=1123029 RepID=A0A1M7ZMV0_9RHIZ  ali  16  24.................................................GGRVETFAALGEVWAEIVPAGAAEREIAGRLDGVASHRIAIRHRGDVRGGMRFVAADGRVFRILDADGRRRRLVCVAEE..... 105
473 2.000e-04UniRef50_A0A2W5I107 Uncharacterized protein n=1 Tax=Azospirillum brasilense TaxID=192 RepID=A0A2W5I107_AZOBR  ali  10...............................RLNERLTIEQPTHTDDGQGGQVVSWGTLGECWAAVTPVSGRETARAGQAEAVAGYRVQIRRREDVLATMRLRWRNRILW-IHSLHEQEGLLSMLVYE..... 107
474 2.000e-04UniRef50_UPI0003B1ACEF head-tail adaptor protein n=2 Tax=Brevibacillus laterosporus TaxID=1465 RepID=UPI0003B1ACEF  ali  14  1..............................MRIGSLRHRITIQERLGLV------FQDFAKVWSSIEPISANEKLERADMEQSNTHRIRIRFRRGLTSTMRI-IYKDRLFSVESI.................. 78
475 2.000e-04UniRef50_A0A0F7L120 Phage head-tail adaptor n=1 Tax=uncultured marine virus TaxID=186617 RepID=A0A0F7L120_9VIRU  ali  11  11................................LDQRITFQKKVKTPDGMGGNSVEWVDFPTVWAHVRLKSGREVTEFDRVNAKSTYLFVVRYRGDIKPEYRIVW-DGELFNIAKPKSRSLYLEI......... 107
476 2.000e-04UniRef50_A0A285BWY6 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Nitrosomonas ureae TaxID=44577 RepID=A0A285BWY6_9PROT  ali  9................................LNKQITIQQLSQTKDDEGGMIDTWTDFAAIWAKVNNLSGNERSITQQGTLESRTEFTLYFLEGVTNQMRIMF-NGKYFNVRHVNEANEYLIITC....... 107
477 2.000e-04UniRef50_A0A1W6BN18 Head-tail adaptor protein n=1 Tax=Staphylococcus lutrae TaxID=155085 RepID=A0A1W6BN18_9STAP  ali  19  33..............................................................WSDIKTIRGNEFIGSGLTASEIPVRFIIRYREGITASQRIKWKDLDFY-IESVQNDNG............. 89
478 2.000e-04UniRef50_A0A1Q6PU34 Uncharacterized protein n=1 Tax=Faecalibacterium sp. CAG:74_58_120 TaxID=1897005 RepID=A0A1Q6PU34_9FIRM  ali  6......................NFEANPHPGSLRHLVEIGYTENAVNENGFPEPTDHVICKAWAAVTDAGNQHYRSADVMNTEAVVNFTIRYRSDVVPGMWVRFRGKKWF....................... 93
479 3.000e-04UniRef50_A0A1B9KCA5 Uncharacterized protein n=1 Tax=Gilliamella apicola TaxID=1196095 RepID=A0A1B9KCA5_9GAMM  ali  2............................QPGRLRNRISFQKKTTEKDELGQTVERWIDVYTLWGVVTDQTGREFNASQTELSITNCTITVRKYKNITSEMR-ACYNGNIYNIKAINERQTYLQLPCQKME... 106
480 3.000e-04UniRef50_J7JGI2 Gp9, phage head-tail adaptor, putative n=38 Tax=Burkholderia TaxID=32008 RepID=J7JGI2_BURCE  ali  12  1..............................MKAGKLKERIVIERPSGEENENGEAWVVHSRPWADVLFVNGKEHVVSGAIRGSTVASMRIRYRSGIDERMRVRY-DGRLYDITAVACKRGYLDLSVK...... 102
481 3.000e-04UniRef50_A0A0K0TSM1 Uncharacterized protein n=16 Tax=Hyphomicrobiaceae TaxID=45401 RepID=A0A0K0TSM1_9RHIZ  ali  17  34.......................................................YIPVATVWSRVRPLSGRQGVDADGRGVVMSHAVVMRFRSDVRPGDRVVYRGRKL-EVVDVNGRRAYLSCSCAE..... 108
482 3.000e-04UniRef50_UPI00036EDFEF head-tail adaptor protein n=1 Tax=Effusibacillus pohliae TaxID=232270 RepID=UPI00036EDFEF  ali  10  1.......................MAERWVHFRQFRHRVTIQQQVRTPDGQGGYTEWVDLKTVWAHIEPVQAREEITGQQPVPMLSYKVRIRYDAAMTPDKRLKWRTRIL........................ 91
483 3.000e-04UniRef50_U2NSW5 Phage head-tail adaptor n=2 Tax=Clostridium intestinale TaxID=36845 RepID=U2NSW5_9CLOT  ali  5...............................KLNRKIEIQQYTEVENELFQMIREWKTVKEPWALVRGSEVKKFEEIGKEELHVDYVIVIRYRPGITTDMRVKYLDKILNSIINIGEQNKELCLLCK...... 104
484 3.000e-04UniRef50_UPI00082C4178 head-tail adaptor protein n=1 Tax=Snodgrassella sp. CFCC 13594 TaxID=1775559 RepID=UPI00082C4178  ali  3............................EPGKLNRRITIQKPVVIKDELGGVVEDWQDFAKTWAYILNLNGKEFSTKGIDTTSTTTSMRIRYREGITTQMRV............................... 77
485 3.000e-04UniRef50_F7U7P0 Uncharacterized protein n=37 Tax=Rhizobiales TaxID=356 RepID=F7U7P0_RHIRD  ali  10  9.................................GKLTARLELEQTSDGQGGAAESWNVLRSLWAAIEPVSDASHERAAAEGVTITHRVWLAHRSDIAAGMRFR-KGRRILAIMDPDETGRFIVCRCEE..... 108
486 3.000e-04UniRef50_A0A2E6QP68 Uncharacterized protein n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E6QP68_9PROT  ali  11  8..................................RVTLQTVERTADGEGGF-SESWSDAATLWARVRPVAAPLEVSGAQPRHPATIRVTLRHGATVDCGMRL-VHEGTAYRIVDADEDRRWITLVCQAL.... 103
487 3.000e-04UniRef50_A0A2G9WY72 Uncharacterized protein n=1 Tax=Pleomorphomonas sp. SVCO-16 TaxID=2023338 RepID=A0A2G9WY72_9RHIZ  ali  14  9..................................RVTMQRLTTGTPDEYGVPSETWNDLRTVWARVTPDSEDEKYQLGVDLAFVLVKVQCRWFAGLITTDRLVI-DGRVFDIRGVRE................ 90
488 3.000e-04UniRef50_A7HRJ9 Phage head-tail adaptor, putative n=1 Tax=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) TaxID=402881 RepID=A7H  ali  12.......................................QSPIRTADGAGGAAVTWDDGVSIWAKVEMRGGGETPAGERLEARALVRMTIRYRSGITAEMRALWQG-RAFNIRNLDGRRRFLVLDCEE..... 102
