current user: public

If you have questions about the server, please let us know.

Query: gi|29345419|ref|NP_808922.1|(removed signal:1-26) phosphate-binding periplasmic protein precursor, putative ABC transporter BT_0009 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# E-value Template Links and tools%idFirst AATLFTSGKPVEELSENAAVGRKSVITAAGATLPLPFYSEAFKMYWEKNDIPVTYAGIGTERGFRSLKNQQIDFAGVDVPPTKAELDSLPVKSILVPTCMGAVTIAYNLEGVDNLRLTGELIADIYMGKILKWNDARIAAVNAGKQLPDKEIYPVFRLDGSGTTYIFSDYLTKVSTDWKAKIGTGKALTFPRGVAATGNTGVAGLVGKVPGAIGYVASEYAASFNTQSAWLKNAAGNFVQPTSESVTAVASVGDATGMITDSEVADAYPISCFTWVVLYKEQNYAGRSRSEAEETVKLLEWLISPEAQTITTQVQCSPLPEKAVEYAKNMLKEVTYDGKALRKLast
1 0.000e+00UniRef50_F1YV27 Phosphate-binding protein PstS n=23 Tax=Acetobacteraceae TaxID=433 RepID=F1YV27_9PROT  ali  29  29....................SHAQSVTGAGSSFAAPIYEAWASAAKADTGVNVNYQTVGSSAGQNQILAGTVDFGASDAPMDAKKLESAH--LFQFPTVMGGIVPVVNIPGIDVLVLSGDVLAAIYSGDITTWNDPKIAALNPGVSLPDTAVAPIHRADGSGTTFVFTSYLDQSSKNWHDQYGAGTSISWPGGLGARGNDGVAATVQNTEGGVGYVEYAYASRNHLTTIRLKNSSGQAVAASQASFSQAAEAADWSVNLLNTSGAQAWPIVSATYVLVP----LPARNPARDEAVKRFFIWDF-AKGDSIAAKLDYVPLPKTVKDSIQSAWQAGK........ 344
2 0.000e+00UniRef50_A0A1E3GD59 Phosphate-binding protein PstS n=1 Tax=Piscirickettsia litoralis TaxID=1891921 RepID=A0A1E3GD59_9GAMM  ali  29  4.LIAVPASIALVCGLAGSAFAAGEAVTGAGSTFIYPALAKWAAAYKDKTGHKINYQAIGSGGGLRQLAKGTVDFAASDKPLTATELK--EKGYMQFPAIVGGIVMSYNLPSVKKLVLNGQTVADIYQGKIKYWDNAAVQKLNPGVSLPHKYITTVHRADGSGTTFNFTYYLSKVSKSWNKEVSYNTVVAWPGGVGGKGNAGVANYIKQIPGAIGYVEYAYAKETHMPAAKMVNASGHVVEADMETFKAAAKNAKWQAILANAPGEKSWPIAASTFVLVHKD-----ESAKKVDEVLKFFHWSY-HHGQKMAEKLDYVPIPKPVYQLIGQEWA........... 334
3 0.000e+00UniRef50_A0A2A4N7U7 Phosphate-binding protein n=7 Tax=Bacteria TaxID=2 RepID=A0A2A4N7U7_9BACT  ali  48  10AVIAVALMAGCGGSGKEKSTKKAKAITGAGATFPQPFYNKIFKNYTSEQGLLVTYGGIGSGGGIRSLKDKIVDFGASDAFLSDKKLADMPGEVLHIPTCLGAVVAAYNLPGKPELKFTPELMEGVFMGKITKWNDAKIAAVNPDVELPDLEITVVYRSDGSGTTFIFSDYMSKVSADWKEKIGAGKALLWTVGIGAKGNPGVAGTISQTVGAIGYIGSEYAFAQNIPVASLQNLAGNFIKPSVESVSASAKPADTRVSLTNTDAADGYPISSFTWLIIYKEQNYNNRSLDQAVQTIKLIEWVIGSDAQKETTKVHYAPLPEAAAAKAKAVLSSVTYNGKSLK. 354
