current user: public

If you have questions about the server, please let us know.

Query: gi|29345416|ref|NP_808919.1| hypothetical protein BT_0006 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MRRLTVLLFLACLFSCQNDDNEKETQPEEKESVFRFIDKANITNTDTYEKAEFCLRIYYPKGDYTKFINDFIYADNIPDTLDYIVPELYEGCIYEYRVFLSNKSWDAPKKSKEYRSAEVRVEHSCDSVHFEYPKDTINAIEALEISRPLast
1 -7.470[G] COG3732 Phosphotransferase system sorbitol-specific component IIBC  ali follow..  19  37....AIVDKLAQLTGWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGIYPKRRI-IHSTGKSGPLAQYIVEDIYVSGVKEENITVVGDATPQPFSVGRDYDTSKKITEQSDGLLAKVG--MGMGSTVAVLFQSGRDTIDTV........ 173
2 -6.340[P] KOG4404 Tandem pore domain K+ channel TASK3/THIK-1  ali follow..  16  28...VLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNFTGAFYFVGTVVSTIGFTTPATVGGKIF...................................................... 126
3 -6.080[O] COG2332 Cytochrome c-type biogenesis protein CcmE  ali follow..  12  37.............FYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVD-VSYEGILPDLFREGQGVVVQGELEKGNHILAKE---LAKHDENYTPPEVE............................ 140
4 -6.080[R] COG2372 Uncharacterized protein, homolog of Cu resistance protein CopC  ali follow..  16  16...LIVLFVGLSSQQALAHAHLKAETPAADTTINAAPEALTLGFSEGIELNFSGVKVTGPDNNVVKTGDLKLDPANNTQLILPIGHALAAG---KYHVSWHVVSVDGHKTKGTYSFT............................... 126
5 -6.010[U] COG4669 Type III secretory pathway, lipoprotein EscJ  ali follow..  19  3RRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNI-EANKIDSGKLGYSITVAEPDFTA-AVYWIKTYQLPPRPRVEIAQMFPA---------SLVSSPRAEKARLYSAIEQRLEQSLQTVHISYDIDAGENGRPPK.... 144
6 -5.760[S] COG3014 Uncharacterized protein conserved in bacteria  ali follow..  14  1MKIFVLLMSVILGIGCIGYRMDLEHYEESPKKAYEYSKQFTKKKKNALLWDLQNGLSALYARDYKTSLGVLDQAEQRFDKTQSAFTRGYGGNIYEYKAIDYMLLNDSAKARVQFNRANERQRRAKEFYYEEVQKAIKEIDSSKK.... 173
7 -5.530[C] COG3043 Nitrate reductase cytochrome c-type subunit  ali follow..  23  89..........RCL-QCHGVESYRTTG-APRISPTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVNTF............................................................................. 148
8 -5.510[S] COG3521 Uncharacterized protein conserved in bacteria  ali follow..  15  8TRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAIEIRVYFTTADYWSLHDN-VLTDDLVRRDSFILRP-AIGVLAGYR--LAKSVWKIPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK.... 178
9 -5.480[S] COG3101 Uncharacterized protein conserved in bacteria  ali follow..  16  29.................GDDEPIYLPADAEVPYNRIVFAHGFYASAIHEISHWCIA-YCPDGRDAQTQSQFEDVEVKPQALDWL---FCVAAGYPFNVSCDNLEGDFEPDRVVFQRR............................... 137
10 -5.470[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  40..KSTLFSWMIGALAEQNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGG--QRARVALLRALLAQPRDNFRQWVFSEVRALAIPVVQVTHDLDVPADSSVLDMAQW 209

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.