current user: public

If you have questions about the server, please let us know.

Query: gi|29345423|ref|NP_808926.1| hypothetical protein BT_0013 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MIQYNGITLLRDEDGTPMQVNIDLRVHGTELDAFMRAHGLTAQEQSEMLRSVTGEDISPTYVAGGKVQQHVRYLPEMKRQIQTETDRLFVSPRTRPVSVIRKEFPDLLLHRIVRVLTPIPRTKAATPKAFERYCGRDTFWVRFKMQGMMNVTWCVFFTIHDEGIVLVRHLAGAGENDEDLLast
1 -6.160[S] COG5501 Predicted secreted protein  ali follow..  12  83....ESLKLVIDENPAPVAAEIRFGPAMAPLKFETRVRVNQYSNIRAIAETPRGIFMHGRFVSGGCSAPATKDPVAALKDMGEMRLKLFGGKGEVQKARREAQI--MIRHPNYSGLQRDQITQLFVSAKF-KQGDELLFALDGGISISENPVFRFSYTDNGAPDFTVHAVDTDGNVFD.. 261
2 -5.610[F] COG0563 Adenylate kinase and related kinases  ali follow..  13  14...........................GTQAEKIIEKYGIPHISTGDMFRAAMKNETE-SYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLDKKLDYVINIDVPEQLLMDRLTGR............................................ 127
3 -5.560[F] KOG3078 Adenylate kinase  ali follow..  15  22..............GPP---------KGTQAPRLAENFCVCHLATGDMLRAMVASGSE-ATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGR............................................ 142
4 -5.550[J] COG0242 N-formylmethionyl-tRNA deformylase  ali follow..  13  53YGLRSGVGLAAPQINISKRVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHL............................................................................................ 159
5 -5.350[K] COG1476 Predicted transcriptional regulators  ali follow..  13  2...........................KNNIKVYRAIHDLT---QENLAEKVGVTRQTINAIEKGKYDPSLDLAFKLSRLFKASVEDIFLYESNEK.................................................................................... 67
6 -5.310[R] COG5516 Conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding  ali follow..  12  33.....................IDRFDDPAAIDTFAEAANLYGAERNRFGTLVPAKSERRNAFIGLREATDRHFRALVRDLLADLLEAIATVLRQPADTRKGTPLDVATAHSALGLIAGPERERLRSRNRSRTWCDMAVCGNRTKAR.................................. 174
7 -5.290[R] KOG4578 Uncharacterized conserved protein, contains KAZAL and TY domains  ali follow..  354..........................................................................DPSHTLEERVVHWYFSQLDSNSSNDIKREMKPF------KRYVKKKAKPKKCARRFTDYCDLNK-------KVISLPELKGCLGVSKEGRLV.............. 434
8 -5.020[K] KOG4319 DNA-binding nuclear protein p8  ali follow..  18  5........FLLPVHG-PQQRNVCFGLDGAELETFFRTN-FQESACADAWPQTAGQCQQAGPQAQTRPPTPISYKEELYRCLYYYCLR--ACGVGRSKGLTLSEQAL--------------RTKRLSPGGHAS................................................ 126
9 -4.950[L] KOG2519 5`-3` exonuclease  ali follow..  10  74RLLEAGIKYVFDGKPPELKRQELAKRYSKRADATADLTGAIEAGNKEDIEKYSKRKVTKQHNDDCKRLLRLMGVPVVEFEKEAEAQCAALCKSGKVYGVASED-MDSLTFGAPKFLRHLMDPSSRKIPVMEFEVAKILEELQLTMDQFIDLCILS-------GCDYCDSIRGIG...... 255
10 -4.910[H] COG0853 Aspartate 1-decarboxylase  ali follow..  16  3......RTMLGGKIHRATVTEADLNYVGS--QDLLDAAGIYPNEKVAIVNNNNGERFE-TYTIAGKRGSGVICLNGAAARLVQKSDIVIIMSYVQLSEPEIAAHEPKVV....................................................................... 106

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.