4 0.000e+00UniRef50_A0A2V2RVX8 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V2RVX8_9BACT  ali  33  5...LIRFLVLVILLSVSTAYSQETTLKGAGGTAIFPLLSKWSEAYKQKAGVVIDYQPVGSSAGIAQIKAKSVIFANSDKPLKPEELKEAG--LVQFPAVVIGITPVINVPGVKPGNLDGQVLADIFLGKITKWNDKAIQALNPDLTLPDLAIIVVHRSDGSGTTFNFADYLCKVSSEWKAKIGTDTTISWPTGIAAKGSDGVADQVQKNPGSVGYVEYAYAMQRRIDFVRMKNHDGKIVNPYVGTFQAAAASADFYLILTDQSGMNSWPITAATYILLRRD-----SDKEVNASVVKFIAWCMT-EGQAQAKELNYVPLPERTFRWIKAYWKS.......... 335
5 0.000e+00UniRef50_A0A023X1Q4 Phosphate-binding protein PstS n=1 Tax=Rubrobacter radiotolerans TaxID=42256 RepID=A0A023X1Q4_9ACTN  ali  31  17SALLVGCATAEETGTSGGGGGEAQSIDAAGASFPAPLYSQILQQFAEAEGIQVNYQSIGSSGGREQFIQQNVSFGASDEPMDDEEMEQAGGEPVHIATVGGAVVPAYNLEGVEQLNFTGEVLAEIFLGNITNWNDPAIAELNPDADLPDAEITVVHRSDGSGTTNIWTSYLSAVSEEWANGPGPGGEVSWPTGVGGDGNEGVAGQIQQTPNSLGYVGLEYAVANDISYGSVG-EEGNFVEPSVDSAQAALDAVRVTVSELEPTGEGVYPITGLTWILVRQQMDDLAECKAVAETA-----WYMTHEGQELAPEQNYVPVSDDINATNEEFIRGMEAEGEPCYE 372
6 0.000e+00UniRef50_F8ADR8 Phosphate ABC transporter, periplasmic phosphate-binding protein n=1 Tax=Thermodesulfatator indicus (strain DSM 15286 / JCM 11887 / C  ali  37  29.............................GATFSYPLYSRWFDTYGKETNTRINYRYVNSGSNIREVLARVIDFGVTEAPLNDRERFKAPDLVLHIPIALGAVTLAYNLPKVNKLKLTPEVLVDIYLGKISKWNDPAIAELNKEITLPDMPIKVVCRFDSSGTSYIFSEYLSKISEEWEENIGKGKTIDWPVGEEVKGSEKVAQFIKENEGTIGYLGLTYALKENLPVALIRNQAGEFVAPSIKAIYAATKPDDARATIINSQMEDAYPLSTIVWFITYQEQRYHNRSYERAKELVKLLWWCIT-DGQKFNEELGYGAITKELRAKAESFVRNMTYDGHRIL. 344
7 0.000e+00UniRef50_A0A0D6ACP3 Phosphate-binding protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A0D6ACP3_9CHRO  ali  33  14GAVLFTGVLTGCVSAPSIDPNQTVMIKGAGATFPAPLYQLWIQKYSEEKDIKIAYDSVGSGAGVKNFLSENVDFGASDAPLNEEEKQKMPKNALQIPMTGGLVVFAYNLEGLEDIRLSRDSYCGIVTGNITKWNDPQIMADNPDLRLPDLPVIFVHRSDGSGTTFIFTSHIEKVCNDWKA--GAGKKVEWPSGIGADGNEGVSTQIQQTDGAIGYIEYSYAKTKNLKTATIENKAGNFIKPSPESASKAFAPDDFALVIPDTDITDAYPIVGLTWLLLYANYN----DPNKIEVIKNFVQWSL-IEGDQNASTLGYLPIPDDLQEKVITSLNN.......... 359
