current user: public

If you have questions about the server, please let us know.

Query: gi|11497095|ref|NP_051172.1| hypothetical protein (BB_P11) [Borrelia burgdorferi B31], from B.burgdorferi

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# E-value Template Links and tools%idFirst MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAASYKILNLTVNNYEKQIETLEKENGNGEDQFGKEKTLLKTAMSNFFNSSEESLKSADLFIYKDKPEELKNYLKVHRHTFVVLINTEGDASDDGLKIYKDDYNKFKKPSTFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGVPAFKEGVDLAGGAIDEQFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLRLTLSPTPQLKLELSVNITYNFSINAVALVITTQDIVDYQNSLSALast
1 0.000e+00UniRef50_C0RQF3 Uncharacterized protein n=2 Tax=Borreliaceae TaxID=1643685 RepID=C0RQF3_9SPIR  ali  94  1........................................................................................................................................MKDDYDKFKTPSIFFVFSTKEQEIKELFKDKGNAEKERNIVVYSNNKDNLHLKFISQYLHQASIFHSVNPYGMSLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGVPAFKEGVDLAGSLIDEQFTYHYIKNEAIIELIRIWNKNNRQNSKLSVLQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLSLALSPTPQLKLELSVNITYNFSINAVALAITTQDIVDYQNSLSA 234
2 0.000e+00UniRef50_UPI0004E108FB DUF787 family protein n=6 Tax=Borreliella TaxID=64895 RepID=UPI0004E108FB  ali  82  1MPQDTISVSLVTSRIQTSRPNYYNPLLVYKTAKIKVNKDVANXXXXXXXXXXXXXXXXXXXXXNGNGEPQFGKEKALLKTAMSDFFNSSEESLKSAVLFIYKDKPEKLKKYLKEHRHSFVVLINTQSDDSDDGLTVCKDDYDKFKMISTFFVFSTKEDSIKGIFNGKSNADKTRNIVVYSSNKDNLHLKFISAYLHQASISHSVNPYGMPLAAVPLVDDTLIGKLRTAKINFYSLLNETGLDGMPAFKEGVDLAGNSIDELFTYHYIKNEAIIELIRIWNKNNRQNSKLSE............................................................................... 294
3 0.000e+00UniRef50_Q0SLW2 Uncharacterized protein n=17 Tax=Borreliella TaxID=64895 RepID=Q0SLW2_BORAP  ali  49  1MPKDTISVSLAQNRLVTNNINYYNPLLIYKSS-------VLASKYLALSVTNFEDLLKKLEIQKGQESDSSKKQLIALQKAMGDFF--GQDGLKSVDFYVY-NQIKEIKDFLKSNLHPFVVFVNEAEDS-------ISGDFEAIRKAYNFIVISTKDNTLVNVLKGKDKSEFKNIIAIYSDN-ENLHLKFTAMYLHQASIFHAVNPYGMILNSTPIYDDSLIDSLRKSNINFYSLLNETGNDGVLAFKEGVSLSGDSIDEAFTLYYIKNESIKELIRIWNKNSRANSKLSALNLDGSLPNEYTAGLECFFHELKQRGLIVFYKEIKVKINSSQGLSLSLEVALKYNDSFNSVNLIITAQEINEY...... 351
4 0.000e+00UniRef50_O50939 Uncharacterized protein n=38 Tax=Borreliaceae TaxID=1643685 RepID=O50939_BORBU  ali  49  1MPKDTISVSFVQNRLAFNNVNYYNPLLIYKS-------NVLASKHLALSVTNLQDLLEKLEMQKAQESDSSKKQLSALKKSMSDFF--GQDGLKSVDFYVY-NQIKEIKDFLKSNLHPFVVFVNQAED-------VISSDFEEIRKICNFIVISTKDANLPDFLKGKDKSELKNIIAVYAG-KQNLHLKFTAAYLHQASIFHAVNPYGMILNAVPVYDDSLIDSLRKTNINFYSLLNETGNDGILAFKEGVSLSGDPIDETFTLFYIKNEAIKELIRIWNKNNRANSKLGSLNLDGNLPNEYTAGLECFFHELKQKGLIVSYKEIKLKINSSEGLSLSLEVALKYNDSFNSVNLIITTQEINEY...... 351
5 0.000e+00UniRef50_C0APH6 Uncharacterized protein n=2 Tax=Borreliella finlandensis TaxID=498741 RepID=C0APH6_9SPIR  ali  87  1MPQDTISVSLIDSRIQASKPNYYNPLLVYKTAKIKVNKDNTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGKEKTLLKTAMSDFFNSSEESLKVAVLFIYKDKPEELKKYLKIHRHSFVVLINTEGNNSEDGLKVYKDDYAKFKMPSTFFVFSTKEQEIKEPFNDKGNTEKARNIVVYSNNKDNLHLKFVSGYLYQASIFHSVNPYGMPLSALPLVDDTVIGKLRTANINFYSLLNETGLDGMPAFKEGVDLAGNPIDTLFTYHYIKNEAIVELIRIWNKNNRQNSKLSELQLNGARDNAYTSAIECLLKRFIDRGLIIEYKNLKLVLSASSQLKLELSVNITYNFSINAVALVITTQDIVDYQNSLSV 370
6 0.000e+00UniRef50_Q9S0C8 Uncharacterized protein n=195 Tax=Borreliaceae TaxID=1643685 RepID=Q9S0C8_BORBU  ali  98  1MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGKEKTLLKTAMSNFFNSSEESLKSADLFIYKDKPEELKKYLKVHRHTFVVLINTEGDNSDDGLKIYKDDYDKFKTPSIFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGVPAFKEGVDLAGGAIDEQFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLRLTLSPTPQLKLELSVNITYNFSINAVALVITTQDIVDYQNSLSA 370
7 7.000e-97UniRef50_B9X9F1 Uncharacterized protein (Fragment) n=3 Tax=Borreliella TaxID=64895 RepID=B9X9F1_9SPIR  ali  86  1........................................................................................................................................................................................NLHLKFISAYLHQASISHSVNPYGIPLAAVPLLDDAVIKKLRDAKINFYSLLNETGLDGISAFKEGVDLSGKAIDEIFTYHYIKNETIVELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFIDRGLIVEYKDLKLTLSGTKQLKLELSVNITYNFSINAVVLVITSQDIVDYQNSLNV 186
