current user: public

If you have questions about the server, please let us know.

Query: gi|29345430|ref|NP_808933.1| hypothetical protein BT_0020 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MDPLSRDENYIQRLTPEMWREIKAASPEVTAEMLDDLKHGNTYYTGVETDKGVLIFSRDIIGEGQFSDYMYKYIENDFFASEFVLKSLAVHELRGWPSLMEGKLNRCHNRFGWWGDGETIRRAFQDRSVLKNVTDSETYDFTPPPHGRTITGLast
1 -6.7805mrw_C mol:protein length:187 Potassium-transporting ATPase KdpC subunit  ali model follow..  10  19...........................................YPLLTTVLGQWWFPWQANGSLIREG--QNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAA--VPVELVTASASGLDNNITPQAAAWQI.. 138
2 -6.6101fvp_A mol:protein length:231 FLAVOPROTEIN 390  ali model follow..  10  101..................................EERLKLLSFYNASASKYNVNVNEAETVAKEELKLYIENYVACT--NFNGSIDSIIQSNVTGSYKDCLSYVANLAGKFDNTVDFLLCFESMQDQNKKKSVMIDLNNQVIKFRQDNNLI. 231
3 -6.6003aag_A mol:protein length:291 General glycosylation pathway protein  ali model follow..  249....................................................FILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLK.......................................................... 290
4 -6.5605fiq_A mol:protein length:243 EXD1  ali model follow..  10  48...............................DGANMGRKCKMPFLVLSTDHQIYIFDIQVMQYHAFESGLKKILEGDAHDCRKLSDCLSVFDTQVGDLIITKNKKVTLPNKVKSLGECLTNYLGLQQNTIDEKLDIVQSTERPLSVKI.... 178
5 -6.5204hz0_A mol:protein length:213 DNA topoisomerase 4 subunit B  ali model follow..  10  14...MYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNK-GLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSP. 166
6 -6.5001ukf_A mol:protein length:188 Avirulence protein AVRPPH3  ali model follow..  111....................HDVAQSGRKHLLSLRFANVQGHAI-ACSCEGSQFKLFDPNLGESAAPQLIKGLI-DHYNSLNYDVACVNEFRVS.......................................................... 187
7 -6.2303tg9_A mol:protein length:356 Penicillin-binding protein  ali model follow..  11  3MKNHLHTIMEDWALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKAIAICQLVEAGKLSFDTPLSDWLDAPF-------PNVTIHHLLTHTSGVPDYFDEEITDDFEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPNNAGFILLG 161
8 -6.0104j2p_A mol:protein length:236 Non-fluorescent flavoprotein  ali model follow..  101..................................QKRIELLNHYQAAAAKFNVNVNDNPTQAKAELSIYLEDYLSYT--QAETSIDEIINSNAAGNFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHNL.. 227
9 -5.8604y7p_A mol:protein length:388 Alkaline D-peptidase  ali model follow..  57VRDTLQLGFPGILAKTSEGGKTWSYAAGVANLSSKKPMKTDFRFRIGSVTKATVVLQLAEENRLNLDDSIEKWLPGVIQGNGYDDKQITIRQLLNHTSGIAEYTR------SKSFDLMDTKKSYRAEELVKMGI-SMPPDFAPSNTGYVLLG 210
10 -5.8205bxy_A mol:protein length:158 RNA methyltransferase  ali model follow..  14.......DRMLELADVDETDVLYDLGSGDGRIVIRAARTHGARGVGIEIDPDLVKKARKNAKEAGVADLVEFRQGDLFEADISEATVVTLYLLPSVNQKLRPILFEQLSPGTPVVSHDFDMGRWAPDRTVDLEGDTVYRWTIP......... 149

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.