8 0.000e+00UniRef50_UPI000A065197 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Rubrobacter aplysinae TaxID=909625 RepID=UPI000A065197  ali  29  17ALSLAVAGCGGDGSAGGGEDSEVRHLSGAGASFPDPVYQQMFQAYNEETGVQVNYDPVGSGGGREEFINDTVDFAGSDAPMDQEELRQAGGSPVHVPAVGGAVVMAYNVPGDQPLNLTGEVVSRIFLGEITNWSDPAIQGLNPEARLPDAGITAVHRSDGSGTTEILTTYLASLSRAWSEGPGVSDEIDWPVGVGGEGNDGVTQQISQTENSIGYVGLEYAESDGLPYASVASGDGPFVKPDTDTASNAIDAVSLTQYTPDAQGENIYPITSITWLLVRTR----MEDAATCRGVAKLAHYMIT-DGQKLAPENNYVPLPESLARKSQGQIEKMQAGGEACYK 370
9 0.000e+00UniRef50_UPI00082FB36F phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Novosphingobium rosa TaxID=76978 RepID=UPI00082FB36F  ali  28  6......LLGAACAMALAVPAARAESVMGAGASFPAPLYTAWARAWHARSGDEVNYQPIGSGGGLRQIRAGTVDFGASDRPLTRAQLDA--DALVQFPAVIGGIVPVFNVPGVGQLRLTGPVLGEIFLGHIRRWNDPALARLNPGLRLPALPITVVHRADGSGSTYLFTSWLSRVSPSWQRGPGASDAVNWPAGIGAKGNDGVAVFVQRTLGSIGYLEYTFAHKVSIAQALVQNRAGAFVAPTPRAFALAADGVPWGSLMLDRPGAGSWPISGASFILMRR----MGPRRAGQGAVMRFLDWAL-AQGDAAAQRLDYVPLSGAIKAQVRQGWKA.......... 333
10 0.000e+00UniRef50_I3Y7P0 Phosphate-binding protein PstS n=3 Tax=Chromatiaceae TaxID=1046 RepID=I3Y7P0_THIV6  ali  31  11..SLALATLFMTALPQASFASEMIKIVGAGASFPAPIYLRWFRDYYAHPEVQIDYQAIGSGGGVSNLINGTLDFAGSDLPVTAEDAAKVPGGIVQLPMTAGAVVIAYNLPGVDALKLSREAIAGIFLGRIARWNDPVIAAANPGVTLPDLPIFVVARGDSSGTTFVTARHLNAISPDFAQSVGVDMNPEWPQALKERGNGGVAAFIQAIPGSIGYLQYSYAYLTNMTMALLQNRAGEYVAPDGDSFRAAIESFRADMDLADPTGDGSYPILSLSWLVLRKDYPD-----ERASVIRDVIGYALT-DGQKVADLLGYIPLRDDAVKLILEKVETIQ........ 348
11 0.000e+00UniRef50_A0A1H1GKP0 Phosphate-binding protein PstS n=4 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1H1GKP0_9BURK  ali  34  17......AIMAGLICCSCAAAAHAADIKGAGSTFAAPLYTRWAADYQKSGGSRVIYQGTGSSDGLKQVIAREVDFAGSDAPLTDDQLTRNG--LRQFPTVIGGVVPVVNLPGLKAGELTGPVVADIYLGKIQFWDDPAIVRLNPKIKMPNYPIAVVRRQDGSGTTLIWTHYLAQVSPEWKRRVGEGTSVRWPLGIGGKGNEGIATYVGYLPGAIGYVAWDFTKQNRLKYVAMTNAAGNVVQPSAATFRAAAASADWSGSLTNQPGKDAWPVMGATYVLLPAMPNKPGHD----EATLKFFEWALSHGGPT-VNALDYIPLPEPVVTKIRAQW............ 340
12 0.000e+00UniRef50_UPI000479FD95 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidobacterium ailaaui TaxID=1382359 RepID=UPI000479FD95  ali  29  11AALVAAAIFSITGCKSGDTGQESVMLSGAGSTFVYPVMTRWIQDYQQHPNVRINYQSIGSGGGIQQVKMGTVDFGASDAALSDEQLKEMK-PVIQIPESAGPVCITYNLPDLKPLQLSPQALAAIFLGTIKSWQDPAITKDNPGVQMPKLPVIVAHRADGSGTTNIFTTYLAAVSPEWQSKVGKGSSVSWPVGVGGKGSEGVTGNIRNAPGAIGYVELTYAEQNHLPVARIKNQAGAYIAPTAQATTAAINAQDPRTPIVNPPASDAYPISGLTFLILPKD----GQDKEKRSALKSFVQYVIT-DGQSTAGSLSYAPLPDGVKQYDQQQLQQLTANGLPL.. 357