489 3.000e-04UniRef50_A0A2U2AJS7 Head-tail adaptor protein n=1 Tax=Ignatzschineria indica TaxID=472583 RepID=A0A2U2AJS7_9GAMM  ali  16  5...............................KAGSLRHRITIEQVTIKDGYRDEEWSEYKNVAAKVTFLSTKELVASGAELSEVKARIQVRYDKNINAKMRIKFRE-ELYEIEGVDNESGLQWLTL....... 102
490 3.000e-04UniRef50_A0A2L0TWY5 Head-tail adaptor protein n=4 Tax=Aeromonas TaxID=642 RepID=A0A2L0TWY5_9GAMM  ali  24..............................MPAGRLRDRITLLTRQDAVGQPLDGWDESSPIWADVQMIGGREQMRAGREVSEGQYSIRIRHRPGVTTAQRIRLASGEVLDIAQPDQRRAWLTITAERV.... 128
491 3.000e-04UniRef50_A0A1G7TNK3 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Pelagibacterium luteolum TaxID=440168 RepID=A0A1G7TNK3_9RHIZ  ali  15  34...........................................................TSVWARVRSRSARIMREGDGRAATSTHAVTLRFRKDVSPGDRIVYRGREVVEAEDINGRKAYLDCLCVE..... 104
492 3.000e-04UniRef50_A0A249MPQ0 Uncharacterized protein n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A249MPQ0_9SPHN  ali  8...................................RTVTIQRMTLVDDGYSSVETWADWQTVPAQVVQEGGREFFAAAAVQAEQRVLFRMRWLDGVTVLDRVSY-DGRPHNIIGVKELGR............. 91
493 3.000e-04UniRef50_A0A1D9N876 Uncharacterized protein n=2 Tax=Clostridium pasteurianum TaxID=1501 RepID=A0A1D9N876_CLOPA  ali  9................................LNKRISIGAMAVTTNSNGYEEPQWQDYLSSWSKISNVSGTEVFKSGHDFSQTMTRFLIRYRSDIDNTMKVKFGKDVFYNIKYVNNSNEFLEII........ 114
494 4.000e-04UniRef50_F5J7Z4 Uncharacterized protein n=26 Tax=Rhizobiales TaxID=356 RepID=F5J7Z4_9RHIZ  ali  9.................................GKLTARLDLEARTETQGGATESWTVLRSLWAAIEPVSEASHERASAEGVTITHRVWLAFRSDVTAGMRFR-KGRRILAIMDPDETRRFIVCRCEE..... 108
495 4.000e-04UniRef50_UPI000D1DF21E head-tail adaptor protein n=1 Tax=Staphylococcus simulans TaxID=1286 RepID=UPI000D1DF21E  ali  13  4................................................................DVKTLKGSEFAEAGFTINEQPMRFIIRYREGIETYHQVRY-KGQMYNIQSIDGRNHTLTIFCKKVE... 71
496 4.000e-04UniRef50_X0WA14 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0WA14_9ZZZZ  ali  13  4............................RPGELDQRIVIERSSSVDDGMGGNAITWATHLTIWSLVRPLSGNEKVDFERVQGEARYLFVVRYPVDIEDNDRISW-EGDYYNI..................... 86
497 4.000e-04UniRef50_F8DMX5 Putative phage head-tail adaptor n=6 Tax=Lactobacillus TaxID=1578 RepID=F8DMX5_LACRS  ali  16  45..........................................................FANVWAKVSALHGQEYYTAVSVKLEKQLSFIVRYRPDIDEKTNI-WFDGRGYNIGFIDNRNEYLEI......... 112
498 4.000e-04UniRef50_A0A1H9M8F5 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=bacterium A52C2 TaxID=1855383 RepID=A0A1H9M8F5_9BACT  ali  1....................MLSRAGASAPGRLGHRVTLERASGVSDGAGGRSSSWKTVAKLWAEVVPTGSDEQAVGEGTSSVITHKITLRGGQRLAAGDRLRLGQRLFWAITDPAEDGRFIVCLARE..... 110
499 4.000e-04UniRef50_UPI0004D41982 head-tail adaptor protein n=1 Tax=Clostridium novyi TaxID=1542 RepID=UPI0004D41982  ali  8................................LNKKIQIGRDESVQDDEGFETKNFTGF-ECWAKVQNMSGTEIFKSKSDYSKKTTRFIIRYRKDITTKHTI-LFNNKYYNIVYVNDYNESNEFV........ 100
500 4.000e-04UniRef50_B1JCZ4 Phage head-tail adaptor n=132 Tax=root TaxID=1 RepID=B1JCZ4_PSEPW  ali  1..............................MKAGPMRHIYKPHREQNRSGGATEAWVEVGEVWAEVTTPTGRVSPVAEQLQAVISAEIRIRPRSDIVAGWRLTERTGITYKVEAPNNERDMLRLLCSSV.... 105
501 4.000e-04UniRef50_A0A1X9UHX9 Uncharacterized protein n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A1X9UHX9_SPHSD  ali  13  10...............................RLDRQVVIQRPGVFENDHGDQVEGFAPLATVWASVRPAPGSERLQSAEVAANAPMVFRIRYSPDLNPKDRIVYSGRIIASVIEIGRRDG............. 103
502 4.000e-04UniRef50_A0A059NW91 Putative phage head-tail adaptor n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A059NW91_9BACI  ali  10  13.......................................QKKERVSDGMGGGTDEWVNVFTTEAHVQPITGRNRILAQQLETPVTTKVYYPYQEGAKPGMRIQHGSNTL........................ 82
503 5.000e-04UniRef50_A0A2A4UZT0 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A4UZT0_9PROT  ali  12  6...............................KRNERIRIETVTTAKNAAREAIETWAPLRTVWAQVLQQTGKEFVANAATTGGADVAFLALYQGDVDHKMRVVWRGRN-YEIQSVDSDYRKNETVIK...... 100
504 5.000e-04UniRef50_A0A031I848 Uncharacterized protein n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A031I848_9SPHN  ali  17  8................................LDRRIRIERDGKPSHDGLQNVPKPFPLATVWAQYKPARGQERFDLATREAEIPVAFIIRWVADVGPADRVRYDDGQLFEIIAIGRRDG-LELTCRAV.... 114
505 5.000e-04UniRef50_UPI0007E4FDE0 head-tail adaptor protein n=1 Tax=Pseudoalteromonas prydzensis TaxID=182141 RepID=UPI0007E4FDE0  ali  14  20.............................................KSNDGYNTDSFEEFYK-WVNIQTGAAKELEQSGQLMGEITHTVTCRYSSKITPAHQISY-KQRVFEIIGTQDFANVLTIIA....... 102
506 5.000e-04UniRef50_B2THE8 Putative phage head-tail adaptor n=33 Tax=Firmicutes TaxID=1239 RepID=B2THE8_CLOBB  ali  10  1..............................MRKDKKITILEYVNGVDEDNLPLEEYVPVKGIWAYYRHLSGKEFYAAATTNSKVDVIFQINWRQGIDTTMKVLYNNKEYY-ITQIDDFEGKKT.......... 95
