current user: public

If you have questions about the server, please let us know.

Query: gi|29345419|ref|NP_808922.1|(removed signal:1-26) phosphate-binding periplasmic protein precursor, putative ABC transporter BT_0009 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst AATLFTSGKPVEELSENAAVGRKSVITAAGATLPLPFYSEAFKMYWEKNDIPVTYAGIGTERGFRSLKNQQIDFAGVDVPPTKAELDSLPVKSILVPTCMGAVTIAYNLEGVDNLRLTGELIADIYMGKILKWNDARIAAVNAGKQLPDKEIYPVFRLDGSGTTYIFSDYLTKVSTDWKAKIGTGKALTFPRGVAATGNTGVAGLVGKVPGAIGYVASEYAASFNTQSAWLKNAAGNFVQPTSESVTAVASVGDATGMITDSEVADAYPISCFTWVVLYKEQNYAGRSRSEAEETVKLLEWLISPEAQTITTQVQCSPLPEKAVEYAKNMLKEVTYDGKALRKLast
1 -107.0005i84_A mol:protein length:335 Phosphate-binding protein PstS  ali model follow..  30  1........MGSSSSGLVPRGSHMADVTGAGASFIYPVMSKWSADYNAATKKQVNYQSIGSGGGIAQIKAASVDFGSSDAPLKPEELAAA--GLAQFPSVIGGVVPVVNVPGAGTLKLDGKTLGDIFLGKVSTWNDPAIAALNPGVKLPEGKITVVHRSDGSGTSFNFTNYLSKVNPDWKGKVGEGTAVQWPTGIGGKGNEGVAAYVKQIKGGIGYVELSYALQNKMAYTAMKNAAGKFVQPSDETFAAAANSADWGLVMTNAAGDNAWPITATNFILVQKKPK----NPAGLKNTLEFFRWVYT-KGDAQAKQLDYVPLPDTLVTQIEAYWAKNL........ 328
2 -101.0001a40_A mol:protein length:321 PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR  ali model follow..  33  1......................EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQE--GLFQFPTVIGGVVLAVNIPGLGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYWYAKQNNLAYTKLISADGKPVSPTEENFANAAKGATFAQDLTNQKGEDAWPITSTTFILIHKDQK----KPEQGTEVLKFFDWAYK-TGAKQANDLDYASLPDSVVEQVRAAWKTNISSGKPLY. 321
3 -101.0005wnn_A mol:protein length:363 Phosphate-binding protein PstS  ali model follow..  32  14GSMKLMQTAFAGLAGALFAVAAHADITGAGSTFAMPIYTKWAADYQQSGGAKVNYQGIGSSGGLKQIVAKTVDFAGSDAPLKDDELAKE--GLFQFPTVVGGVVPVINVPGVKALTLSGAVLGDIYLGKIKKWNDPAIAALNPKVKLPDTDIAVVRRADGSGTSFIWTNYLSKVNDEWKSKVGEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKKNNMVYTALKNSTGTVVEPKTETFKAAAAGANWSKILTNQPGKEAWPVVGATFVLLHAKQD----KPAQGAETLKFFDWAFK-NGAKAADDLDYISLPASVETEIRKQWKVKVAAGKAVAE 357
4 -101.0002z22_X mol:protein length:321 Periplasmic phosphate-binding protein  ali model follow..  32  1......................EASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATE--GLFQFPTVIGGVVLAVNIPGIKSLTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWAQDLTNQKGDDVWPITSTTFILVHKEQK----NAANGTEVLKFFDWGYT-HGAKQANELDYATLPAEVVEQVRAAWKTQISSGKPIF. 321
5 -100.0001pc3_A mol:protein length:350 Phosphate-binding protein 1  ali model follow..  22  4PPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHEYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAA-HKGLMNIALAISAQQVNYNLPGSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTV-PGALGENGNGGMVTGCAETPGCVAYIGISFLDQAGLGEAQLGNSSGNFLLPDAQSIQAAAAGFNQAISMIDGPAPDGYPIINYEYAIVNNRQK----DAATAQTLQAFLHWAITDGNKSFLDQVHFQPLPPAVVKLSDALIATISS....... 350
6 -99.2004lvq_A mol:protein length:376 Phosphate-binding protein PstS 3  ali model follow..  25  31.....GGGATTGQASAKVDCGGKKTLKASGSTAQANAMTRFVNVFEQCPGQTLNYTANGSGAGISEFNGNQTDFGGSDVPLSKDEAAAAQRPAWNLPVVFGPIAVTYNLNSVSSLNLDGPTLAKIFNGSITQWNNPAIQALNRDFTLPGERIHVVFRSDESGTTDNFQRYLQAASNGAWGK-GAGKSFQGGVGEGARGNDGTSAAAKNTPGSITYNEWSFAQAQHLTMANIVTSAGDPVAITIDSVGQTIAGATISGVFYRPKRPGSYPIVLATYEIVCSKYP----DSQVGTAVKAFLQSTIG-AGQSGLGDNGYIPIPDEFKSRLSTAVNAIA........ 370
7 -89.6004f18_A mol:protein length:381 Putative alkaline phosphatase  ali model follow..  21  2........................DINGGGATLPQALYQTSGVLT----AGFAQYIGVGSGNGKAAFLNKNVHWAGSDSKLSATELSTYASKLIQVPSVGTSVAIPFNKSGSAAVDLSVQELCGVFSGRINTWDGISG-------SGRTGPIVVVYRSESSGTTELFTRFLNAKCNAETGNFAVTTTFGTAGAVAATGSQGVMTALAAGDGRITYMSPDFAAPTGLDDATKVARVGKNVATNTQGVSPAAANVSAAIGGVQPYPTSGYPILGFTNLIFSQCYA----DATQTTQVRDFFTKHYSNNNDAAITANAFVPLPTAWKATVRASFLTASNAGRPLLE 373
8 -87.1005jk4_A mol:protein length:373 Alkaline phosphatase  ali model follow..  21  1......................ETAVTGGGASLPADLYKGSADSI---LPANFSYAVTGSGTGKKAFLEGTVHFAGSDSVLSSTELNTYNSALVQIPSVATSVTIPFNKAG-SAVDLSVTQICGIFSGKINNWSQ-------LAGLGRTGAIQVVYRGESSGTSELLTRFLTSACQPADVSGTNLKLANGVPAAPATGGSALYNAVYAVDGRVGYVGPDVIPSLTTKVAKVKSFSPDEVSVQATLETAAPPTGAAAENPVFGNPSAGYPIAGYTNFVFGQCYK----NATVGANVRGFLTRHYGSPNDDAIRAHKFIPLTKAWRDAVRARFATATNAGRPL.. 373
