current user: public

If you have questions about the server, please let us know.

Query: gi|29345418|ref|NP_808921.1| hypothetical protein BT_0008 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MAEINNPEFGVRRLDEHERIESFDCGDADLNDFIMNESFIYRNELLAVSYVVEDAFGKVLAYFSLANDKISLSEFENKTEFNRFRKKRFVNEKRLKSYPAVKICRFGVDVSTHNLHLGSKLLNFIKGYFVINNKTGCRFITVDAYIDAVPFYLKNNFLELTSSDEDASHTRLLYYDLKMMVLast
1 -70.4006g96_B mol:protein length:176 Acetyltransferase  ali model follow..  18  4.....FTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVIHGFYSVSPASLIYAQVPGAI----------SKGLGRYDVPVFRLGRLAVDKSMQGQGLGALLLSAGKRCIQAALQVGGVALLIDAKNKVCDWFKGFGAVPLNDQP------LSLLLSFKTL. 166
2 -70.1005fvj_A mol:protein length:166 PUTATIVE ACETYLTRANSFERASE  ali model follow..  20  8......RVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNL----------RRNMPDPIPVIILARLAVDLSFHGKGLGALLHDAVLRCYRVAENIGVRAIMVHALTEAKNFFIHHGFKSSQTQQ------RTLFLRLPQ.. 166
3 -69.3005xun_A mol:protein length:177 Acetyltransferase  ali model follow..  19  6.......TIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVLLGYYTLSGSCFERGMLPSKTQ---------QKKIPYQNAPSVTLGRLAIDKSVQGQGWGELVAHVMRVVWGASKAVGIYGLFVEALNEAKAFFLRLGFIQLVDEN-----SNLLFYPTKSI. 168
4 -28.3002pr1_A mol:protein length:163 Uncharacterized N-acetyltransferase ylbP  ali model follow..  13  4MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDST---SPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQ------------------DYLELWKLEVLPGYQNRGYGRALVEFAKSFKMP--------IRTNPRMKSAEFWNKMNFKTVKYD.................. 137
5 -27.4001kuv_A mol:protein length:207 Serotonin N-acetyltransferase  ali model follow..  11  32LPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAF--IIGSLWDEERLTQESLALHRPRG-----------HSAHLHALAVHRSFRQQGKGSVLLWRYLH--HVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIGSLTFTEMHCSLRG.. 197
6 -26.0001tiq_A mol:protein length:180 Protease synthase and sporulation negative regulatory protein PAI 1  ali model follow..  15  15.........TLQQLSIETFNDTFK-SPENMKAYLESEQLEKELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAE---------------------SLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHS................. 154
7 -25.8005gcn_A mol:protein length:166 HISTONE ACETYLTRANSFERASE GCN5  ali model follow..  13  3......GLLDFDILTNDGTHRNMKLLIDLKNIFSRQYIVKLVFDRHHESMVILKNKQKVIGGICF---------------------------RQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHM---QKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLM 154
8 -25.7005icw_A mol:protein length:182 N-alpha-acetyltransferase 60  ali model follow..  10  3VPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEI---------KNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTAINFYENRDFKQHHSIRGVLKDGFTYVLYIN... 180
9 -25.5001u6m_A mol:protein length:199 acetyltransferase, GNAT family  ali model follow..  11  36..........................EEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVEG.. 191
10 -25.3003fb3_A mol:protein length:161 N-acetyltransferase  ali model follow..  17  7NLYFQGVDLELRVLEESD-LGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLM----------------------IQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDL---CEISRSKGCYKVILDSSEKSLPFYEKLGFRA...................... 146
11 -25.2004ua3_A mol:protein length:194 Uncharacterized N-acetyltransferase C825.04c  ali model follow..  12  21LKNLGVWVEIYHHLEKGLLQQCFNLVKKNMEALYRQSSFGWDDSEKLKICIFEKTSKKLVGFLSFEDTV--------------------------AGLTCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDFVPHESSPQIHPDYYILYTKSRK.. 192
12 -24.8002bsw_A mol:protein length:146 GLYPHOSATE N-ACETYLTRANSFERASE  ali model follow..  18  69...................................................................................................QYQLRGMATLEGYREQKAGSSLIKHAEEIL---RKRGADLLWCNARTSASGYYKKLGFSEQGEV.................. 129
