current user: public

If you have questions about the server, please let us know.

Query: gi|29345416|ref|NP_808919.1| hypothetical protein BT_0006 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MRRLTVLLFLACLFSCQNDDNEKETQPEEKESVFRFIDKANITNTDTYEKAEFCLRIYYPKGDYTKFINDFIYADNIPDTLDYIVPELYEGCIYEYRVFLSNKSWDAPKKSKEYRSAEVRVEHSCDSVHFEYPKDTINAIEALEISRPLast
1 -8.5901wwx_A mol:protein length:107 E74-like factor 5 ESE-2b  ali model follow..  21  14........FVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKM-TYEKLSRALRYYYKTGILERVDRRLVY........................................................................... 87
2 -6.9205c6t_A mol:protein length:636 Envelope glycoprotein B  ali model follow..  16  5.........IWCLVVCVNLCIVCLGAAVSTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINEDLDEGI--VVYKRNI-------VAHTFKVRVY-QKVLTFRRSYTEYVAPPMWEIHHINSHSQCYS..................... 125
3 -6.7301yo5_C mol:protein length:97 SAM pointed domain containing ets transcription factor  ali model follow..  21  10..PIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARL-NYDKLSRSIRQYYKKGIIRK.................................................................................. 82
4 -6.7103jtg_A mol:protein length:103 ETS-related transcription factor Elf-3  ali model follow..  20  10........FIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQL-TYEKLSRAMRYYYKREILER.................................................................................. 76
5 -6.7004xr8_F mol:protein length:151 Protein E6  ali model follow..  13  26.......IILECVY-CKQQLLRREVYDFAFRDL-----CIVYRDGNPYAVCDKCLKFY-SKISEYRHYSYSLYGTTLEQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRSSRTRRETQL........ 151
6 -6.4904twk_A mol:protein length:283 Potassium channel subfamily K member 2  ali model follow..  16  31...VLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPDLGSSFFFAGTVITTIGFISPRTEGGKIF...................................................... 134
7 -6.3204jg9_A mol:protein length:174 Lipoprotein  ali model follow..  1MKKGTMLLFSILIAGCTQAQDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVNWEETPSFIQEKIPLK--------GIEEKIAMADSPIIANEKNEIMWYF----LDPEMPTGKLSIIALKQGSV........................ 114
8 -6.3002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  2.............SSLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEA--------LVRVDSSSGLGDYLELHIHQGKIVKFNV-INDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIP 142
9 -6.2701sr3_A mol:protein length:136 APO-CCME  ali model follow..  13  7............LFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVD-VSYEGILPDLFREGQGVVVQGELEKGNHILAKE---LAKHDENYTPPEVE............................ 111
10 -6.2405xs8_A mol:protein length:505 Extracellular solute-binding protein family 1  ali model follow..  17  1MKKLLALGLLGLVLASCGKKEETTTGPKETTIFAMHLGKALDPNLPVFVKAEKDTNIKLNQTDQIQAYNLMLTEGKLPDIVADLENLGIEGGLIPLEDLINQHAPNLKKFFEENPRYKKDAQDWLEKLGLKEPRELYTTLKAFREKDP 190

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.