9 -86.6005j1d_A mol:protein length:373 Phosphate binding protein  ali model follow..  19  1......................ATAVTGGGASLPADLYKGSADSI---LPANFSYAVTGSGTGKKAFLEGTVHFAGSDSVLSSTELNTYNGALVQIPSVATSVTIPFNKAG-SAVDLSVTQVCGIFSGKITSWSQ-------LAGLGRTGDIQVVYRGESSGTSELLTRFLTSACQPADVSSSNLKLTNGVPAAPATGGTALYNAVYAIDGRVGYVGPDAIPSLTDATK---VAKVKGFSPDEVSVQATLETAAPPTVPVFGNPSAGYPIAGYTNFVFGQCYK----NATVGANVRGFLTKHYGSPNDVAIRAHKFIPLTKAWRDAVRARFATATNAGRPL.. 373
10 -85.4004m1v_A mol:protein length:378 Phosphate-binding protein  ali model follow..  21  1.......................ADINGGGATLPQKLYQTPDVLT----AGFAPYIGVGSGKGKAAFLENNVHWAGSDSKLTATELSTYASKLIQVPSVATSVAIPFRKAGTNAVDLSVKELCGVFSGRITDWSGITG-------SGRSGPIQVVYRSESSGTTELFTRFLNAKCTTETGTFAVTTTFANSGAVAATGSQGVMTALNDTTVAEGRITYMSPDFAAPTLAGLDDATKEGKSPAAANVSAAISVVPTTGAGVVAYPDSGYPILGFTNLIFSQCYA----NATQTTQVRDFFTKHYSNNNDAAIEANAFVPLPSNWKAAIRASFLTASNAGRPQL. 378
11 -84.5002v3q_A mol:protein length:376 HUMAN PHOSPHATE BINDING PROTEIN  ali model follow..  20  1........................DINGGGATLPQKLYLTPDVLT----AGFAPYIGVGSGKGKITDTTKNVHWAGSDSKLTATELATYAAKLIQVPSVATSVAIPFRKAGANAVDLSVKELCGVFSGRIADWSGITGA-------GRSGPIQVVYRAESSGTTELFTRFLNAKCTTEPGTFAVTTTFANSGAVAATGSDGVMAALNDTTVAEGRITYISPKVARVGKGVVNGVAVEGKSPAAANVSAAISVVPLPAGGVVAYPDSGYPILGFTNLIFSQCYA----NATQTGQVRDFFTKHYSANNDAAIEANAFVPLPSNWKAAVRASFLTASNAGRP... 375
12 -62.0004n13_A mol:protein length:265 Phosphate ABC transporter, periplasmic phosphate-binding protein  ali model follow..  19  1............GAMGSKNQDNEKIVSIGGSTTVSPILDEMILRYDKNNNTKVTYDAQGSSVGINGLFNKIYKIAISSRDLTKEEIEQG---AKETVFAYDALIFITS-PEIKITNITEENLAKILNGEIQNWKQVG----------PDAKINFINRDSSSGSYSSIKDLLLNKIFK-----THEEAQFRQDGIVVKSNGEVIEKTSLTPHSIGYIGLGYAKNSIEKGLNILSVNS--TYPTKETIN-----------------SNKYTIKRNLIIVTNNKYED--------KSVTQFIDFMTSSTGQDIVEEQGFLGIKT...................... 265
13 -60.2004omb_A mol:protein length:347 Phosphate binding protein  ali model follow..  17  29GAASAVAAIDPALPEYQKASGVSGNLSSVGSDTLANLMTMWAEEYKRYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVELQAFEQKPTAVPVAVDALAIFVH-KDNPIKGLTMQQVDAIFSATVKTWGD-----LGLTGDWAKKPVQLFGRNSVSGTYGYFKEEALCKGD------------FRPNVNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTVALAKKEGAAFVEDNEQNAL-----------------NGTYPLSRFLYVYVNKAPNK-----PLDPLEAQFLKLVLSKTGQQVVVKDGYIPLPAKVAEKAIKELGLKLAAA..... 339
14 -59.8004ecf_A mol:protein length:264 ABC-type phosphate transport system, periplasmic component  ali model follow..  21  1....................GAGESITAVGSTALQPLVEAAGEQYTGHLGTFINVQGGGTGTGLSQIQEGAVQIGNSDLFAGEQKGIN-ARQLVDHRVAVVGITPIVN-KKVGVKNLSTNQLIKIFTGQITNWKEVG----------ADQSIVLINRAQGSGTRATFEQFGLANHRS-------------KTAQEQDSSGMVRSIVATTPGAISYVAFSYVNKT------VQALSLNHVAPTEVNVT-----------------TNDWRIWSYEHLYTKGHPT---------GLTKAFITYVQSPAIQNLVRQLGYLSPDQMLVERDANGHITKTGGA..... 264
15 -59.6004exl_A mol:protein length:265 Phosphate-binding protein pstS 1  ali model follow..  21  1....................DRGESITAVGSTALQPLVEVAADEFGTHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGID-ASALVDHKVAVAGLALIVN-KEVDVDNLTTEQLRQIFIGEVTNWKEVG----------KDLPISVINRAAGSGSRATFDTVIMEGQSA-------------MQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDS------VKSMKLNGYDLSPENIS-----------------SNNWPLWSYEHMYTLGQPN---------ELAAEFLNFVLSDETQEIVKGLKYIPIKEMKVEKDAAGTVTVLEGRQ.... 265
16 -58.0001twy_A mol:protein length:290 ABC transporter, periplasmic substrate-binding protein  ali model follow..  20  6.MALAAVCALLFSITTMTPFVQASEITISGSTSVARIMDVLAEKYNQHPETYVAVQGVGSTAGISLLKKGVADIAMTSRYLTESEAQN---TLHTFTLAFDGLAIVVN-QANPVTNLTREQLYGIYKGQITNWKQVG----------NDQKIAVVTREASSGTRYSFESLMGLTKTV----KDREVSDVAPTALVVNSNSMMKTLVNHNTQAVGFISIGSVDKS------VKAIQFEKADPTSDNIA-----------------KHTYQLSRPFLILHYSD--------NADEQTKEFIAFLKSESAKKLIVEYGYIMPSDV..................... 279