13 0.000e+00UniRef50_A0A258LX46 Phosphate-binding protein PstS n=2 Tax=Rhizobiales TaxID=356 RepID=A0A258LX46_9RHIZ  ali  33  29..................PAAHAADVQGAGSTFAYPIIWKWAETFRERTGGLVAYQSVGSSAGVNRIKDGVVDFGASDKPLKPEELEKYGLG--QFPIVFGGVVPVFNLEGVGPLRFTGALLADIYLGKVAMWSDPAIKALNPDVKLPDEKIVAVHRSDGSGTTFNWVSYLAKASPDWKQQVGEGSAVAWPVGPGARGNEGVSTEVRRVKNAIGYVEYTYVVQAKLAYGLVQNRAGRFIAPSAASFQAAALSFDWTVIINDSAAEDAYPIAATTFALMYRAP----KVPAKSEAAFAFWRFALG-EGEKAASELGYVPLPPALVRQVKDYWAK.......... 344
14 0.000e+00UniRef50_A0A2A2TJ90 Phosphate-binding protein n=8 Tax=Cyanobacteria TaxID=1117 RepID=A0A2A2TJ90_9CYAN  ali  29  14..TSVVAATVAFVPMLGAVAQQAQTLNGAGATFPAPLYERYAREIKKKPNIKINYQAIGSGGGIRQTIAGTVDFGASDAAMTDADIAKVKRGVILVPTAGGAVAVVHNIPGVKNLRLSRKTLPAIFSGQITNWSDAQIKADNPGVNLPNTPIKAVVRSDGSGTTFIFTNHLSAISAYFKGRVGANTAPKWSNILKGKGNPGVANLVSRTQGSIGYVEDSFAKSNRLNAAQIQNKQGQFVAPSLQAANAALSTVQFPANVFVGDPSQGYPIVGLTWIMVYKNYP----NAAKADAVKKFVNWALT-DGQQFNDDLNYTSIPKAVVNRVLQTVNS.......... 345
15 0.000e+00UniRef50_A0A1G3PHX9 Phosphate-binding protein n=1 Tax=Spirochaetes bacterium GWF1_51_8 TaxID=1802190 RepID=A0A1G3PHX9_9SPIR  ali  35  5.ALVFTAVFAIAFGACGGGSVSK--IMGGGATFPKELYDAMFAKYKQLKGIEVNYQAIGSGAGQKGIASKTLEFGASDNPYNDEQTKKFGVELIHIPTCVGAIAMAYNLKSHGQLKITPEVIAGIFLGTITKWNDPAIAALNPDAKLPDLSIIVVHRNDSSGTTYAFTDYLANASPKWFETMGKGKDVDWKTGKGAQGNQGIAAEIDQTDGSIGYLELSFAENGGFTYAAVQNKSGNFIVPSIEGVSVSADPAHTRVSIANTAAANGYPIASFTWVLLYKEQKYDSRTLDQAKALVDLIWWM-THDGQSLATPLYYAPLAPSVVAKLEALLLSVTYDGKPVM. 356
16 0.000e+00UniRef50_UPI000DACD974 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Paracraurococcus sp. DB-1506 TaxID=2230885 RepID=UPI000DACD97  ali  31  80.LLIATGIAATAPLLGRPALAEQTPITGAGASFPRPVYERWGQAAREAIGVQLNYQSIGSGGGINQITNRTVDFGASDAPLAAAQLA--ERHLLQFPTVMGSVVLIVNLPGVADLRLTPELVADLFLGKLTRWNDPRIAEQNKELKLPNLPVAPVYRADASGTTFVFTSYLARVSEAWKSGPGAATSVQWPGGQGARGNEGVANTVRQTPGGIGYTENAYATVNRLVTTQLRNKAGQFVKPEMPNFAANWNAPNFAADLIDLDGPETWPIVSPTFILLPVNPTPDRLAGSL--ATMKFFDWAYKN-GAEAARRLEYIPLPDAVHAAIRSAWAAVKPDGKAIW. 423