507 5.000e-04UniRef50_D8NBQ4 Putative phage head-tail adaptor n=20 Tax=Burkholderiaceae TaxID=119060 RepID=D8NBQ4_RALSL  ali  1..............................MQRGKYNRRIALQRRQEGRGQPINAWVEVAKPWARVLGENGKEFIAAGRETAEREMSLRIRYRADVTAAWRVIFRGQ.......................... 80
508 5.000e-04UniRef50_X0YY21 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0YY21_9ZZZZ  ali  5...............................KLSRRVAIQSLTETLDEYGEPIKEWATVYTVYAQVLPMRGEERASNQQLVSRADTKFRIRYNSDMTITEKHRLYDGDNYDITAI.................. 89
509 5.000e-04UniRef50_UPI0009FF5C4D head-tail adaptor protein n=1 Tax=Anaeromusa acidaminophila TaxID=81464 RepID=UPI0009FF5C4D  ali  11  19.............................................PDDSGGYAEEYQPYGKAWVQFLPVRSSKNEQAEQMQFQATYEVVLPYRKDVLLKDRIFYQNRYFYQAVNVEQKKAYLKLTVEEV.... 105
510 5.000e-04UniRef50_A0A0C2BQK3 Uncharacterized protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A0C2BQK3_9BURK  ali  13  25.....................................................TGWADVADLWADIRYQTGMETVKAGAEASITRVSIRIRHRDDINAGMRV-IHGGIIYNIKAV.................. 85
511 6.000e-04UniRef50_A0A1I5JD89 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Acidaminococcus TaxID=904 RepID=A0A1I5JD89_ACIFE  ali  14  5.............................PGLLNRKVTIYRPTVVEGDDLDTQKDRVLFQNVSAWIAPVRGIQYKENGTDRNDATVKITIRYRKGITDGCWISYKDHHYLVIADPDMLHESLELMCVE..... 105
512 6.000e-04UniRef50_A0A0G9HFF3 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0G9HFF3_9GAMM  ali  11  8................................LNRQIRVQKKIDGHDAAGQPTKVWADFLSTWANVRGQTGVGTIVGAQGDIASQYSFRIRYRAGLDAGMRVLLGG-TPYDITSVQDRREWTDLVC....... 106
513 6.000e-04UniRef50_A0A0Q6W030 Uncharacterized protein n=1 Tax=Massilia sp. Root351 TaxID=1736522 RepID=A0A0Q6W030_9BURK  ali  2............................QAGRRNKRVMLQALIQSKDKAGGTLRAWTDVTALWAGMRHLSGDEKRVTKYGGEQAGTRITILYRRDVDASMRVLHGDAVYNHVNNVREANRELVLTC....... 103
514 6.000e-04UniRef50_UPI0005C92FB5 head-tail adaptor protein n=1 Tax=Megasphaera massiliensis TaxID=1232428 RepID=UPI0005C92FB5  ali  10  43.............................................................IWARIEPTRGRAYFEQYKDKTEDFLKITIRYRPEVTAGMYVRYRG-VTYDINTVINANVKLELMCVE..... 111
515 6.000e-04UniRef50_A0A1I5RW19 Phage head-tail adaptor, putative, SPP1 family n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I5RW19_9RHOB  ali  12  1..............................MRAGKLTHVIKVQSAVNEYGTPVPTWTDLATLRAEVVEQTAEEFIRDARATTETAIVFRTRFLDGVKTADRVRFDGTDFNEVTPIGRRKGM............ 97
516 6.000e-04UniRef50_A0A1T5KFF4 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Maledivibacter halophilus TaxID=36842 RepID=A0A1T5KFF4_9CLOT  ali  10  8.................................YRITIQEKQFVEDKKTGIESKKWAAISRPWAKVQDIGGNEFFSSAKENNKIKTKFQIRYRKGLREDMRVIFNGKE-YDITFIDYNKKFMNLIC....... 102
517 7.000e-04UniRef50_A0A077FH09 Bacteriophage head-tail adaptor n=1 Tax=Rickettsiales bacterium Ac37b TaxID=1528098 RepID=A0A077FH09_9RICK  ali  14  10..................................KLRSRITIQKSIDDSGGTTANWVDVIKVFAYVLPLESAEHIYTNQIITSNYYKFIMRYIPGITCKMRV-VYKERFFNIQNVIEENKILKIIAKE..... 111
518 7.000e-04UniRef50_X1DKS4 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DKS4_9ZZZZ  ali  12  1..............................MLIGDLKHRQAPTKTSDGMGGFETAFKTMFTAWGSLWPLSGAEALAAMQMGGVMTGKVRIRYRSTIRVSYRIK-HGNKYYNIINLGGNNEYLEMKIKE..... 105
519 7.000e-04UniRef50_UPI000A10B34A head-tail adaptor protein n=1 Tax=Cronobacter sakazakii TaxID=28141 RepID=UPI000A10B34A  ali  9.......................................KRLTGAENEFGEQVDVWANVGNAWASVKLLNGIQTLKADRPLTTVQASIRTLYRTDIVPGMR-AHDGARVYEVKAV.................. 83
520 7.000e-04UniRef50_UPI000A361585 head-tail adaptor protein n=1 Tax=Novosphingobium panipatense TaxID=428991 RepID=UPI000A361585  ali  17  9..................................RIQFERPVTTRDPTYNTSKTTWEPHAKVWAEVRDVSRAESVDESASLQQRPARIRMRYREDITPDMRVIYRG-RTLEIVSIGRRDG-LELIAQELS... 108
521 7.000e-04UniRef50_A0A0F9W615 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9W615_9ZZZZ  ali  11  1..............................MQAGKLRHLVDIQTNTDTTGQPVASWGDTSTQRAFIRPLRGNELMIARQVTPQVTHEITMR-NPTLTHDQRLQEGGSRTFNILSINERDHEKRILCVE..... 105
522 7.000e-04UniRef50_A0A143DC19 Uncharacterized protein n=1 Tax=Haematospirillum jordaniae TaxID=1549855 RepID=A0A143DC19_9PROT  ali  15  32.......................................................YRTEAEIWARVEPVGGAVYLGSQQIGQTITHRITMRWREGITAEHVIR-HRGRCFRIRRITDLNG............. 95
523 8.000e-04UniRef50_G9PX79 Uncharacterized protein n=2 Tax=Synergistes TaxID=2753 RepID=G9PX79_9BACT  ali  10  3.............................PAKRDRKINIERPVTAPDGMGGRSKTWEVLCTAWAEFKKPRAQTAMVQGGVAAVVTQEMTIPRNDEIAVGCRVREGARE-FKIIGVGNDRRYMTLVCEEVV... 103