17 -56.4004gd5_A mol:protein length:279 Phosphate ABC transporter, phosphate-binding protein  ali model follow..  20  14GTIFIGATAMVGCNSGGSEAKSTNSVSISGSTSVGPVMEAEAEAFKTKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQA---GLKEVEIAYDGIALITH-KNNPVKDLTLVQIKDIYTGKITNWKELG----------NDAPIVVVSREDGSGTRDAFQEIVGFKAEELTVN-----------SQISDGSGNIKSLVQGNENAIGYISFSYVDDS------VSAVKVDGVEATPENVL-----------------NKSYKVSRPFLAVYKEE--------NLTESGKSFIDFILSEEGQDIVAKEHLIKV........................ 278
18 -55.3004q8r_A mol:protein length:252 Phosphate ABC transporter, phosphate-binding protein  ali model follow..  20  2.....................STNSVSISGSTSVGPVMEAEAEAFKTKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQA---GLKEVEIAYDGIALITH-KNNPVKDLTLVQIKDIYTGKITNWKELG----------NDAPIVVVSREDGSGTRDAFQEIVGFKAEELTVN-----------SQISDGSGNIKSLVQGNENAIGYISFSYVDDS------VSAVKVDGVEATPENVL-----------------NKSYKVSRPFLAVYKEE--------NLTESGKSFIDFILSEEGQDIVAKEHLIKV........................ 245
19 -54.3004jwo_A mol:protein length:341 Phosphate binding protein  ali model follow..  18  38AASTSEKTNSSTEGMNAATPSISGTIAVDGSSTVFPISQAVAEEFEGFPEVKLTVAMSGTGGGFKKFIAEEIDVTGASRPITEKEAAECKADYVEFQVAIDGLTVVINPANTFAECMTVAELNKIWASKVSKWSEV-------REGWPDEPIQLFGADTASGTFDYFTEVINGKAKSSRSDY-----------TANSNDNILVQGVVDSKGALGYFGYAYFAENASKLKAVKGKKAVCVEPTPATIE-----------------SGEYPLSRPLFIYTTKAK-------LKRPEVAEFIKFLLSEKGDQLVEEVKYIKVPKSVKETMQQRLAD.......... 338
20 -36.2003cvg_A mol:protein length:294 Putative metal binding protein  ali model follow..  11  1...MSLDPEDVYDGGYGSKHSPVQLRIGNGGAGQSGLVKELADAFIKSAPFKVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHGISESPSYYAFRDHFMLIGPPSNPAKLSGDSDIADMF-SKMHDAAEAGNT---------KPPVRFLSRYDKSATNIKEAELWLSIG-----------QVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTY-------------------LSIPRGLRDQMVIYKKGTNDADDPLLNPAHLLVGAR-------AKNAEMAKEFAKWLVSKEGQKVIEGFKYSPAPYR..................... 285
21 -28.8004h1x_A mol:protein length:265 Phosphate-binding protein pstS 2  ali model follow..  13  151..................SQHLSGKLSVVGSTSVSSLMEKLAEAYKKNPEVTIDITSNGSSAGITAVKEKTADIGMVSRELTPEEGK----SLTHDAIALDGIAVVVN-NDNKASQVSMAELADVFSGKLTTWDKIK.............................................................................................................................................................................................................. 265
22 -21.8003kn3_A mol:protein length:242 PUTATIVE PERIPLASMIC PROTEIN  ali model follow..  12  1.................SNAAAELRMATTTSTDNTGLLDVLAPAYKKDTGVDLKWVAVGTGNALKLGENCDVDVVFVHAPKVELEYVEKGFGIDRTPVMYNDFVII--GNPSFKQKFTGMSVAEAFKLIEKE------------------QVKFVSRGDKSGTHSKEREVWKEALGK------------------------------IPEKESWYIEAGQGMLATINIAEEQKGLTLTDRGTFIKYESNHKGKPPMVIVLEGDNTNFYSIMAV---------NPKRCEKADYKGAKQFIDWIVSEKMQAEIANFK............................ 241
23 -21.6005my5_A mol:protein length:274 ABC transporter periplasmic substrate-binding protein  ali model follow..  11  1..MAVDDDDKMLEVLFQGPEAPVLMMATTTSTDNTGLLDDLAPQFTKDTGIELRWTAVGTGKALKMGENCDVDILLVHAPAAEKAFVDAGFGTARTQLMYNDFVIIGPAADPAGVK-VAAALGKIAADNAV----------------------FVSRGDNSGTHKMEKSLWKQIEGPSPEK----------EAWYVQTGQGMLRTINVAAEKGGYTMTDRGTYIKYEASMDGNPPLKILVEGDKILFN------------------QYSAIPV---------NPAHCPKVKKDLADKFVNWMASPATQKTIGDFKFTPNAE...................... 268
24 -19.5003k6u_A mol:protein length:354 Solute-binding protein MA_0280  ali model follow..  13  15.LYFQGAMADNQPEPGNTSAGEGEVLTVFHAGSLSVPFEELEAEFEAHPGVDVQREAAGSAQSVRKITELKADVLASADYALIPSLMVPEYADWYAAFARNQMILAYTNESKYGDEINTDNWYEILRR-----PDVRYGFSNPNDDPAGYRSQMVTQLAESNDDMIYDDLMLANTGMTLTTEENGTALIHVPASERSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPA-------DLSSLEYADNYSKVQVEMVNGEVVTGSPIVYGVTIP---------NNAENSELATEFVALLLGETGQQIFIENGQPPIVPAIAEGKDSMPEELQ........ 344
25 -18.1003cfx_A mol:protein length:296 UPF0100 protein MA_0280  ali model follow..  12  1...................GHMGEVLTVFHAGSLSVPFEELEAEFAQHPGVDVQREAAGSAQSVRKITELKADVLASADYALIPSLMVPEYADWYAAFARNQMILAYTNESKYGDEINTDNWYEILRR-----PDVRYGFSNPNDDPAGYRSQMVTQLAESNDDMIYDDLMLANTGMTLTTEENGTALI-SKIMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPA-------DLSSLEYADNYSKVQVEMVNGEVVTGSPIVYGVTIP---------NNAENSELATEFVALLLGETGQQIFIENGQPPI........................ 296
