|
current user: public |
|
Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . | |||||||
# | Score | Template | Links and tools | %id | First | MEKENTNGGSVYVTVDGHFKPVHVSMKGTGEKGFLEFMLEDVEKALKETEMPVIGMMYYNVPDMGIVPHLWEGNNDDYLQRLEKAMDGHGIKLHRYLRLSEVVYCL | Last |
1 | -7.920 | 2vt1_B mol:protein length:93 SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS | ali model follow.. | 16 | 1 | ...................................................PTHIAIGIYFPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLY.. | 54 |
2 | -7.680 | 3c01_E mol:protein length:98 Surface presentation of antigens protein spaS | ali model follow.. | 9 | 1 | ...................................................PTHITIGIYFPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLARSLF.. | 54 |
3 | -7.600 | 5cul_A mol:protein length:126 Translocation protein in type III secretion | ali model follow.. | 10 | 18 | .....................IKSKRRQFHQELQSSNLRADVRRSSVIVANPTHVAIGIRYRGETPLPLVTLKHTDALALRVRRIAEEEGIPVLQRIPLARALL.. | 101 |
4 | -7.340 | 3bzy_B mol:protein length:83 EscU | ali model follow.. | 13 | 1 | ...................................................PTHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLD.. | 54 |
5 | -7.330 | 3bzv_B mol:protein length:83 EscU | ali model follow.. | 15 | 1 | ...................................................PAHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLY.. | 54 |
6 | -7.320 | 3bzz_B mol:protein length:83 EscU | ali model follow.. | 15 | 1 | ...................................................PTHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLATSLY.. | 54 |
7 | -7.290 | 3bzx_B mol:protein length:83 EscU | ali model follow.. | 15 | 1 | ...................................................PTAIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLY.. | 54 |
8 | -7.280 | 3t7y_A mol:protein length:97 Yop proteins translocation protein U | ali model follow.. | 11 | 2 | .....................................TSSQIKHASAVVSAPKDIAVAIGYPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVPLAHQLL.. | 69 |
9 | -6.800 | 5vit_C mol:protein length:99 MdcC | ali model follow.. | 12 | 24 | ......GSGDLEVLLEPGQPGKLSIQVQTSVNGSASRWQHLFERLFDGQTPPA---LLIDIHDFGATPGVVRLRLEQGFEEI........................ | 96 |
10 | -6.710 | 3bzp_A mol:protein length:137 EscU | ali model follow.. | 10 | 25 | .....................IKGERRRLHSEIQSGSLANNIKKSTVIVKAPTHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLY.. | 108 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10. |