524 8.000e-04UniRef50_A0A1D7NJW1 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Porphyrobacter sp. LM 6 TaxID=1896196 RepID=A0A1D7NJW1_9SPHN  ali  21  12..................................RIQIERKVVDRDPQYGTEAVTWTEFACVWAEVKPSRAQRLADSIQI-SRRPARIRIRYLAGLAADMRIII-DNRTHQIIS................... 92
525 8.000e-04UniRef50_UPI000BF7DEF0 head-tail adaptor protein n=1 Tax=Bacillus thuringiensis TaxID=1428 RepID=UPI000BF7DEF0  ali  2.....................................................EGYKDSFTVWGSFLFLKGRKYFEAAAANSEVQGETEIRFRADVNADMKMKY-KNVMYDIISV.................. 62
526 8.000e-04UniRef50_J4P390 Phage head-tail adaptor n=2 Tax=Achromobacter piechaudii TaxID=72556 RepID=J4P390_9BURK  ali  13  31.......................................................WERVATVWANIRVANGKEHIASGAEMSPLQASFRIRWLKGITTEMRLTYAG-IAYEIEAV.................. 89
527 9.000e-04UniRef50_A0A2N9WP39 Uncharacterized protein n=5 Tax=Snodgrassella alvi TaxID=1196083 RepID=A0A2N9WP39_9NEIS  ali  11  1..............................MRAGLLRTRITPISGKDVNGAVTQDWAEFGRLWADVRNKSGLETIKADKVTGIVRVSIRVRYNTKLNNAMRV-IVNNVIYNIKAVMNSREYTDLICEAV.... 104
528 9.000e-04UniRef50_L0NC01 Uncharacterized protein n=10 Tax=Rhizobium TaxID=379 RepID=L0NC01_9RHIZ  ali  32......................................................TWEAVRSLWARVEPVRVSERQEAGAESATNSHRIWIWFREDVVAGQRFRKGARLFKLVRDPDETQRFLVCHCEE..... 107
529 9.000e-04UniRef50_A0A271J7V9 Uncharacterized protein n=1 Tax=Rubrivirga sp. SAORIC476 TaxID=1961794 RepID=A0A271J7V9_9BACT  ali  1..............................MNVGRLDTLVTPQSSTPSAGESTDAWSDGTPFWASVDEATGREQIRAGQVDSRQPVVVTARYSDALTPTDRLVLPDGRILDIES................... 88
530 9.000e-04UniRef50_A0A255YRA1 Uncharacterized protein n=1 Tax=Sandarakinorhabdus cyanobacteriorum TaxID=1981098 RepID=A0A255YRA1_9SPHN  ali  18  12..................................RIRIERKVVTHDTQYGTEQVNWTEFACIWAEVKPSKAERLADSIQI-GRRPARIRTRYLPGLTAEMRVII-DSRIHQIIS................... 92
531 9.000e-04UniRef50_A0A2T3EPC1 Head-tail adaptor protein n=7 Tax=Rhizobiales TaxID=356 RepID=A0A2T3EPC1_RHILI  ali  15  1..............................MKAGVMRHRVRVETADDAMGAAKKTWALVAEVNCQIEAGAGREYFATATELAEGTTRIRLREIPGIDPAWRLVDVDSDVYEIVEVQSRNDYL-LNCK...... 106
532 9.000e-04UniRef50_UPI0009C09686 head-tail adaptor protein n=2 Tax=Pandoraea pnomenusa TaxID=93220 RepID=UPI0009C09686  ali  10  52..................................RIRIEQKTVSQNPESGAVSVTWTLFDDVPAEFKAGPGREFAASGTVHAEADGRFIIRYLPGVTSVMRVLW-DEQVWSIIAPRTARRDMTLMVK...... 148
533 1.000e-03UniRef50_UPI0005A2FECA head-tail adaptor protein n=1 Tax=Collimonas fungivorans TaxID=158899 RepID=UPI0005A2FECA  ali  1..............................MRAGALRHRVKLQDGQDEAGQPIKVWVDDATIWADIRFLSGLEAIKANAPVSVAKCSIRIRHRS-VKVEQRIVEGT-TVYEIKAV.................. 86
534 1.000e-03UniRef50_M8B4Y5 Phage head-tail adaptor n=55 Tax=Rhizobiales TaxID=356 RepID=M8B4Y5_RHIRD  ali  14....................................RLELDVRTETPDQGGAAESWNFLRSLWAAIEPVSEASHERASAEGVTITHRVWLAYRGDIAAGMRFRKGRRILRAVMDPDETRRFIVCRCEE..... 108
535 1.000e-03UniRef50_UPI0007C66DAD head-tail adaptor protein n=5 Tax=Burkholderia ubonensis TaxID=101571 RepID=UPI0007C66DAD  ali  12  1..............................MEAGKFTERIEIERRTGATNENDDAWELQARVWADVRFVNGIEHVVSGAVRSTSVASFRIRYRRDVNADMRVRYL-CALYDIVAPNRAKGYIDLSVK...... 102
536 1.000e-03UniRef50_C1D8G3 Uncharacterized protein n=1 Tax=Laribacter hongkongensis (strain HLHK9) TaxID=557598 RepID=C1D8G3_LARHH  ali  11  1..............................MNAGKLRVLQSREAGTDAWGQPLEGWADVALLWAHVRFLSGVEAIKSGAETATATASVRIRKR-DVTTAHRLLIAGKP-YDITAVLPALAHTDLTVKE..... 99
537 1.000e-03UniRef50_A0A1N6N6Y4 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Aeromonas sp. RU39B TaxID=1907416 RepID=A0A1N6N6Y4_9GAMM  ali  1..............................MPAGRLRDRITRTTVRNEIGQPRDEWVASLPVWADVQMIGGREQLRAGQEIADGQYRIRIRFRGGVSAAQRIML............................. 77
538 1.000e-03UniRef50_A0A1C0AFA3 Uncharacterized protein n=1 Tax=Criibacterium bergeronii TaxID=1871336 RepID=A0A1C0AFA3_9FIRM  ali  20.....................................IIQEKTVIQDENGIEAETWKDKYKLFAAAKSLFGSEYELARQRTDKKTVKFIVRAGVHITSDMQI-IFDGNAYDIENVDN................ 98
539 1.000e-03UniRef50_UPI0009E9F1C8 head-tail adaptor protein n=1 Tax=Sphingomonas sp. Leaf257 TaxID=1736309 RepID=UPI0009E9F1C8  ali  37.......................VSRGWHVIQAGKLNILYRPIKQRSGSGAETQAWSKVATVWAERQSLNLREVNRMAGIAEAQEAKFLIRYRADVSTFFEVM-CDKRRYSVVAVDE................ 132
540 1.000e-03UniRef50_S0FUM6 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=[Clostridium] termitidis CT1112 TaxID=1195236 RepID=S0FUM6_9FIRM  ali  11  6................................FDKRIIIRKDEVEKDKDGFSNKEWNDFLSIWANVKDLSGSAFYQLNSEQQVKTITCKVRYNNKIDESMRVIYRNEIYKVI..................... 87