13 -24.8004e2a_A mol:protein length:207 Putative acetyltransferase  ali model follow..  13  44.........LLQKIAIQTFRETFA-TAEQLQNFFDESVLKLELDDKESETYFILMSGKAAGFLKVNWGSSQTEQVLED---------------------AFEIQRLYILKAYQGLGLGKQLFEFALERAQISGLSWVWLGVWEKNVKAQLLYAKYGFEQFSKHS................. 183
14 -24.6001z4r_A mol:protein length:168 General control of amino acid synthesis protein 5-like 2  ali model follow..  16  80....................................................................................................TEIVFCAVTSNEQVKGYGTHLMNHLKEYHI---KHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLM 157
15 -24.6001i1d_A mol:protein length:161 GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE  ali model follow..  19  54...................................NDNEDKKIMQYNPMVIVDKRTETVAATGNII----------------------IERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQL---VTIGFDYGCYKIILDCDEKNVKFYEKCGFSN...................... 152
16 -24.3002vez_A mol:protein length:190 PUTATIVE GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE  ali model follow..  16  40VLAVLPADYTIRPLCRSDYKRGYTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLV----------------------VERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQAL---DYVAEKVGCYKTILDCSEANEGFYIKCGFKR...................... 181
17 -24.3005jq4_A mol:protein length:146 Acetyltransferase SACOL1063  ali model follow..  16  1......SNAMFSKVNNQKMLEDCFYIRKKV--FVEEQGIPEESEESESIHLIGYDNGQPVATARIRPIN-----------------------------TTVKIERVAVMKSHRGQGMGRMLMQAV---ESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNI-EEGIEHIEMTKKLTSL. 146
18 -24.2004nsq_A mol:protein length:190 Histone acetyltransferase KAT2B  ali model follow..  16  95....................................................................................................TEIVFCAVTSNEQVKGYGTHLMNHLKEYH---IKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLM 172
19 -24.1004e8o_A mol:protein length:167 Aac(6`)-Ih protein  ali model follow..  8RENLYFQGMNIMPISES-QLSDWLALRCLLEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNGTQTS--------------------PVAFLEGIFVLPEYRRSGIATGLVQQVEIW---AKQFACTEFASDANQISHAMHQALGFHETER................... 152
20 -24.0005us1_A mol:protein length:189 Aminoglycoside 2`-N-acetyltransferase  ali model follow..  13  7.SHMGSMGIEYRSLHTSQLTLSEKEALYDLEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVAIIQRHMALDN---------------------TPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLG----LLSASDDGQKLYHSVGWQIWKGK.................. 145
21 -23.7004e0a_A mol:protein length:164 BH1408 protein  ali model follow..  15  18..........HTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQR-------------------KTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQ................... 150
22 -23.6003efa_A mol:protein length:147 Putative Acetyltransferase  ali model follow..  14  71...................................................................................................VMRFGRVCTRKAYRGHGWGRQLLTAA---EEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGP-EDGAPVVIMHKQL.... 146
23 -23.6005hgz_A mol:protein length:243 N-alpha-acetyltransferase 60  ali model follow..  11  12......SEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEI---------KNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTAINFYENRDFKQHHSIRGVLKDGFTYVLYIN... 183
24 -23.5004f6a_A mol:protein length:156 BH1408 protein  ali model follow..  15  18..........HTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQR-------------------KTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNERAKRFYHSLGMRCQKQ................... 150