26 -17.5002onk_E mol:protein length:314 Molybdate/tungstate binding protein  ali model follow..  11  1...................GHMNVKLKVFHAGSLTEPMKAFKRAFEEHPNVEVQTEAAGSAATIRKVTELKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKR-----PDVRFGFSNPNDD-PYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVL-SKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVE-------DLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIP---------KNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS..... 314
27 -16.8006DDN Entity 1(prereleased)  ali follow..  11  23QMGRGSEFGPSDVVGRAGPDRAHTSITLVAYAVPEPGWSAVIPAFNASRGVQVITSYGASADQSRGVADGKADLVNFSVEPDIARLVKAGADATKGIPFGSVVTFVVRAGNPK---------------NIRDWDD---------LLRPGIEVIT--LSSGSAKWNLLAPYAAKSDGGRNNQAGINTLVNEHVKLRPGSGREATDVFVQGSGDVL------------------------ISYENEAIATERAGKPVQHVTPPQTFKIENPLAVV-------------ATSTHLGAATAFRNFQYTVQAQKLWAQAGFRPVDPAVAADFADLFPVPA........ 311
28 -16.7003cg3_A mol:protein length:320 UPF0100 protein PH0151  ali model follow..  10  1...............GHMSESREARLIIFHAGSLSIPLSQVEEKFTKGVKVTFQDEASGSVKAVRKVTDLRADIVAVADYTLIPQLMIPNYTDFYVLFATNEIVIAFTNKSKYADEMLKNPDKWY---EILSRPDVSFGFSDPNQD-PYRSVMVMKLAERPIFKELVEKTTNIYSNGTRIYAPKEIIIKDKRVIMRPKETDLVGLVESGSLDYIFIYKSVAKQHHLSYITLPDD--NLGDFNKADFYGRVSITLGSTGKTIKAKPIVYGITVL-------------KNAPNRELAIEFLRFLLGNEGRKIFEDNYQEFVPPEIRRLVEVK............. 320
29 -16.4005um2_A mol:protein length:334 ABC transporter sulfate binding protein  ali model follow..  1.......MGSSSSGLVPRGSHREIGLLNVSYDPTREFYRDYNAAFAAQDTVTVETSHGGSGKQARAVIDGEADVVTLALAYDVDAIAQKAK---NSAPYTSTIVFLVRKGNPK---------------NIHDWPD---------LLRSGVAVVT--KTSGGARWNYLAAWAYADHIFKGDRERIQALFRNVPVLDTGARGATTTFVQRGIGDVLLA---WENEALLAREELGKDKFEIVVPKLSILAEP-------------------SVALVD---------KNVDKHGTREVAEAYLRYLYAPEGQKLAAKHFYRPRHPEFADP................. 286
30 -16.4003cg1_A mol:protein length:296 UPF0100 protein PF0080  ali model follow..  13  1...................GHMEVTLIVFHAGSLSVPFQEVEKEFSEGIKVSFQDEASGSVMAVRKVTDLKADVIGVADYTLIPQLLIPNYTDFYVLFATNEIVIAFTDKSRYVEEMKSNPDKWY---EILAREDVRFGFSDPNQD-PYRSLMVIKLADKEIFKELIEENTNIYSNGTQIYAPKEITVNPGKIVIRPKETDLLGLVESGSIDYIFIYKSVAKQHNLSYITLPSE--NLGDFSKEKFYGQISITLGSTGKTIKAKPIVYGVTVL-------------KDAPNREVAIEFLRYLLSENGKRIFEKNHQDFL........................ 296
31 -15.2003cfz_A mol:protein length:292 UPF0100 protein MJ1186  ali model follow..  1...................GHMKIVLKIFHAGSLSVPFEEYEKMFEKHPNVDVEREPAGSVACVRKIIDKKADILASADYSLIPQMMMPKYADWYVMFARNEIVLAYTDKSKYKDEINSTNWYKILQR-----PDVKIGFSNPNDD-PYRTQMVLQLAELYYKDPTIYDNLVLKHSNIKVEENNGTDVDTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKE--NLGYYEYADTYKKVALKIIAKNKTINAKPIVYGMTVP-------------TNAPHKKEAIEFVKFVLG--HPEVLENNGQPAI........................ 292
32 -14.9003fir_A mol:protein length:251 Major antigenic peptide PEB3  ali model follow..  13  1....MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVKPLYFREAIILTQKGNPL---------------KIKGLKD-----------LANKKVRIVVP-EGAGESNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVY---------------------------RTFNVIA-------------KEGASKETQDFIAYLSSKEAKEIFKKYGWRE......................... 250
33 -14.8003muq_A mol:protein length:237 uncharacterized conserved protein  ali model follow..  1.................SNAAEHVRLATTTSTYHSGLLDYLLPQFEKDTGYKVDVIAAGTGKALKMGENGDVDLVMTHAPKAEGTFVEKGYGVLPRKLMYNDFVIV-DPAKIKDDESVLDVFKEIANKNAT----------------------FISRGDDSGTHKKEMGFWAQTK----------EPNFGGYRSVGQGMGPTLNMASEMQGYTMSDRGTWLAYQNKLDLEILFQGDEKLFNPYQVILVNPERY----------------------------------PTINYQGAKAFSDWLVNPRGQELINGFR............................ 236
34 -14.8001sbp_A mol:protein length:310 SULFATE-BINDING PROTEIN  ali model follow..  10  1.....................KDIQLLNVSYDPTRELYEQYNKAFSAHDNVVIDQSHGGSGKQATSVINGEADTVTLALAYDVNAIAERG-------PYTSTIVFLVRKGNPK---------------QIHDWND---------LIKPGVSVIT--KSSGGARWNYLAAWGYALHHNNNDQAKAKALFKNVEVLDSGARGSTNTFVERGIGDVLIA---WENEALLATNELGKDKFEIVTPSESILAEP-------------------TVSVVDKVV---------EKKDTKAVAEAYLKYLYSPEGQEIAAKNFYRPRDADVAKKYDDAFPKLK........ 279