541 1.000e-03UniRef50_A0A1V4AIC3 Uncharacterized protein n=1 Tax=Pyramidobacter sp. C12-8 TaxID=1943580 RepID=A0A1V4AIC3_9BACT  ali  12  3.............................PGKLNRKVAIEFPRAENDGMGGRSVAWIPLCSVWACFKPAATTEIQQGG-VVSAVTYPVTIRYRADVKPGCRLIYAG-RTYRILDVWDIGMELTRMCEEV.... 102
542 1.000e-03UniRef50_A0A1F6C4R5 Uncharacterized protein n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6C4R5_HANXR :_  ali  10  3............................QAGKLRDRISIIAPTASQDEYGESIAAGSVWKIRWAEVKATSGSEGIAAGAVTPRTRYEIRLRYVAGLTTDHSVAW-KGKVLEINSPDEKQAWLTLQCVE..... 103
543 1.000e-03UniRef50_A0A256CUH5 Uncharacterized protein n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A256CUH5_9GAMM  ali  17  4..............................LRAGSLRHRITIEEPIIEEGFQKQSWRVYREVPAKVTFLSVKEQVASGAEISKVSARIQIRYDKNINAKMRIRFRDD-LYEIEGVDNESGLQWLTLT...... 103
544 1.000e-03UniRef50_A0A1U9V930 Uncharacterized protein n=3 Tax=Clostridium perfringens TaxID=1502 RepID=A0A1U9V930_CLOPF  ali  13  4...............................RSYKHKVIIKRPNGVNEDGLPVPNYEEILTCRARISNTSGKEINFANGEGSVITTRFYIRYIRDLKLTNEILIYNGNQFNIINIKEENKEYEIV........ 103
545 1.000e-03UniRef50_UPI000DA1B2BB head-tail adaptor protein n=1 Tax=Salinicola sp. CPA57 TaxID=1949080 RepID=UPI000DA1B2BB  ali  12  9................................RHRITFQKKVKTREPATGAVIYAWTDIDEVPADVQFLSAKELMSADSLQSSVSARIIIRYRSDFTASMRIIYKDK-IYDILGVDNETGRTHIT........ 106
546 1.000e-03UniRef50_G8NR98 Phage head-tail adaptor n=1 Tax=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8) TaxID=682795 RepID=G8NR98_GRAMM  ali  11  2............................QAGNLKRPITVEVPGTTKDQYGQITATWDTLLQTWADIHTITSKEVYALGAFNSQISHKITIRFQPAVTAGMRVVYLTRNFI-IQAVSEERRELDLLCLE..... 106
547 1.000e-03UniRef50_T0IDH8 Uncharacterized protein n=4 Tax=Sphingomonadaceae TaxID=41297 RepID=T0IDH8_9SPHN  ali  15  12..................................RIQFEKPVTTRDPTYNTSKTTWQPHVKVWAQVRDVSRAESVDENASMQQRPARIRMRYREDITADMRVVYRG-RVMEIVS................... 92
548 1.000e-03UniRef50_Q9MCT0 Putative head-tail adaptor n=366 Tax=root TaxID=1 RepID=Q9MCT0_BPHK7  ali  2............................EPGRFRNRVKILTFTTSRDPSGQPVESWTGGNPVPAEVKGISGREQLSGGAETAQATIRVWMRFRSELNASSRLEVYKGQVLNIIGPPVANATLEILCK...... 107
549 1.000e-03UniRef50_A0A0Q8TDG0 Head-tail adaptor protein n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q8TDG0_9BURK  ali  13  7................................LNRRITIQRPGTARNDLNEVVPGWVDVAAVAASIKTLNGAQTIKADAVTSKVRASIRVRFRTDIDASMRVVHGATVYQVLASIEERREHTDLVC....... 104
550 1.000e-03UniRef50_A0A2S1FBZ8 Head-tail adaptor protein n=1 Tax=Acinetobacter schindleri TaxID=108981 RepID=A0A2S1FBZ8_9GAMM  ali  13  1..............................MRTGQLNHREHSTRATDGSGDRIKSWQKEFDVWGDIDALSGRDYIAAKSQQTMISHRISIRYSPGFEPGCRI-ESEGVTYKINAPDNQNGWITLMC....... 108
551 1.000e-03UniRef50_UPI000C1E2944 head-tail adaptor protein n=3 Tax=Lactobacillus fermentum TaxID=1613 RepID=UPI000C1E2944  ali  16  52..........................................................LAEVWANVSNLSGNEYYAAAMVRVQKEVSMTFRYVDGLTESCEI-WFNNRWYNIQFIDDKYQHRYIQCKVAIETS 126
552 1.000e-03UniRef50_UPI00037DB15B head-tail adaptor protein n=1 Tax=Acidobacteriaceae bacterium KBS 96 TaxID=1267535 RepID=UPI00037DB15B  ali  1................MGRRMLT--RRETTVDIGSLRHIQQRADQPDAYGQLIPTWTDVLSPWGGFSSLTAKEQFQANQLSTQVTDVFTMRYPVSITAGMRL-IFASKVYEIQA................... 100
553 1.000e-03UniRef50_UPI000C7B8A90 head-tail adaptor protein n=1 Tax=Sinorhizobium medicae TaxID=110321 RepID=UPI000C7B8A90  ali  12  15........GLRDDPATGGRRDQGDRRGGRAMKAGVMRHRVRVETADDAMGAAKKTWALVAEVNCQIEAGAGREYFATATELAEGTTRIRLREIPGIDPAWRLVDVDSDVYEIVGVQ................. 129
554 1.000e-03UniRef50_UPI0009ED2A12 head-tail adaptor protein n=1 Tax=Haematospirillum jordaniae TaxID=1549855 RepID=UPI0009ED2A12  ali  15  66.......................................................YRTEAEIWARVEPVGGAVYLGSQQIGQTITHRITMRWREGITAEHVIR-HRGRCFRIRRITDLNG............. 129
555 1.000e-03UniRef50_A0A2A4TIE1 Uncharacterized protein n=4 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A4TIE1_9PROT  ali  6................................MHQKITCRAQMLSPTTAGEQQENWQDIAVVWAEVTAKSAGVTTAARQRHMAESYTVRVRYQQDLLPTRNILWQGQRVTSLLNPDNRQRILEI......... 99
556 1.000e-03UniRef50_A1TMM1 Phage head-tail adaptor, putative n=21 Tax=Proteobacteria TaxID=1224 RepID=A1TMM1_ACIAC  ali  11  2..............................LEAGKLNRRITIQRRGDEKGGGPANWLDVGTTWASIKTLSGLAAIKADAQASVAKVSIRVRWRTDLAAGMRV-LHGGVVYDVQAVDAAGRYVDLVC....... 105
557 1.000e-03UniRef50_J6IYE1 Bacteriophage head-tail adaptor protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=J6IYE1_9RHOB  ali  11  5.............................PGRLNRRLVLEAPAETDDGAGGVVRTFAEVATLWAAVTPVSATHGSEADAHGATVAWRIVMRAPREITTRHRLRLG-ARILRVLAVDPGFGFLEIDAEE--WTD 106