17 0.000e+00UniRef50_A0A2U8I7V3 Phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2U8I7V3_9GAMM  ali  32  11.......IIAVVLSVFTLSAFAAVNLTGAGATFPTPVYAQWADAYQKETGNKVNYQGIGSSGGEKQIIANTVAFGASDKPLSNDKLAING--LFQFPTVIGGVVMVVNLPGIKELILNGQTLGDIYLGKVTKWNDAAIAKLNPGVTLPDKNIAVVRRADGSGTSFVFTQYLAKVNTEWKKKVGFGSSVNWPVGLGGKGNDGVAACVQRLPGSIGYVEYSYVKETGLAYTKLVSADGQPVSPTVMSFSAAAKEADWSQDLTNKKGKDVWPITSTTFILLHK----VQKDAVKGREVLKFFDWSYKN-GARQANDLDYAMLPAEVVEQIRAAWKT.......... 335
18 0.000e+00UniRef50_A0A2U3PF50 Phosphate-binding protein PstS n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A2U3PF50_9MYCO  ali  33  62...................DGGATSLSGAGSTFVAPAMSVWTKDYSQSDGVQVAYQPIGSGGGVQQIVAGTVDFGASDTPMKDSELAAAKFGPIHIPLTLGAVVPTYNVKGVQTLKFDGDTLGKIFAGKITKWNDPALVGLNPGTTLPDQPIAVAHRSDGSGTTAVWTDFLTKESPTWVQTLGGGKDIAWPVGIGGKGNEGVSGVINQTDGSIGYVELAYVLAQNLNYGVVKNKAGNFIQPCVATITAGAYPPDLRVSLTDGSDQNAYPITGTVYGLVYQNQT----DPAKAKALVNFFSWTLSN-GQDDAASVNYAPLGKDLQGLAMGMVQKITLNGGPVTK 391
19 0.000e+00UniRef50_A0A2S8SRN3 Phosphate-binding protein n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SRN3_9BACT  ali  36  38......SAATTSTDGAAPAAGGATSLTGAGATFPAPLYTRWFDAYDKAAGVQINYQSVGSGAGIKQLASKTVDFGASDAPLGSKDIASLSAPVATIPTVGGAVVLAYNLPGAPALKMTGSAVADIFLGKIKKWNDPAIASINPGATLPGTSIVVAHRSDGSGTTNIFTNYLAAVSPEWKTKVGAGKSVDWPTGVGGKGNDGVAAAIKQAPGGFGYVELAYAKQNKLPYASVKNLAGQFVSPDVAGVTAAAEGADITAPIANAAGAKAYPISGFTYIMVYK----TAQNPAKGQAVKAFLKWAMT-EGQKDAAAQDYAPLPGAIVALNEKTIDALK........ 368
20 0.000e+00UniRef50_A0A1I6L918 Phosphate-binding protein n=2 Tax=Granulicella pectinivorans TaxID=474950 RepID=A0A1I6L918_9BACT  ali  33  6...MFAAALTAATLAPLTVQAQNVTLTGAGSTFAAPLYSKWAAEYKKHPNVEINYQAIGSGGGIRQVSTGTVDFGGTDGPMNDAQLADAKNKLLHFPTALGAAVPIYNVAGVSDLKFTQDALAGIFLGKITKWNDKYIQDANPGVKLPAANILVVHRSDGSGTTYTWADFLSKVSPEWKSRVGVNSSLSWPVGLGGKGNDGVAGLVKQTPNSIGYVELVYAVQNKISYGEVRNSSGKFVKAGLASVSAAAAPADFRVSITDAPNAEAYPISTFTWMLIPRN----MNDKNKAAVLKDFLKWSLTT-GQNECEALTYAKLPKEVVTKEAVAIGTLQY....... 345