35 -14.7005t1p_A mol:protein length:348 ABC transporter, periplasmic substrate-binding protein  ali model follow..  11LVALLFSNSQAIDENLIKAAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKNASGDIGDVGQPFKTSYWDQIPTWAKDLLAYTGTIAFIVN--------------KDVVKDIPKTWQDLLKGNYKITVGDVS--------VAAQAVSAVLAANYALGGDEKDLSPALAFFNTLAKQGRLVNNDVSIANLEKGEVEVGLVWDFNGKVGKDRYEVLIPADGSVISGYTTIINK---------------------------------------YAKHPNAAKLAREFILSDKGQINLAKGYARPIRIDHIT.................. 301
36 -14.2003lr1_A mol:protein length:236 Tungstate ABC transporter, periplasmic tungstate-binding protein  ali model follow..  13  1.................SNAEERLKMSTTTSTQDSGLLKVLLPPFEKKNNVKVDVIAVGTGQALKLGEAGDVDVVFVHARKLEDKFVADGFGVNRKDVMYNDFVIV-DPAGIAKAKTAAEALKLLATKGAT----------------------FISRGDKSGTH--------------------------------TKELDLWKSAGVDPKGNWYVEAGQGMGPVITMATERRAYTLTDRGTYNAFKGAKTDLVILFQ--EKGLFNPYGIMAV---------NPKKFPHVKYDLAMKLIDYVTGPEGLKIISD.............................. 235
37 -13.2002qry_A mol:protein length:330 Thiamine-binding periplasmic protein  ali model follow..  10  1....MGSSSSGLVPRGSHMKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNDAASKTGLFAVPFDYGYFAFVYDKNKLKNPPQSLKELVE-QNWRV--------IYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTV-----------------TKGWSEAYGLFLKGESDLVLSAYHILEEKKDNYAAANFSEGHYLQVEVAARTA---------------------------------------ASKQPELAQKFLQFMVSPAFQNAIPTGNWYPVANVTL................... 286
38 -13.1003c9h_A mol:protein length:355 ABC transporter, substrate binding protein  ali model follow..  14  11LCMASPALAQVAVFPALSGKTDAQTLV---SSLDEPLATPMIEGFQKAPDIAVHYEDMLTGEIYDRIVKETADFAFSSAMDLQVKLSNDGAMSARWPLTFEPAVFVYHKPSFTTEKPTRAEFVDYLERHAKEVHG-RIATYDI---------------ERSGVGFLFMSRDQEQFGDIWSVI---KAMGAAGVKVYSTSSAILERVSDGRFVLGYNILGSYASRHPDVGIVLPKDYTVVMSRIGLVPE---------------------------------------AAANPELGRRYLEFFMSKEGQTIMARQLQIP......................... 300
39 -12.6002hxw_A mol:protein length:237 Major antigenic peptide PEB3  ali model follow..  15  2........................DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDAILFGASDQSALAIASDFGKDFNVSKPLYFREAIILTQKGNPL---------------KIKGLKD-----------LANKKVRIVVP-EGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKE----------------------------------------GASKETQDFIAYLSSKEAKEIFKKYGW........................... 229
40 -12.3004r6y_A mol:protein length:318 Putative 2-aminoethylphosphonate-binding periplasmic protein  ali model follow..  12  1..................SMESVVTVYSIDGDGDNSWYQVQFDAFTKATGITVRYVEGGGGVVVERLANPQADVLVTAANFNTDTASAIPDNNLYSPLVKNYLSFIYN--------------SKLLKTAPASWQDLLDGKFKNKLQYST--------PGQAADGTAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLAQMERNPNV-----KIFWPANDKGERSA--------------------------LAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSELSWVTPSDEHYKAATAALEGVQ........ 291
41 -12.2001y4t_A mol:protein length:322 putative iron-uptake ABC transport system periplasmic iron-binding protein  ali model follow..  13  8..............................SARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEPADIFITASPVSSKYLEEFDKDKEWFAITKRARIIAYNKNTNIDISKMKDLAKAEFKGEI-----------------------VMRSATAPYSKTLLASIIANDGNKEAKAWAKGVLEN--ATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLG--------------------------IFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYFPIRNDV.................... 279
42 -12.0004r72_A mol:protein length:321 ABC-type Fe3+ transport system, periplasmic component  ali model follow..  13  1....................GSKGRLV---CSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIENPQADVWYGGEAYRSPNIDQIMPKFQDSAVYIGILGFAVNTERLKKLGIEKI----------QCWNDLTDPKLKGEIQIAD--------PQSSGTAYTAIATFAQLWGEDKA-----KHLHPNISQYTKSGITPARNAARGETTVGIGDYALEKEQGAPLEMVVPCEGTGYELGGVSILK---------------------------------------GARNLDNAKLFVDFALSKEGQETAWKKGQLQTLTNTTAEQSPLAFDLT........ 288