558 1.000e-03UniRef50_A0A154VEA5 Uncharacterized protein n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A154VEA5_9PROT  ali  12  13............................................TKNAGGGSVEAWAQLAKSWAKVKPMSGSEQVRAAQVGSSTMFEVGLYRRTDVNEADRIVRSNGDVLRIRSVETNEGFMTVMAEKV.... 100
559 1.000e-03UniRef50_E6TVG5 Phage head-tail adaptor n=1 Tax=Bacillus cellulosilyticus (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) TaxID=649639  ali  12  1..............................MNPGRARHRITPEKGDFSSHNDLGNWPEYTTVWAELETKPGRFFSGSDRNFLQSMKVFKIRYRKDLNESMRVMYKGKELVEISNVDGMNIDLLVVLQAV.... 108
560 0.002UniRef50_A0A2V3W4B1 SPP1 family predicted phage head-tail adaptor n=2 Tax=Pseudogracilibacillus auburnensis TaxID=1494959 RepID=A0A2V3W4B1_9BACI  ali  10  17....................................RLLFTQPLEKNENGFPVPGTDIYSKAWGALKTLKGKTFYEAAQTNREHNREFTVRYQDGIRPKHKIKWRGIEHKSIENDDGQNITMTVFCKAVE... 117
561 0.002UniRef50_A0A1U7CX72 Uncharacterized protein n=1 Tax=Paludisphaera borealis TaxID=1387353 RepID=A0A1U7CX72_9BACT  ali  17  2.........................RFPNPNKFNRL-VSIERRNAVQEESYGSPQWDELAKVYASIATVDGREYPGLNQNVPLATHRITFRW-PGFKPKDRIGY-EGRSFNITRVDEANRFIQVLATEL.... 112
562 0.002UniRef50_A0A2L0PQ89 Putative phage head-tail adaptor n=2 Tax=Vitreoscilla sp. (strain C1) TaxID=96942 RepID=A0A2L0PQ89_VITS1  ali  10  1..............................MQAGKLNQIITIESSKDVFGGVSFQWTQVCRPYCHVRFINGREFAKQGIQLAELTVSFRIRQRKGIDHLMRVKF-DGEIYQIIAVDAQGKYMDLACKK..... 103
563 0.002UniRef50_A7MLQ3 Uncharacterized protein n=37 Tax=Enterobacterales TaxID=91347 RepID=A7MLQ3_CROS8  ali  11  1..............................MKAGRLRHRVILQKPATGRGQPATGWVDVASVRAEVADVSGREMMDGGAELSSTTTRIWMRRYPGITTGWRAVHGGGEIYDIKSISAENGTLELLCEKGVK.. 112
564 0.002UniRef50_A0A2A7UXI9 Head-tail adaptor protein n=1 Tax=Comamonas terrigena TaxID=32013 RepID=A0A2A7UXI9_COMTR  ali  11  1................MATS-ITTLEAPPSQKLNKLVQIRKRTDVPLGDSDLGQVFSDPKPRWARIQPVGTAVYAEGQQTDHAITHRIWLRKIAGITTAHEV-VHKESLYRVLDLDGGNAFTIL......... 109
565 0.002UniRef50_A0A1V0HT71 Uncharacterized protein n=6 Tax=Rhodovulum TaxID=34008 RepID=A0A1V0HT71_9RHOB  ali  14  10................................LDQRVTIERVSRAPDGMGGATETWAPIATVWAQILPVRGTEKWEAMRVSPEARMKVRIHWQGDATPADRLVWRGRTY----NIDSALPY............ 100
566 0.002UniRef50_Q2L2A7 Putative head-tail adaptor protein n=11 Tax=Burkholderiales TaxID=80840 RepID=Q2L2A7_BORA1  ali  14  2..............................FKAGKRRVEILERTGDRDAANDADAWRVAGKAWASIKYVSGITAIKAGAEQEIAKASIRIPYRRSVLAGMRVRHGDD-VYEVDAVEERREHTDLVCREL.... 105
567 0.002UniRef50_A0A1B4LAZ4 Uncharacterized protein n=12 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1B4LAZ4_9BURK  ali  11  7................................FNRRITIQVKQAGQDDLGQPLTSWVDVAGVPAYLLASTGREYVNSGEEISKAQVSMRIRWRTDVTAAMRVLYDGGIFIEAVLPDYAGRYVDLAC....... 103
568 0.002UniRef50_UPI000C7A777F hypothetical protein n=1 Tax=Sinorhizobium medicae TaxID=110321 RepID=UPI000C7A777F  ali  16  236..........................................TTADDAMGAAKKTWALVAEVNCQIEAGAGREYFATATELAEGTTRIRLREIPGIDPAWRLVDVDSDVYEIVGVQSRNDYL-LICK...... 326
569 0.002UniRef50_A0A0U0D929 Bacteriophage head-tail adaptor n=3 Tax=root TaxID=1 RepID=A0A0U0D929_STREE  ali  12  2.........................................................DLFTVWGAVEGLGNSETMIAGALGVKTPKKITVRYRKDIKPNMRIKEKTERVFDILDPDDQGEELEILCQEV.... 84
570 0.002UniRef50_A0A1M3A7X6 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium 62-8 TaxID=1895708 RepID=A0A1M3A7X6_9PROT  ali  10  5................................LNQRAVIEARTLDPDGSGGFRESWAAVASAWVHVSPSSGRDAFDGDRAESRARVRVTLRRNAAIAAGQRVVIGSRILAIVVVLDEGAALMTLLC....... 100
571 0.002UniRef50_A0A076PIX4 Head-tail adaptor protein n=3 Tax=Comamonas testosteroni TaxID=285 RepID=A0A076PIX4_COMTE  ali  17  30.....................................................EAWIEIGKLWARIEPLSVRAFIAAAAEQSEISAHIVTYRDPRVKRGMRFVGDDGSIYRIAAADKKNGH............ 99
572 0.002UniRef50_UPI000BF193FB head-tail adaptor protein n=2 Tax=Bacillus toyonensis TaxID=155322 RepID=UPI000BF193FB  ali  11  4........................FQYKKPLNTGDFRNRIQPEVIKDELNQEVETGXEVKKAWAMIKTIKGSEYIEASASQATRIYRFVIPYTTGITELMR................................ 83
573 0.002UniRef50_A1TN22 Phage head-tail adaptor, putative n=17 Tax=Bacteria TaxID=2 RepID=A1TN22_ACIAC  ali  32.....................................................ENWVEVGKAWASIKTLSGLGAIKADAQASTVKVSIRVRWRTDLAAGMRV-LHGGTVYDVQAV.................. 92
574 0.002UniRef50_A0A0F8WZD9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8WZD9_9ZZZZ  ali  1.......................MAKWTPTGEFDQRVTVCKNDPTTNTDGQKVAVEDEWIRRWAKVMPVAGREWLLAQQTQADVSYRVRMRQTKTITPQMWLKLRDGTVLNITDVELRKIEIELEC....... 109