21 0.000e+00UniRef50_A0A1F9ZJ29 Phosphate-binding protein n=1 Tax=Euryarchaeota archaeon RBG_13_61_15 TaxID=1797978 RepID=A0A1F9ZJ29_9EURY  ali  33  39.....................ESVTLTGAGATFPMPLILKWADEYYNETDVRVDYAGGGSGAGITQIKDNNVDFAGTDAPLSAADSTTYG--LVHIPETLGAVVVAFNEPTVSSLKLNGPTLARIFMKNITAWDDPEITVLNPGVTLPSEQITTIVRSDSSGTTFVFSGYLAKISSEFDELYGQGKSVSWPDAIGASGNSGVTQTIKTTAHSIGYIELSYAIENDVPFAQLENHDGNFVTASLETTSAAADGDWSGVNILDQPGANAYPIASFTYILVYKENDGSSMNKTAAQALLDFLWWCVHEHGQAYGPDLHYAELPASVVAINEATLNSITYDGE.... 366
22 0.000e+00UniRef50_UPI000750C30F phosphate ABC transporter substrate-binding protein PstS n=4 Tax=Proteobacteria TaxID=1224 RepID=UPI000750C30F  ali  31  25....................AADVVLRGAGATFPYPIYAKWAAEYKRATGVDIRYEAVGSGAGIDLVGHGMVDFGASDVPLAEEELQRAGA--MQFPAVIGGVVPVMNVGGIKELRLSGQVLAEIYLGKITKWNDPAISALNPGLHLPSTFITVVHRSDASGTTFLWSEFLSRSSAEWRAKVGADKVLAWPTGVTGAGNEGVASSVQRTKSSIGYVEYAYAREHNLTTASVRNRDGAFVQPGEASFEQWRRSADLYQLLIDQAGAASWPIAGGTFILLRTAADQPARSLE----VLKFFDWAL-HDGQRFAIDLDYVPLPAPALDLIDGVWADRSASGGAVW. 349
23 0.000e+00UniRef50_A0A1H4FJR4 Phosphate-binding protein PstS n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1H4FJR4_9RHOB  ali  31  18................SSLSAQSVRVNGAGASFPFPLYATWTQAFQQNSGVRIDYQSTGSGAGIRAFIDRTVDFAGSDAEMTQEQMDSVEGGLVVIPATAGKVVLAYNLPDVGELRLPRSVYPEIFRGAITRWNDERIVAANPGVTLPDMQITVVRRSDGAGTNFIFTNHLSAIDEAFASEIGVGTTVQWPNFVGAPRNDGVMATTMQTPGALGYVEYGFARMSNTPMAMLENASGEFILPSNDAGTLALSSGDFSGDVTDPSDPGAYPITSMTWMLFYRN----HGDPQVAEALRNFVTWAM-DDGQAMAAELNYVPLPDAVKESNRAKIAEIQ........ 340
24 0.000e+00UniRef50_A0A1J5S5K9 Phosphate-binding protein PstS n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5S5K9_9ZZZZ  ali  33  16............TFASGVAAKADVSLNGGGSSFDLPAFTKWFQAYRSDPSVSFNYQPNGSGFGQASMLNQTVDFGASDFTMDDAKLAKTNGPILQLPIVAGAVVISYNLPGNPKLKLDGDTIANIYLGNITKWNDSRIAALNPGVDLPDLDIVTVHRSDTSGTSYIFSDYLSSVSQEWASKVGRSGSPMWPNGLGGKANAGVAGQVKQLPGAVGYIELAYAVENRLPYATLKNHDGDYVEATPAAVSAALAPDDFRFTMVNAPGAKSYPIAGVSWILLYQNQ----KDSVKGAAIVKFAKWIVT-AGQKISPELEYAPLPDNVQQRILAAIDTIKY....... 340