43 -11.8004edp_A mol:protein length:351 ABC transporter, substrate-binding protein  ali model follow..  14TGLVLGTSLVGCGKTEGAEAGKKLVVSTWGLNEDV-LKETVFEPFAKEHGVEIVLDIGNNSERLTKMKNNQIDITYLADKLDYSKIPNASEAGYGPAYTLNSIGIVVDPSAGI---------------EINSWEDLWKPELKNKIAIPDITVEIAAEKAGVDVKTDNGEAAFKELEALKPNVVK------------SKSSDLANMFSNGEIVAAVAAFGTISKAKPEVINVIPESGTYLNFNTININK---------------------------------------NSKNKDLAYEFINYALSKEVQETAKALNESPVNKEVK................... 309
44 -11.7004elo_A mol:protein length:336 Iron ABC transporter, periplasmic iron-binding protein  ali model follow..  10  1..MMKRYLLTLAAFAALGALAQSPTLT---SGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEANTAGALGQASAKGLLRPLGETLLEKPVTVRLRVLAYNPDRIKAEELP------------ESLLD-------PRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTR----LAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLG----------------------------------HHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQFVGNIGEYPLVKGV.................... 291
45 -11.7004jb7_A mol:protein length:256 Accessory colonization factor AcfC  ali model follow..  12  1......MSSGVDLGTENLYFQSNADVNLYGPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAKKNADILFGASEHSALAIAEGHSERFSK-PVFMREAIILVKKGNPK---------------NIKGMAD---------LLKPGIGIVV---NDGAGVSNTSGTAVWEDSVGRMKNVEKLQAFRSNIHVFAPNSGSARKAFVDGEDIITWVDWAIANPTIGDMVRMED---------------------------EYRIYRDFNVVL---------------AKNPSSEAIDFFDYLTSKDAEAIFQHYGWF.......................... 249
46 -11.3001d9y_A mol:protein length:309 PROTEIN (PERIPLASMIC IRON-BINDING PROTEIN)  ali model follow..  10  6..............................NGQHKEAAQAVADAFTRATGIKVKLNCAKGDQLAGQIKEEPADVFYSEEPLPASTINETRGKGVPVALSGRSRVVVYDTRKLSEKDLE------------KSVLN---------YATPKWKNRIGYVPTSGAFLEQIVAIVKLKGEAAALKWLKG-----EYGKPYAKNSVALQAVENGEIDAALINNYYW----HAFAREKGVQNVHTR--------------------------NFVRHRDPGALVTYSGAAVLKSSQNKDEAKKFVAFLAGKEGQRALTAVRAYPLNPHVSTFNLEPIAKLE........ 284
47 -11.3002pt1_A mol:protein length:334 Iron transport protein  ali model follow..  12  2......HMGQSPDAPIADTPGEQQEIN---SSRHYNTDNELYAKFTAETGIKVNLIEGKADELLERIKNSPADVLLTVQPVQSEILETNVPEYLRFGFTKRARVIMYNKGKVKPEELSTELADPKWKGRV--------IIRSSSNEYNQSLVASLVVADGEESTLAWAKGFVSNFAR----------------EPQGNDTAQIEAVSSGEADLTLANTYYMGRLLESEDPAQKAIAENVG--------------------------FFPNQEGRGTHVNVSGVGVVKTAPNREGAVKFIEFLVSEPAQAFLAQNNYYPVLAGV.................... 295
48 -11.3003pu5_A mol:protein length:333 extracellular solute-binding protein  ali model follow..  12  2.................SLADDHIYVTSSGGSFLENVRKHMAEPFEKQSGVKVTLVPGTNPAHALKILTPPYDVAAFGAQVDEKSVPSLADEGCGSLYDYSSVGIAYR--------------PDKIQGGVKSWKEFVERTVAGEFGKQVFFNNLSSNVRGAEVLSMFGKIYGSGYGDIEASIATLERMKPHIFKFFTAFNDPVVLLTSGEGAIGPG-FIAEDSTKGMVKWVDPTEGAVSSGPVMAVVKG----------------------------------------GKEDLAKAFMNYALGEEAQKFCEAMYYGAYSEKLKHRLPSIDSVQLVDTALLIK 310
49 -11.2001xvx_A mol:protein length:312 YfuA  ali model follow..  11  11..............................NAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVASPADVFLTEAPLDAVTQAQVAQEYRPTGIAARSTVFVYNPEKISEAELP------------KSIMD---------LAKPEWKGRWAASPSGADFQAIVSAMLELKGEKATLEWLKAMK---TNFTAYKGNSTVMKAVNAGQIDGGVIYHYYR----FVDQAKTGENSGKTQ--------------------------HYFKHQDPGAFVSISGGGVLASSKHPKEAQEFVKWITGKSGQDILRTNNAFEYAVGVDAASNPKLVPLK........ 285
50 -11.1001y9u_A mol:protein length:323 putative iron binding protein  ali model follow..  13  1..................GSHMSDEVS---TTREPKLIQPLLDAFAKDSGIKVNTVFVKD--GLLERVRAEGDKSPADQKIQSQTLDSVGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKV--------CIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLAR----------------KAAGGDRDVARDILGGICDIGLANAYYVGHMKNA------------EPGTDARKWGDAIKVVRPTFATAKDGGTHVNISGAAVA---------AHAPNKANAVKLLEYLVSEPAQTLYAQANYYPVRAGV.................... 283
51 -10.9006g7n_A mol:protein length:318 Extracellular solute-binding protein, family 1  ali model follow..  12  7..............................SSRHYDTDQALYDSFTKKTGLKVNLIEGKGDKLIERIK--------SEGANSPADVFMTVDAGRLWRAQEAGILQPISSSTLN------NKIPANLRSPEKLWNKNKVQPSELDLAQNKWKGKIVIRSSSNIYNQSLIASLIEIHGMSDAEGWAKGFVRNFARPPEGNDTAQIKAVAAGIGDIGLANSYYLARLKRSSKPEDQAVADKVG--------------------------FFPNQNGRGTHVNISGGGVVKNAPNKEGAIKFLEYLVSPEAQKIFSEGNNYPVVAGVIASVLKPFGSFK........ 290