25 -23.5001y9w_A mol:protein length:140 Acetyltransferase  ali model follow..  22  1........MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMY-----------------------------FYHLHIDFLWVDESVRHDGYGSQLLHEIEG---IAKEKGCRLILLDSFSQAPEFYKKHGYREYGVVEDHPKGHSQHFF...... 136
26 -23.3002k5t_A mol:protein length:128 Uncharacterized protein yhhK  ali model follow..  12  2.......KLTIIRLEKFSDQD-----RIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSG-----------------------------TEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTTQQG................... 122
27 -23.3001q2y_A mol:protein length:140 similar to hypothetical proteins  ali model follow..  22  65...................................................................................................YGKLERICVLKSHRSAGVGGIIMKAL---EKAAADGGASGFILNAQTQAVPFYKKHGYRVLSEKE................. 126
28 -23.2001m44_A mol:protein length:181 Aminoglycoside 2`-N-acetyltransferase  ali model follow..  10  1...MHTQVHTARLVHTADLDSETRQDIRQMGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRG---------------------NALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLG----ALSSSARARRLYASRGWLPWHGP.................. 137
29 -23.2004pv6_C mol:protein length:162 N-terminal acetyltransferase complex subunit [ARD1]  ali model follow..  15  5..AINAVAGTIREFSPKDIESVYRIAQTSLTEYYTQALILDLHREWPESFMVYTVAGSVVGFIVGSKYSRTEAR----------------------------ILLFAVDERFRRMGVGSALMDAFLSLCREQNMLSVRLEVRTDNDEAIRFYKKYGFVITAMLPNDSSNAYTMWRIVLE.. 156
30 -23.1002huz_A mol:protein length:184 Glucosamine 6-phosphate N-acetyltransferase  ali model follow..  16  31SPTHPGEGLVLRPLCTADLNRGFETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLI----------------------IEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTL---TLLSKKLNCYKITLECLPQNVGFYKKFGYTV...................... 172
31 -23.1002dxq_A mol:protein length:150 Acetyltransferase  ali model follow..  12  1...MSSDAISLRAAGPGD-YQVLNPSDPELTTQEAGAVFAAMLAQPGLTIFVATENGKPVATATLL----------------------IVPNLTRAARPYAFIENVVTLEARRGRGYGRTV---VRHAIETAFGANCYKVMLLTDPAVHAFYESCGFVQ...................... 140
32 -23.1004cry_B mol:protein length:137 PANZ  ali model follow..  12  2.......KLTIIRLEKFSDQD-----RIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSG-----------------------------TEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQG................... 122
33 -22.9001wwz_A mol:protein length:159 hypothetical protein PH1933  ali model follow..  14  1MDEIKIEKLKKLDKKALNELID----YGGEGRDYARNYIKWCWKKASDGFFVAKVGDKIVGFIVCDKDW----------------------FSKYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDT-IELWVGEKNYGAMNLYEKFGFKKVGKSG................. 148
34 -22.9003jvn_A mol:protein length:166 Acetyltransferase  ali model follow..  36...........................KTASEIEEEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELISTVSKLV--------------------MMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWDFNKGALEFYNKQGLNEH..................... 148
35 -22.7005wjd_A mol:protein length:159 CG8481, isoform B  ali model follow..  13  2......SPFNVVPIHNYPEL-------KDTCALINAELEASCDSLPCSLVLTTEGMCRVIAHLKLSPIN--------------------------SKKKACFVESVVVDKRHRGQGFGKLIMKFAED--YCRVVLDLKTIYLST-IDQDGFYERIGYEYCAPITMYGPRHCELP....... 145
36 -22.6003t90_A mol:protein length:149 Glucose-6-phosphate acetyltransferase 1  ali model follow..  16  3......ETFKIRKLEISD-LGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIETSGKIAATGSVM----------------------IEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFL---MDHCKSMGCYKVILDCSVENKVFYEKCGMSN...................... 139
37 -22.6002fiw_A mol:protein length:172 GCN5-related N-acetyltransferase:Aminotransferase, class-II  ali model follow..  12  1.GHMVMSTPALRPYLPEEQLTADDYSEEQQEAWASADEAKFAARLSGQLTLIATLQGVPVGFASLKGPD--------------------------------HIDMLYVHPDYVGRDVGTTLIDALEK---LAGARGALILTVDASDNAAEFFAKRGYVAKQRNTVSINGEWLANTTMTKSL 160