575 0.002UniRef50_A0A1R0WG55 Uncharacterized protein n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1R0WG55_9BACL  ali  11  14...............................RFNKRITLWGPVVIQDEIGNEVESFEEIVTLWSMVKTTKGSEYFAAAQTNSVNTVRFVVRYSKSLEE---IFNRETSKFEI..................... 91
576 0.002UniRef50_F5RN59 Uncharacterized protein n=41 Tax=Selenomonadaceae TaxID=1843491 RepID=F5RN59_9FIRM  ali  10  9................................RHRISILRPVTDTDDEGNILSSSAQEISKAWALVLPFAAKISDGYAEKVQEVDYRIVIRYRADVRVTDRIRWGDKTLTPIAPPGGKKQWLVMECRELV... 109
577 0.002UniRef50_UPI0007EDA0D1 head-tail adaptor protein n=1 Tax=Rhizobium loti TaxID=381 RepID=UPI0007EDA0D1  ali  10  9................................LDRRVELQSYTTTTNAYNEDVQAWSTYATVWAKMEFHTSVEGEASARQYAEMGLYFTIRYRTGLEPNHQLVFEDKTY........................ 85
578 0.002UniRef50_UPI000370F146 head-tail adaptor protein n=2 Tax=Methylocystaceae TaxID=31993 RepID=UPI000370F146  ali  10  30.....................................................TTWTQVATCWARMRPLSAAQVERAGRDDAIRRYEMTIRYRTDIATNSRVMWRGRRF........................ 85
579 0.002UniRef50_A0A1D9BCQ6 Uncharacterized protein n=1 Tax=Jeongeupia sp. USM3 TaxID=1906741 RepID=A0A1D9BCQ6_9NEIS  ali  10  6................................IGELRHRVTFELRSDDWGIEHDRAPPM-TVWARVEPVGGAIYHGSAQTDNAVTHRILLRYRGDLSADHEATHRRYRVRRVNNINGESRFLELEVTEL.... 107
580 0.002UniRef50_UPI0009F9DCBE head-tail adaptor protein n=1 Tax=Mongoliimonas terrestris TaxID=1709001 RepID=UPI0009F9DCBE  ali  13  7................................LDRRIVIQRATTAPDAMNEPIQTWSKLASVLAAKEDIRDSERYSAGAVVAKITTRFRIRWVADVSPTDRI-LFDGRVFDIV.................... 89
581 0.002UniRef50_D7PQ46 Head-tail adaptor protein n=13 Tax=unclassified Siphoviridae TaxID=196894 RepID=D7PQ46_9CAUD  ali  11  5............................PTQRLDRKISIQHKTTHKNEYYEWVTDWETKATIWCSVKQQYFKDYKESLGTVLEDTTNFIIRYEQQIHITMRV-VYNGVNYDIIQVLEQRDFTTLVCKRV.... 109
582 0.002UniRef50_W1KG65 Uncharacterized protein n=3 Tax=Sphingobium TaxID=165695 RepID=W1KG65_9SPHN  ali  12  1...................................MTIERATITQDPLYGGDIETWAPLVTVSAQVVQQGGREFLAAAQMMAEIRVLFRLRWIEGITVLDRVAYADRLHNEVRELGRREG-LELM........ 91
583 0.002UniRef50_U6SQD0 Uncharacterized protein n=11 Tax=Bacillales TaxID=1385 RepID=U6SQD0_9BACI  ali  16  3.............................PGDLRQKLTFQLPSDSQDADGFPILEATTYTTAWGALKTLKGKTFYAAAQTNMENNRVFTIRYQRKLMDDERVLWRGTSH-EIESIDGLNISMTVILKAV.... 109
584 0.002UniRef50_UPI00056DB47C head-tail adaptor protein n=1 Tax=Thermopetrobacter sp. TC1 TaxID=1495045 RepID=UPI00056DB47C  ali  31.......................................QKPVTTDDGAGGEMMAWRDHATVYAALIPLCARDVLFAGMESGEVLWEVRLRWRDDVQAGDRFLRRDGALLLVQAVDGRRRF--LICRCLE... 122
585 0.002UniRef50_F8GEH0 Phage head-tail adaptor n=4 Tax=Nitrosomonadales TaxID=32003 RepID=F8GEH0_NITSI  ali  12  29....................................................VDSWTDFAAVWAKVNNLSGNERSATAKGKQEARTEFTIYYVAGVTNLMRIS-CGGRYHNIRHVNEGNEFLIITC....... 107
586 0.002UniRef50_UPI000B84D042 head-tail adaptor protein n=1 Tax=bacterium A52C2 TaxID=1855383 RepID=UPI000B84D042  ali  34....................VLSRAGASAPGRLGHRVTLERASGVSDGAGGRSSSWKTVAKLWAEVVPTGSDEQAVGEGTSSVITHKITLRGGQRLAAGDRLRLGQRLFWAITDPAEDGRFIVCLARE..... 143
587 0.002UniRef50_A0A2T4ZFG5 Head-tail adaptor n=1 Tax=Phreatobacter oligotrophus TaxID=1122261 RepID=A0A2T4ZFG5_9PROT  ali  13  7.............................PGILRHRLYVEAPYEVPDGVGGVTRAFETVGLVWGLIEPLGGTEILAEERLVQRLTHRITLRRFAGLTAAHRLR-KGARLFDIRAIREARSYLTLLAEEV.... 108
588 0.002UniRef50_A0A077LL62 Phage head-tail adaptor n=3 Tax=Pseudomonas TaxID=286 RepID=A0A077LL62_9PSED  ali  10  23.................................................GGDTDRWVLVRAFWGDVRAVSGRNWLAAAQHQAEVTVEIHCRPLAAL-AGMRVA-HDTLTYQIEQPDRGRHRLRLMCKTV.... 102
589 0.002UniRef50_F7X321 Phage head-tail adaptor, putative n=66 Tax=Alphaproteobacteria TaxID=28211 RepID=F7X321_SINMM  ali  10  2..............................LNIGNMDHRITIERETETVGSVVKAWTPVATVWAEVLQQTASEFFTGYGEAETGTVIFRVRYRPGITTADRVTYDGTAYY....................... 84
590 0.003UniRef50_A0A2G8D931 Uncharacterized protein n=1 Tax=Erwinia sp. OLMDLW33 TaxID=1928656 RepID=A0A2G8D931_9GAMM  ali  1..............................MEPGRLRHRVRIEVKTDERDEHGQGWQAVKTVPADIRSVTGREFISGSAERSSVTTKIFMRYRDDIRATTRLIEQDNR......................... 81
591 0.003UniRef50_A0A1E4DT60 Uncharacterized protein n=4 Tax=Hyphomicrobiaceae TaxID=45401 RepID=A0A1E4DT60_9RHIZ  ali  11  19.......................................RQRQSVAEDEGGHGRVYVPLGTVWARVRSLTGRQGTNADGRSVAISHAVVLRFRSDLGPGDRIVYRGRQLLSASDINGRRAYVSCACSETSVT. 113
592 0.003UniRef50_UPI0008AD6022 head-tail adaptor protein n=1 Tax=Luteibacter sp. UNC138MFCol5.1 TaxID=1502774 RepID=UPI0008AD6022  ali  8................................LNRRIAIQKPGTVKDPAGQPIKGWVDHVITWANVKSQTGMGTIAGEQSTSVTRYSFRIRYRQGIDASMRV-LMGGIPYDITSVQDRREWTDLVC....... 106