52 -10.9001xvy_A mol:protein length:309 sfuA  ali model follow..  11  8..............................NAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVASPADVFLTEAPLDAATLAQVEPQYRPIGIAARSTVFVYNPAKLSDAQLP------------KSLLD---------LAKPEWKGRWAASPSGADFQAIVSALLELKGEKATLAWLKAMK---TNFTAYKGNSTVMKAVNAGQVDSGVIYHYYP----FVDGAKTGENSNNIK--------------------------YYFKHQDPGAFVSISGGGVLASSKHQQQAQAFIKWITGKQGQEILRTNNAFEYAVGVGAASNPKLVPLK........ 282
53 -10.9001d9v_A mol:protein length:309 PROTEIN (iron-utilization periplasmic protein)  ali model follow..  10  6..............................NGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEPADVFYTEAPISEQTIQQTAQKGVPIALSGRSRVVVYDHTKLSEKDME------------KSVLD---------YATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKG-----ENGKLYAKNSVALQAVENGEVPAALINNYYWYNKSRLYFVRHQDPGALVSYSGAAVLK---------------------------------------ASKNQAEAQKFVDFLASKKGQEALVAARAYPLRADVSPFNLEPYEKLE........ 284
54 -10.4001q35_A mol:protein length:320 iron binding protein FbpA  ali model follow..  12  8..............................SYRQPYLIEPMLKNFEKDTGIKVNIIFADK--GLVDRVKQEGELSPADQKIDSKVLEKNDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDLAKPEYKGKV-----------------------CVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKAN--ARKPQGGDRDQVKAIKEGICDYSIGNSYYYWAEAAIINFPSGEHGTHKNISGVVIAK---------------------------------------HSPNKANAVKLIEYLSGEKAQGLYAELNHYPVKEGIYEAALKLVDEVKFDDFSEKK 320
55 -10.3004xxu_A mol:protein length:257 Molybdate-binding periplasmic protein  ali model follow..  11  5.WLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGA---------------------------------------------------ADLFISADQKWMDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAE----VRGALALVERNEAPLGIVYGSDAVASKGVK------VVATFPEDSHKKVEYPVAVV----------EGHNNATVKAFYDYLKGPQAAEIFKRYGFT.......................... 255
56 -10.1002voz_A mol:protein length:346 PERIPLASMIC IRON-BINDING PROTEIN  ali model follow..  11FVGGTALTALVVANLPRRASAQSRTIN---SSRHYNTDDALYDAFGEVNLIE------ASAEELIERIQSEGANSPGDQPVRSGKLNERHPDGLWYGFTQRARVLYYSRD-------------RVNPADLSTYEA---------LADPQWRGKILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLFFPNTGSGERGT-----------------------HVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNYPVIPGV.................... 307
57 -9.8805ci5_A mol:protein length:415 Extracellular solute-binding protein family 1  ali model follow..  14  1.......MSSGVDLGTENLYFQSKTLTGGQVAELDETWNSVIKTFEEKYGISVEVQLFGFDTYYDKLVTALQAGKGPDEPMEE-PTVTYKKIRYGLPWYTDCRLLLYNKAMFEKAGLNPDN---------KTWDELLDAALKITDTKNRIYGYGVSGTKTEHTTLGYMMFLYAAGGKLLTDDYSKAAFDSPEGLK----------------ALKFY-TDLAKKYNVSPNAIQYHEDDYRNMMAQNRVAMAIGGPWSFPLIEAANPDLHPYDAKPASVLGGWALVIPSSSPNKEDAWKLAEYLTSFDVWMKWVEEKGGPMPTRMDVCKKSKLAN.......... 347
58 -9.7203axf_A mol:protein length:237 Molybdate-binding periplasmic protein  ali model follow..  11  1.................GSHMDEGKITVFAACSLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGA---------------------------------------------------ADLFISADQKWVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAE----VCGALALVERNEAPLGIVYGSDAVASKGVK------VVATFPEDSHKKVEYPVAVV----------EGHNNATVKAFYDYLKGPQAAEIFKRYGFT.......................... 235
59 -9.6702h5y_A mol:protein length:254 Molybdate-binding periplasmic protein  ali model follow..  13  1.......MGSSSSGLVPRGSHQTAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGA---------------------------------------------------ADVFLSADLEWMDHGLVLPAQRHNLLGNTLVLVAPASSKLRVDPRAPGAIAKALGENGRLAVGQTASVPAGKYAAAALRKLGQWDSVSNRLAESE----VRAALMLVSRGEAPLGIVYGSDARADAKVR------VVATFPDDSHDAIVYPVAAL----------KNSNNPATAAFVSWLGSKPAKAIFARRGF........................... 244