25 0.000e+00UniRef50_D7A0I8 Phosphate-binding protein PstS n=9 Tax=Bacteria TaxID=2 RepID=D7A0I8_STAND  ali  32  6....ILGVAALSFGAAFSGAAFAADINGAGASFPAPVYQAWAAAYKEKTGTGLNYQSIGSGGGQNQIVNRTVDFGASDAPMDDAKLEKNS--LLQFPTVIGSVVAIVNLGEDIPLTLNGAVLAEMYQGKITKWNDPKIAALNKGAKLPDLAIVPVYRSDSSGTSFVFTSYLSSASADWKSNVGAATSVQWPAGAGAKGNEGVAGTVKNTKGALGYVEFIYAAANKLHATDLVNKAGKVVKPDVKTFMAAASAANFAASMVDTAGEEAWPIVSATYILLPKNPS----NAAASAEAIKFFNWAYGEDGDALAEKLHYIPLPNAVVEEVKKAWASVKADGKAVW. 344
26 0.000e+00UniRef50_A0A2N7Q021 Phosphate-binding protein n=3 Tax=Hydrogenobaculum TaxID=168657 RepID=A0A2N7Q021_9AQUI  ali  30  6.......VLALAVFAGSLQGAMAWTITGAGSTFVAPLMQRLALHFKQATGNHVNYQSIGSGGGILQATKRTVDFGASDAPLKPEELKR--RDLIQWPDAIGAVVMGYNIPGVGNLHLTGKQICDIYMGKVRYWDDPEIKATNPKLNLPHIPITPVHRADGSGTTWIFTNYLTKVCPAWAQKVGFDTSVAWPVGIGGKGNEGVANYVMRVRGAIGYIEYAYFKQNHFNVAVLENKAGWWVAPTMQTMIAAAKQANWNEELPNPPGKYSYPIEGPTFALLPK-------GKNTNSYVLQFYTWVFNH-GDADLRALDYITLPDFVKKDIMASWKK.......... 331
27 0.000e+00UniRef50_C4K8E1 Phosphate-binding protein PstS n=48 Tax=cellular organisms TaxID=131567 RepID=C4K8E1_HAMD5  ali  32  9......LCVFSSIFLITASAFSSTNLTGAGATFPTSLYSKWADSYQKKMGAKINYQGIGSSAGIKQIIANTVDFAASDIPLTEQQL--LKNNLFQFPTVIGGIVLAINIPGIKQLILDGKVLGDIYLGKIKKWNDPEIIALNPEIKLPDQDIAVVRRADGSGTTFVFTHYLSKKNPEWKAKIGEGSNINWPIGLGGKGNDGVAAFVQRVPGSIGYVEYSYAKQNNLAYTRLLSANNRSVTPNLTSFESAAKDVDWTQDLTDQKGDNSWPITAATFILIKKTPKKTN---DRRIDVLKFFDWAY-RYGAKEAHDLDYATLPDSVINQIRKAWET.......... 337
28 0.000e+00UniRef50_A0A1V4X0Q8 Phosphate-binding protein PstS n=5 Tax=Syntrophorhabdaceae TaxID=513556 RepID=A0A1V4X0Q8_9DELT  ali  44  30........................ELKGAGATFPQPFYEMLFNMYQRSHGVKVRYEGVGSGEGLRLLATRTVDFAGTDKMAVQGPSDTGSGTVLNIPTCVGAVAVVYNVPGNPKLRFTPDVIADIFLGRIKRWSDPRIAAANRSSALPNIPIAVVYRIDASGTTFIFSDYLAKTSGEWNDRIGKGTSLKWPAGQGARGNPGVAGLVGQIPGSIGYVELVYAIGNKMTFGALRNRSGRFVMPTVKSVTAAASASSSDYSLTDTSVPDGYPISGLTWIALYREQNYGGRTRERAEDLVKLLSFIV-HEGQKHAPFLHYAPLPKNARKNADALLGTVTHGGSPVFR 350
29 0.000e+00UniRef50_T0DRJ5 Phosphate-binding protein PstS n=10 Tax=Bacteria TaxID=2 RepID=T0DRJ5_9PROT  ali  36  6.........VALCLLLASTSTFALKINAAGASFPYAIYSKWFSEYSKNPEVQFNYQPIGSGGGIRQLLKETVDFGASDAPMKAKDKKKAKWPVLHVPMVLGAVAIAYNHPQVPDLKLDGPTLADIYLGKITKWNAAQILALNPGVKLPSDDILVVRRADGSGTTKNFADYLVEVSTEWKQRVGTGKSLRWPTGVGAKGNDGVTSIVSNTKGSITYMDLAHARKNNIKTVALKNKAGLYINPTVEAVSASAEGKELTGSLINSSAKDSYPISALTYILLP-----MVEKDLKQVEIYKFVEWAIS-KGQSYAKELYYAPLPTELSKKVLERVKSL......... 331