593 0.003UniRef50_UPI0002D52008 head-tail adaptor protein n=1 Tax=Clostridium botulinum TaxID=1491 RepID=UPI0002D52008  ali  15  1................MKDSKVNISEFNKRIFFEKKIV------ETNENGFELDTWVTEKSFWAKVNNLYGKEFWAAKANNFEDVIVFTVRYSKFLENVDRNVFFKNKTFKIISIDN................ 98
594 0.003UniRef50_A0A0S3F312 Uncharacterized protein n=2 Tax=Sphingobium baderi TaxID=1332080 RepID=A0A0S3F312_9SPHN  ali  1................................MDRRITLQRYTETRNAYNEVVMTWADLATVYAEVRQQGGREFLAAAQETASKRVVFFIRWYPGLTTADRI-FYDGRLHNIVEVRE................ 84
595 0.003UniRef50_A0A1Y1SKM4 Bacteriophage head-tail adaptor n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y1SKM4_9RHOB  ali  10  1..............................MRAGKLRVTIQSYTQTGTDIYNVPTWADVATVWAQQRPNRGAERFTAAEVAGSSVLTFHIRHR-GVTVQDRLLYGGKT-WDIVDVRE................ 89
596 0.003UniRef50_A0A1H5YA29 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Marinobacterium lutimaris TaxID=568106 RepID=A0A1H5YA29_9GAMM  ali  13  9..................................RVTFQQLAGGESDNGYPDTDSWEDVVTVWAEVRQTTGRERWANDHVAVTSPINVRIRYKIGIHSAMRIKHGD-RYFQLIDPDGKRESLICLCEEI.... 114
597 0.003UniRef50_G7QC50 Phage head-tail adaptor n=1 Tax=Desulfovibrio sp. FW1012B TaxID=644968 RepID=G7QC50_9DELT  ali  12  3..............................IRAGELKHRLTIEANTPEYGGMVPGWAPVAKVWAKLWAKSGQERQTARANQAEVSHGVLMRSFAGLTTAHRLTMGT-RSFAITFINDTIGQFTLDVTE..... 103
598 0.003UniRef50_A0A1G5MG84 Head-tail adaptor n=2 Tax=Afifella marina TaxID=1080 RepID=A0A1G5MG84_AFIMA  ali  12  10...........................TRPGRLSQRMVWERPVTAPDGLGGETTTYLPIGHVWADLRPGTARDVALGEGRVGEVTHEIFVRREVGLAAGDRLRLGARVFLCVIDPDASGRFT........... 106
599 0.003UniRef50_A0A136HNT6 Uncharacterized protein n=1 Tax=Neptuniibacter sp. Phe_28 TaxID=1795871 RepID=A0A136HNT6_9GAMM  ali  1..............................MRYPHRITIQTKNTGKTSTGVPDDTPVVVDGIYARVSVITGREKWVPEASEQSNDVTVICRYRTGITEAMQIKHGDS-IYQITAIDERNTELRCICKR..... 100
600 0.003UniRef50_G4RE07 Uncharacterized protein n=11 Tax=Hyphomicrobiaceae TaxID=45401 RepID=G4RE07_PELHB  ali  15  27................................................DGGHETLFLPITSVWARVRSRSARIMREGDGRAATSTHAVVLRFRKDLKPGDRIVYRG-RALEIVDLNGRRAYLSCLCAE..... 108
601 0.003UniRef50_A0A2S5N9X3 Uncharacterized protein n=1 Tax=Methylophilus sp. TaxID=29541 RepID=A0A2S5N9X3_9PROT  ali  14.....................................ILHNVEAGQDSFGAQQTDWQVLTTIWANVLFKNGSQMMNANREQSDLVASVRVRLNKNIKSDMRLQYRND-VYDIHSI.................. 90
602 0.004UniRef50_UPI000C76A679 head-tail adaptor protein n=1 Tax=Eggerthella timonensis TaxID=1871008 RepID=UPI000C76A679  ali  12  3.................................YRERFELQEQSATQNDKGDSSEWVTIYAGYARVSNLGSREYWQAAAVNAESTLKLFCRYHPALDMTDRLLWRGKQL-DIKSIDNTN.............. 92
603 0.004UniRef50_F0L8J7 Phage head-tail adaptor n=28 Tax=Rhizobiales TaxID=356 RepID=F0L8J7_AGRSH  ali  9.................................GKLTARLELEVRSEVTGGAAESWSFLRSLWAAIEPVSNASHERASAEGVTITHRVWLVWRSDIVAGMRFRKGRRILRAVMDPDETRRFIVCRCEE..... 108
604 0.004UniRef50_E9CK52 Putative phage head-tail adaptor n=5 Tax=Enterobacterales TaxID=91347 RepID=E9CK52_9GAMM  ali  14  9.......................YSRFPDPGELNKRVLFYMRQDEPIGGSGIQAENQDAHTVWGKLIPVSDTLRLHSFQINKTVTHKIMVRYRQSLYSSDQAVINGVVYIGVTDINSAGRFLSFSCEEMS... 117
605 0.004UniRef50_A0A2S5H4U2 Uncharacterized protein n=2 Tax=Brevibacillus TaxID=55080 RepID=A0A2S5H4U2_BRELA  ali  12  26.......................................................WEDVITLWSAIRPLFAKEKIERPDISQSATHLFTVRFRPEIKSIMRVIYRDK-IYDIQSISEHFQKLELTCEE..... 100
606 0.005UniRef50_A0A2G4YRI6 Uncharacterized protein n=1 Tax=Emcibacter sp. ZYL TaxID=2043170 RepID=A0A2G4YRI6_9PROT  ali  5................................LHEKIICQKPVLLASGAGEQHDSWEDIAEVWAAATRVSDRPETEARQTRFTTSYRLLMRHQDILEETRRILWRGKIYQGMGQPNARGQMLEIMVRE..... 102
607 0.005UniRef50_U6SR52 Head-tail adaptor protein n=2 Tax=Bacillus TaxID=55087 RepID=U6SR52_9BACI  ali  14  33.....................................................QRFIEWRKAWANVETVSGRDYYQAASIQAENEVHFKVRYNKQINKQMRLKLH-SKMYEIKTINESKKTITIVARE..... 112
608 0.005UniRef50_A0A1I2E538 Phage head-tail adaptor, putative, SPP1 family n=1 Tax=Peptostreptococcus sp. D1 TaxID=72304 RepID=A0A1I2E538_9FIRM  ali  16  45...................................GEVIGEYSDDENELSENIQGLKLYKRVWANVVPMKSSEKVDTGTIVGDDLYKINIRYLRGINRKCVIKYQGLE-YEIESVQERRRYLEIICKR..... 139
609 0.005UniRef50_A0A0U5B2X6 Phage head-tail joining protein n=1 Tax=Aneurinibacillus soli TaxID=1500254 RepID=A0A0U5B2X6_9BACL  ali  12  1..............................MRIGKMNKRITIEHTTVSGARLVETWEEVASRWA---------YFDNLQS-----LRVVLRYLPDVEPGMRILYGQKIFEDVKDVEERQKEIHLTVKQV.... 89

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.