38 -22.6002q04_A mol:protein length:211 Acetoin utilization protein  ali model follow..  13..ETSLGPVEIEGPVTSQILATYKL-DPGLTAFRQHEALVEIAALEEGRIIIARQGNDIIGYVTFL------------------YPDPYETWSEGNNPYILELGAIEVAARFRGQQIGKKLLEVS---MLDPAMEHYLILTTDYRKIMEKMMNHGGLVFFPTDD................. 172
39 -22.6004evy_A mol:protein length:166 Aminoglycoside N(6`)-acetyltransferase type 1  ali model follow..  9.ENLYFQGMNIKPASEASLKD-------ELRNKLWSDSEASHLQEMHQLQLLAYSDHQAIAMLEASIRFEYVNGTETS--------------------PVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEK................... 151
40 -22.6004ag7_A mol:protein length:165 GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE  ali model follow..  17  14IPSNLPDNFKVRPLAKDDFSKGYSVGNLDQEAFEKREAMRTSVPNYHIVVIEDSNSQKVVASASLV----------------------VEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTL---VSLGKSLGVYKISLECVPELLPFYSQFGFQD...................... 156
41 -22.6003exn_A mol:protein length:160 Probable acetyltransferase  ali model follow..  4MGAMHVLTLDLAPVTPKDLLHRVFHLSPSYFALIGVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLG--------------------------YPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRL--YAVVYGHNPKAKAFFQAQGFRYVKDGG................. 150
42 -22.5003fix_A mol:protein length:183 N-ACETYLTRANSFERASE  ali model follow..  10  23IRKLSIEDLELIEVARESWKWTYAYSEEYIESWIRENEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAE-----------------------------LLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSD............... 170
43 -22.5001z4e_A mol:protein length:153 transcriptional regulator  ali model follow..  12  43...................................VRAFKEIKKDKNNELIVACNGEEIVGMLQVT----------------------FTPYLTYQGSWRATIEGVRTHSAARGQGIGSQLVCWAIERAKERGCHLIQLTTDKQRPDALRFYEQLGFKA...................... 144
44 -22.4002g3a_A mol:protein length:152 acetyltransferase  ali model follow..  13  8VRRLEKNTMNFV-LSDVADAEAEKAIRDPLVAYNLARFGESDKRDLN--ITIRNDDNSVTGGLVGHTAR------------------------------WLYVQLLFVPEAMRGQGIAPKLLAMAEE---EARKRGCMGAYIDTMNDALRTYERYGFTKIGSLGPLSSGQSITWL...... 148
45 -22.3005c82_A mol:protein length:190 Nourseothricin acetyltransferase  ali model follow..  63..............................DESDDESDDGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRR---------------------------LTVEDIEVAPEHRGHGVGRALMGLA---TEFARERGAGHLWLEVTNVAIHAYRRMGFTLYDGTASDGEQALYMSMPC.... 189
46 -22.2004xnh_C mol:protein length:176 N-terminal acetyltransferase A complex subunit NAT5  ali model follow..  3RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDSSKKDVHFTQMAYYSEIPVGGLVAKLVPKKQNELSLK---------------------GIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNDEQDAILLKKHIS... 176
47 -22.1004u9w_A mol:protein length:207 N-alpha-acetyltransferase 40  ali model follow..  10  41..NVSIECKRVSGLEPATVDWAFDLTKTNMQTWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDV--------------------------CGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFEALQFEIDDSSPSEDCSYEILSRRTK... 206
48 -22.1001xeb_A mol:protein length:150 hypothetical protein PA0115  ali model follow..  13  4.......DWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQELVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQ--------------------------VVIGRVVSSSAARGQGLGHQLMERALQ--AAERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEV.................. 136
49 -22.1004r3k_A mol:protein length:173 Uncharacterized N-acetyltransferase SSO0209  ali model follow..  12  5.EKDKGRDFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMP-----------------RIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYAIALYEKLNFKKVKVLKGDGEDAYLMARPL.... 167
50 -22.0002g0b_A mol:protein length:198 FeeM  ali model follow..  10  5......PRKVARILVAPNERDARRIVRTTYQGYAIDESFATFLEGPSATTFGLFNGEVLYGTISIINDG---QGLPMDSIYAVELAAWRGEGKK-----LAEVVQFAMDHTLYEAVAGAEAASLFTMVLTYALETHIDYLCISINPKHDTFYSLLGFTQIGALGTVNAPAIARALYVPEW. 182