8 8.000e-89UniRef50_A0A1L8Z8Z2 Uncharacterized protein (Fragment) n=1 Tax=Borreliella bissettii TaxID=64897 RepID=A0A1L8Z8Z2_BORBI  ali  95  1..........................LVYKTAKIKVNKDAANFITLNLTXXXXXXXXXXXXXXXXXXXXXFGKEKTLLKTAMSNFFNSSEESLKSADLFIYNDKPEELKNYLKIHRHTFVVLINTEGDASDDGLKIYKDDYNKFKMPSTFFVFSTKEQEIKELFKDKGNTEKERNIAIYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLL...................................................................................................................................... 210
9 1.000e-62UniRef50_Q6ASI1 Uncharacterized protein n=1 Tax=Borreliella bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) TaxID=290434 RepID=Q6ASI1_BORBP  ali  53  1.................................................................................MGDFF--GQDGLKSVDFYVY-NQIKEIKDFLKSNLHPFVVFLNESGDA-------LSSDFEAIRKALNFIVISTKENGLPNFLKGKDKGELKNIIAVYSGN-ENLHLKFAAMYLHQASIFHAVNPYGMILNSTPIYDDSLIDSLRKANINFYSLLNETGNDGILAFK.......................................................................................................................... 156
10 5.000e-45UniRef50_A0A1L8Z9A9 Uncharacterized protein (Fragment) n=1 Tax=Borreliella bissettii TaxID=64897 RepID=A0A1L8Z9A9_BORBI  ali  92  1MPQDTINVSLLDSRIQTSRPNYYNPLLVYKTSKIKVNKDAANFITLNLTXXXXXXXXXXXXXXXXXXXXXFGKEKTLLKTAMSNFFNSSEESLKSTDLFIYKDKPEELKNYLKIHRHTFVVLINTEGDASDDGLKIY......................................................................................................................................................................................................................................... 137
11 6.000e-38UniRef50_A0A1D8TET7 Uncharacterized protein n=1 Tax=Borrelia miyamotoi TaxID=47466 RepID=A0A1D8TET7_9SPIR  ali  48  1MPQDTITVNLIHETLDIKNVNYYQPLLVYKCAKIKLASSTPKVKILHLNINNFEKLIDTLEKEGSNDETEFNNEKAYLKRALCAFFSYGDAGLRSVKLLIYKESAQAIKTELIQNRNTFITLINT..................................................................................................................................................................................................................................................... 127
12 1.000e-36UniRef50_I0FDW7 Uncharacterized protein (Fragment) n=1 Tax=Borrelia crocidurae (strain Achema) TaxID=1155096 RepID=I0FDW7_BORCA  ali  74  1.................................................................................................................................................................................................................................................................................ELIRIWNLNNRQNSKLSALQLSGQRDNAYTSAIECMLERFIERRLIVAYSKLKLTLSPNPKLKLILSVSITYNFSMNGVLLNITTEDIEDFTN.... 93
13 2.000e-33UniRef50_C0RQF2 Uncharacterized protein n=2 Tax=Borreliella TaxID=64895 RepID=C0RQF2_9SPIR  ali  84  1MPQDTISVSLVDSRIQVSRPNYYNPLLVYKTTKIKVNKDTANFITLNLTXXXXXXXXXXXXXXXXXXXXXFGKEKTLLKTTMSNFFNLSEESLKSVVLFIYKDKPEELKKYLKVHRQS............................................................................................................................................................................................................................................................ 118
14 3.000e-14UniRef50_Q6ASI2 Uncharacterized protein n=1 Tax=Borreliella bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) TaxID=290434 RepID=Q6ASI2_BORBP  ali  44  1MPKDTISVSLMQNRLVANKINYYNPLLIYKS-------NTLASKHLALSVTNFEELLKKLEIRKGKETDSSNKKIA...................................................................................................................................................................................................................................................................................................... 69

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.