current user: public

If you have questions about the server, please let us know.

Query: gi|29345412|ref|NP_808915.1|(removed signal:1-19) hypothetical protein BT_0002 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst GCETEGEDIDMRFETCTVSFVQQELRSSYEVYFNGEKSINRSTSVKKNSTLKLEVYKIGEKQPELSQEITLDNSKDIELLKLVGRDIAISSSLEEYTTFTPIISYFNPNTDLYTVTFNNGELSNKVKNYIAEADLSGTLKIVRNVDGQVLYEQDMTIMPEGQFSLMQLSDTDFLDISDGEEADPESRQYTKIRFFYTADAFPGHDKLKLVVYLMDLDAMQFTAPIATIDLEAGKISEYIQIDNDAFGQGVVNGVYDLIDESGNMIVNNLEHFNTSIPIGTSDNKFMTFRFMDPSHQGGDNVQCNFILSTPWKLast
1 -4.980[J] COG1588 RNase P/RNase MRP subunit p29  ali follow..  26..............................................................................................RTWIFRGSHRGRVTKRNIIWHELIGLKVRVVNSMHPGFVGIEGYVVDETRNMLVIVGDKVWKVPKDVCIFEFETEDGAKIKIPGELVGRPEMRLKKRWR....................................................................................................................... 125
2 -4.770[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  10  24GCAHQSAEAPVA----APISTATVAASVAQSTVHGT---------------------------NIRERVALPPDAVVT-VTLSDISLAD--APSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIV-------SAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAATI........................................................................................................................... 172
3 -4.700[S] COG4332 Uncharacterized protein conserved in bacteria  ali follow..  25RCGGVKAYRCSGKFRVNA---------------NGKRIDVWLIYRDCDNSWNFGIFERRDIEPVLLQALESNDAGLARRHAFDIATLRNQVGRVEEFPDVAVHKRLLGGASESAATLELQLGLEMPTSLRLDRLLASELGISRSRLQTLAERRLLVVDPDGAKA-KPARQGMTIRID....................................................................................................................................... 192
4 -4.690[R] COG5401 Spore germination protein  ali follow..  12  22GCDKAAEEIDPPQDVTFVNDEAGANSNTTAAKKTESEKSDTAKADQASSTVMRELYLIDKNGYVVAQTLPLPKSESTALEYLVQGGPVSEILPNGFRAVLP------ADTTVNVDIKKDGTAIADFSNEFKNYKKEDEQKIVQS-----VTWTLTQFSSIDKVKLRI-HELKEMPVGGTPISDDLSRKDGINLETAGVNDLTATHPLTVYYLAENEDSEYYVPVTKRIDNSEKDDITAAINELAKGPSKVSGLLTDFSEKDGRVTLDFNQSI........................................ 301
5 -4.660[E] KOG0280 Uncharacterized conserved protein  ali follow..  52............................YDTKEDVLSPHDASVLAVAHSTGHVSFYRHQFRAELMFLRGIKVADSSVLMLSLAVSMSNGSVLIIDIDSGVIKNKWKEHDYEAWTCHYSRQD-----NNLLYSGGDDAALVCYDQRIPNSCIWRDIQVHHSGVVSILSRAPFGPYIATGEYGDF................................................................................................................................. 210
6 -4.640[R] KOG3515 Predicted transmembrane protein of the immunoglobulin family of cell adhesion molecules  ali follow..  290.LQTRANPTPVTYKSLNFTRLHRDDAGIYSCSASNS-------QGGATLNITVVV-EYGTTIKSVSENIVVNPGEDAML----SCTVEGKPLTEEHVKWMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDN----TNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPK----PQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPD.................................................. 558
7 -4.390[R] KOG0619 FOG: Leucine rich repeat  ali follow..  32.CECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLK-LVPLGVFTGLSNLTKLDISENKIVILMFQD-EVGDNDLVYISHRAFSGSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMGLNLTSLSVNLSTVPFLAFKHLVYLTHLNLSYNPIS---TIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLE-TLEENVFSSPRALEVLSINNNPLA 358
8 -4.380[E] COG0066 3-isopropylmalate dehydratase small subunit  ali follow..  13  93GCGSSREHAPWALLDFGIRCV---ISTSFADIFYNNCFKNGILPVVVSPENLEKLLDDASRGSNAVLSIDLERQEISG.......................................................................................................................................................................................................................................... 167
9 -4.290[J] COG1890 Ribosomal protein S3AE  ali follow..  63.....GRILEVSLADLQKDEEHAFRKVKLRVEIQGKSCLTSFNGLSITSDKLRSLVRKWQTTIEADQTIKTTDGYLCRVFVIGFTRRRANQVKKTTYAQSSQIRAIRQKMFQVIQNQTSSCSMRELVQKLIPEVIGREIE---RATGSIFPLQNVLVRKVKILKAPKHDAQKLLELHGESQDVGTKV............................................................................................................................. 242
10 -4.220[S] COG3212 Predicted membrane protein  ali follow..  13  76.........DNGRVVYEIEVKNDD--DEYDFKIDQQTGE--ILKEKQEQRKGSKPREGHSSSKGSEAVISMDEAKEIALKEVSGKIDDIELEREN-------------GSLVYEVEIESDH-YDDDDVTVYVDAMTGNVLYVEWDD...................................................................................................................................................................... 194

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24