51 -21.6002kcw_A mol:protein length:147 Uncharacterized acetyltransferase yjaB  ali model follow..  14  3........ISIRRSRHEE-VAIWCRSVDATHDFLSAEYRTELEDLVRSFLPAVNERDQPVGFMLLSGQ---------------------------------HMDALFIDPDVRGCGVGRVLVEHAL-----SMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLA... 143
52 -21.6001mk4_A mol:protein length:157 Hypothetical protein yqjY  ali model follow..  1..HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQD----TSFITSEHNSMTGFLIGFQSQSDPETA---------------------------IHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTPGQDRVLFVKNI.... 157
53 -21.5002atr_A mol:protein length:138 acetyltransferase, GNAT family  ali model follow..  18  1MITIKKQE-DVLHLYQAVGWTNYTHQTEMLEQALSH----------SLVIYLALDGDAVVGLIRLVGDGFSS----------------------------VFVQDLIVLPSYQRQGIGSSLMKEALGNF---KEAYQVQLATEETEKNVGFYRSMGFEILSTYD................. 127
54 -21.5004m85_A mol:protein length:186 N-acetyltransferase  ali model follow..  11  36.........................PKDMVLDAIEKSCVDATYRTFYQHILVYEVENKVAGCYSGENELKYEKAWELLDLPEEIKQYGTPLPVKEAKDDEYYIETIATFAAYRGRGIATKLLTSL------LESNTHVKWSLNCDINALKLYKKVGFISDGQIELYKHMYHHLIVK..... 186
55 -21.4003s6f_A mol:protein length:145 Hypothetical acetyltransferase  ali model follow..  16  2MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILA----------------------------ASIPLLEVQAGWRSLGLGSELMRRVLTELG-----DLYMVDLSCDDDVVPFYERLGLKRANA................... 130
56 -21.4001s3z_A mol:protein length:165 aminoglycoside 6`-N-acetyltransferase  ali model follow..  44..................................HLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSS--------------------PVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETER................... 151
57 -21.3002q0y_A mol:protein length:153 GCN5-related N-acetyltransferase  ali model follow..  15  7LCIDDLELVCRHREAMFREAGRDALTLAAMQDPFRDWLLPRLADGSYFGWVM-EEGGAPLAGIGLMVIEWPPHPSHPLQDKRGY------------------ILNLYVDPSHRERGIGQALMNRAEAEFAER---GIAFAVLHATEMGQPLYARMGWSPTTE................... 146
58 -21.3003gy9_A mol:protein length:150 GCN5-related N-acetyltransferase  ali model follow..  14  3.......DVTIERVNDFDGAKSSQEGFQLVERMLRNRREESFQEDGEAMFVALSTTNQVLACGGYMKQSGQAR--------------------------TGRIRHVYVLPEARSHGIGTALLEKIMSEAFL----TYDRLVLYS-EQADPFYQGLGFQLVSGEKITHTLDKTAFADSNR.. 150
59 -21.3006bvc_A mol:protein length:177 Aminoglycoside-(3)-N-acetyltransferase  ali model follow..  14  24MGIIRTCRLGPDQVKSMRAAREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYV-----------------------LPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLL---KHEANALGAYVIYVQADYGAVALYTKLGIRE...................... 164
60 -21.3003pp9_A mol:protein length:187 Putative streptothricin acetyltransferase  ali model follow..  12  63..................................EELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNW-----------------------------NYAYIEDITVDKKYRTLGVGKRL---IAQAKQWAKEGNMPGIMLETQNNACKFYEKCGFVIGGLNMTSDEVAIYWYLHFDS.. 187
61 -21.3004bmh_A mol:protein length:262 ACETYLTRANSFERASE  ali model follow..  13  44MTPPPTPSPAVRPYRPDDRVRTAHAGRDS-GVFPAAFAAPYVHLEPELAFVLDDGAGQAVGYVLGTADTPRFVADYRAKWLPLVAGRYPEPRHPPRSPDEEIVAHIDLLPDWQGRGYGRALMETFLRALHERGVAAVHLSMVSANTPARAFYDRLGFHEIAVPHP................ 241
62 -21.2003t9y_A mol:protein length:150 Acetyltransferase, GNAT family  ali model follow..  12  18.........KLNQLCKLYDDLGYPTNENDLKKRLKKITNHDDYF-----LLLLIKENKIIGLSGMCKMMFYEKN------------------------EYMRILAFVIHSEFRKKGYGKRLLADSEEF---SKRLNCKAITLNSRLSAHKLYSDNGYVS...................... 141