60 -9.2804rxl_A mol:protein length:234 Molybdenum ABC transporter, periplasmic molybdenum-binding protein  ali model follow..  11  1....................SMKETLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGSSSLARQIEAGA---------------------------------------------------ADLFISANEEWVEKGLVKPNKVVTLAANSLVLIRPTAQPVASFELQDAAAWQTALADSRLAVAQVDAVPAGMYAKQALQHAGVWPELESRLAQTN----VRLALALVERGESPLGIVYKTDALLSDKVT------IVTAFSAQSHQPIRYPLAQL------------NDKAASAEWVAYLRSDAAQQILQRFGFESVSE...................... 234
61 -9.2004eq7_A mol:protein length:320 ABC transporter, substrate binding protein (Polyamine)  ali model follow..  14  4........................VFSSWGGTTQDAQKAAWAEKFMVETGINVLQDGPTDYGKLKMVEANGVTWDVVDSVIDKTKLDPRFVTDYSVGSFYYSFVIGCN--------------VDSVSACPKSWADLFDTAKFPGKRTAPGVIEAALLADGVTADKLYPLDLDRAFKKLDT----------SDIIWWSGGAQSQQLIASAEAPFGSV------------------NGRMTALEQSGVKVETSWAQ--------------NITAADSLVVPK-------GTKNKDAAMKFIALATSAQAQDMATATGYAPVNIESAKLMDPKIAK.......... 279
62 -9.1602xd2_A mol:protein length:416 MALTOSE/MALTODEXTRIN-BINDING PROTEIN  ali model follow..  11  6SGLVPRGSHMASDKPADSGSSEVKELTVYVDEGYKSYIEEVAKAYEKEAGVKVTLKTGDALGGLDKLSLDNQNGNVPDVDTTKSLVTAANGKVYGAPAVIESLVMYYN--------------KDLVKDAPKTFADLENLAKDSKYAFAGEDGKTTAFLADWTNFYYTYGLLAGNGAYVFGQNGKDAK---DIGLANDGSIVGINYAKSWYEKWPKGMQDTEGAGNLIQTQFQEGKTAAI--KAQAFKDAKVNYGVATIPTLPNGKEYAAFGGGKAWVIPQA-------VKNLEASQKFVDFLVATEQQKLYDKTNEIPANTEARS.................. 339
63 -9.1505z49_B mol:protein length:239 HTH-type transcriptional activator CmpR  ali model follow..  12  2.....................GMGQLRLAVITTAKYFIPRLIGPFCQRPGINVSLKVTNHEGLINRINDNLDDLYVLSRPPSGFDITVQ-------PFLDNPLVVVGSHPLANQRGISLERLAQ----------------------------PFILRERGSGTREATEQLFAAHN------------LNLNVKLDLGSNEAIKQAILGGLG-LAVL-------------------------SYHTLTSAGATPELKMFEVE-----GFPIHRQWHAVYPA-------GKQLSTVAATFLDYLLTESQR................................... 207
64 -9.1401atg_A mol:protein length:231 PERIPLASMIC MOLYBDATE-BINDING PROTEIN  ali model follow..  14  1........................ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGK----------VLAGNGWRHIAISNPQIA-P------------YGLAG--TQVLTHLG---------DKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIP---------------------------GSHWFPPANYYEPIVQQAVIT---------KSTAEKANAEQFMSWMKGPKAVAIIKAAGYV.......................... 228
65 -9.0905ysb_A mol:protein length:397 Lin1841 protein  ali model follow..  10  2...............DDANSSDSKVLNVWAMGDEAKSLKELAQKFTKDTGIEVKFVEAGALLDITKDVEKSKNMNSDLFFPGSVKTTQFDGKTYGVPWYAETRVLFYRTDLLKKVGYNEA----------KTWDE-----SDAALKLSKRGKDMYGFAIDPNEQTTGFIFGRQNGSPLFDKDGTPVFNKKPFVDTVTYLDSFIKNGSAPDTDLGLDASQSFGGDGIVPMFM---SGPWMVNTLKDTAPDIDGK----------ATAVLPKKENNESSLGGANLSIFKYSNKKDDALKFMDYMSQPDVQSWLKDTNSMPARMDAWE.................. 322
66 -9.0605Z6B Entity 1(prereleased)  ali follow..  10SLVCVFLFSGCSAGEEASGKKEDVTLRIAGGQPRHDYTTKVIELYEKNPHVHIEAEFANWDDYWKKL---APMSAAGQLPTKDGTIDKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQ----------TWEDYEKLAYD------QEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKE---------------DGTGLAYQDDQLFVDYFERQLRLVKAKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPALTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGE-VPVSDKVADAIKPKLNEEETNIVEYVE 370
67 -9.0305y2w_A mol:protein length:234 Rubisco operon transcriptional regulator  ali model follow..  14  2....................GKQGRLRLAVITTAKYFIPRLLGEFIQKPGIEVSLKVTNHEQIRHRMQNNEDDLYIVSEPPEEIDLNYQ-------PFLDNPLVVIADHPLAGKSNIPITALND----------------------------AFIMREKGSGTRLAVQNLFHRHYVDVR------------VRLELGSNEAIKQAIAGGMG-ISVL-------------------------SQHTLVSEGARSELTILDID-----EFPIKRRWYVANLA-------GKQLSVITQTFLDYLMAVTKNMPAPFAEQLTTQQTPVKLVL............... 228
68 -9.0205l9g_A mol:protein length:351 periplasmic binding protein  ali model follow..  11  1.......MGSSSSGLVPRGSHMDVVIASSGGGWQEAQDKALWAPAAKALNITYTQDTFQNWAEARAQVESTWDIIQIGDIVNKADFPPGSVTDSFVANSNYSTLIAWNKKTYGD-------------NGPKSMADFFDVKKFPGWNQPIGMIEAAALALGTPRDKVYE--FLSTEEGRKAAIAKLTELAPSVSVWWESGAQAAQLIKDGEVDMIITWGGRVQGAINDGANFA--NDAQLGTDGYAIVK---------------------------------------GAPHRDAAMRFLKEMSKAEYQDLPNSFATAPANMKAYDLAKYTPEKMA........ 301

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.