63 -21.0001vkc_A mol:protein length:158 putative acetyl transferase  ali model follow..  12  43..................................EELFESLLSQGEHKFFVALNERSELLGHVWICITLDTVDYV-----------------------KIAYIYDIEVVKWARGLGIGSALLRKAEEWAKERGAKKIV-LRVEIDNPAVKWYEERGYKA...................... 143
64 -21.0005f46_A mol:protein length:157 aminoglycoside acetyltransferase HMB0020  ali model follow..  14  45...................................SEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSE------------------------PLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQ................... 148
65 -21.0003d8p_A mol:protein length:163 acetyltransferase of GNAT family  ali model follow..  16  3.......AINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLGQFWLAINNHQNIVGTIGLIRLD-----------------------------NMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSVDNRFYYRNLKD.. 163
66 -20.9003mgd_A mol:protein length:157 Predicted acetyltransferase  ali model follow..  11  35..........................DKELTRYFNNKLANNL-----LVEWIAEENNQIIATAAIAFIDFPPTYTNKTGRK--------------------YITNMYTEPTSRGNGIATGMLDRL---VNEAKERNIHKICLVASKLGRPVYKKYGFQDTDE................... 143
67 -20.9005xxr_A mol:protein length:132 Protein RibT  ali model follow..  30...................................QQTIKDYETDTDRQLFLWKEDEDIVGAIGVEKKD-----------------------------SEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQ--------VLVPNELTQSFFERCQGQQDQDISYNNLE............ 126
68 -20.9002r7h_A mol:protein length:177 Putative D-alanine N-acetyltransferase of GNAT family  ali model follow..  11  35........RRVVESTGFFTPEEADVAQELVDEHLMHGAACGYH------FVFATEDDDMAGYACYGPTPATEGTYD--------------------------LYWIAVAPHRQHSGLGRALLAEVVHDVRLT---GGRLLFAEKYAPTRRFYERAGFSAEAVLKAAGDDKIIYRLEVA... 177
69 -20.7002gan_A mol:protein length:190 182aa long hypothetical protein  ali model follow..  16  53.................................VYEPFLKFRLSQEFDELYTYQKDNRIIGTIALVYKRIKEKGIWWVPEELMNEK-------------VGLIEFFVVDPEFQGKGIGSTLLEF---AVKRLRSLGKDPYVFPNLEAYSYYYMKKGFREIMRYK................. 169
70 -20.4003ey5_A mol:protein length:181 Acetyltransferase-like, GNAT family  ali model follow..  10  5IRFQPITTSDVQHYKFMEELESF----PPEEYRELEHLREYTDRIGNFHNNIIFDDDLPIGFITYWDFD-----------------------------EFYYVEHFATNPALRNGGYGKRTLEHLCEFLKRPIVLEVERPVEEMAKRRINFYQRHGFTLWE.................... 134
71 -20.3003zj0_A mol:protein length:206 ACETYLTRANSFERASE  ali model follow..  17  1MA----SEVVIRRATAADHGDLCRVCLLTGDSGRDASSREDDPTLLGMIYAVLEDAEGVCGYLLGAPDTLSFQHFLEKEWLPPLRAGLTDPGPDPAAWQGPAHGHIDLLPRAQGRGVGSRAMDHLEAALAAAGAPGMHLQVSPENPRALGFYEHRGFRELCRSEDEVVVGRRLLDE..... 206
72 -20.3004yfj_A mol:protein length:182 Aminoglycoside 3`-N-acetyltransferase  ali model follow..  14  23MSIIATVKIGPDEISAMRAVKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAA-----------------------YVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVRE...................... 163
73 -20.2002ob0_A mol:protein length:170 Human MAK3 homolog  ali model follow..  13  5.SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEV------GELAKLAYFNDIAVGAVCCRVDHSQNQK-------------------------RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNEAIDFYRKFGFEIIETKKNEPADAHVLQKNLKV.. 157
74 -20.1002oh1_A mol:protein length:179 Acetyltransferase, GNAT family  ali model follow..  10  26.........KINDLMIDTARWLKESGSTQWSDILHGFDVHNIEQRIELVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAID---------------KAYYLHRIMVSRAFSGISLSKQMIYFAEK---LGIEMSVPFIRLDCIESLNQMYVRYGFQFSGKKNGFYLYQKEL........ 176
75 -20.1004kvm_E mol:protein length:156 N-terminal acetyltransferase A complex catalytic subunit ard1  ali model follow..  14  1........MDIRPARISDLTGMQNCNLHNLPEYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGH-----------------------ITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAIHLYDTLQFDVQGIESKDGEDAYAMHKDFST.. 154

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.