30 0.000e+00UniRef50_V4JRZ0 Phosphate-binding protein PstS n=2 Tax=Thiohalocapsa TaxID=85079 RepID=V4JRZ0_9GAMM  ali  34  10....AAIASCVSALMLAPAAQAEVKLNGSGASFPFPIYSKWFKDFSKNRDIRVDYQAKGSGAGIQDLINGVVDFAASDAAMKDSEMAKVEQGVVLLPMTAGEVVLAYNLDTVDELKLPRDVYPEIFAGKISKWNDPKIAEANPDVTLPDDDITVVVRSDSSGTTYVFTGHLSTIDETFKEEIGQAKAPNWPDFIKAPKNDGVTAQIKQIPGSIGYIEYGYAKLTKQPTAMLENKSGKFVAPGPESGAAAIASAEFIAWVWDPAGEDAYPIATMTWLLLYKDQ-----DDDKAAALRKLVEYCTSEKAQGLADGMGYVPLPAPVIEKVRAA............. 347
31 0.000e+00UniRef50_F8F211 Phosphate-binding protein n=2 Tax=Bacteria TaxID=2 RepID=F8F211_TRECH  ali  33  15GTTLFAQAIPGSGLIKGAQAGEAKNLTGAGATFPAVLYSKWFSEYNKLTGVQVNYQSIGSGGGIKSISDMTVDFGATDGPMTDEQLAAAKGGIVHIPAAMGAVVPTYNIPELDSLKFTPETLAGIYLGEIVKWNDDKLVADNPVLKNVNKYIVVARRSDGSGTTNIWTSYLAAVSESWAKKVGAGNSVQWPVGLGGKGNEGVAGVVKQTPYSIGYVELAYANQNKLAVGQVKNKAGKFITPNMKTASLAAQPEDMRVKLVNSDNTEAFPIVGFTWLLAYTNQT----DPSKALALTRMLWWA-THDGQQYCEALDYAPLPVDAIKKSEVLIKKIQVNGKQAL. 360
32 0.000e+00UniRef50_H0E647 Phosphate-binding protein PstS n=6 Tax=Solirubrobacterales TaxID=588673 RepID=H0E647_9ACTN  ali  34  31......STAASTGTETTATAKFSGSINAGGSTFAKPVYDTWGSKLKSQ-GLTFNYAGTGSGAGIAGVTDGTLDFGGTDSAMDDEEIAAAKGDIVHVPTFFGAVVAAYNVKGIETLKLDGETLANIFLGKITKWNDPAIAGQNDGVTLPDEKITVVHRSDESGTTKAFLSYLGAYSKEWEKGPGVDKSVKWPTGTGAKGNDGVAGQVKQTEGAIGYVEQAYALQNDFAYASLKNKAGNYVEPTLESVSAAGDPADLRFSIGDASGDQTYPDASATFIVLPKDLCKAGKSKDVASDVKNFLTYGLTT-GQEEAKQLAYAPLPASVLDKAKAVVDSLECNGAPI.. 370
33 0.000e+00UniRef50_A0A2W6AC79 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=candidate division AD3 bacterium TaxID=2052315 RepID=A0A2W6AC79_  ali  36  26........SSTSGTPASSVDVGSGTLTGAGATFPEPFYTKAFYSYQKYPNVSVNYQAVGSGAGIQQFTNGTVDFGASDVPMTATEIQTAGDKVVQAPTTLGVVAVSYNLSGVQKLQLDGPTLANIFLGTVKRWDDPSIKALNSSASLPARDITVVHRSDGSGTSYHFTDYLSKVSDTWKTKVGVGKAVQWPAGIGGKGNEGVATAIKQTDGALGYVELAYVIQTGMQQAALKNKAGKFVQASVAGATAAANVSPTNFSITDSPGDTSYPIAGFSWVILKKTYT----DVPKGKAVAFLFKWLVT-DGQQYGKDLQYAPLPKPVQDLAITSLKTVTAGSNPAL. 361
34 0.000e+00UniRef50_Q88JJ3 Phosphate-binding protein PstS n=298 Tax=root TaxID=1 RepID=Q88JJ3_PSEPK  ali  28  12..SAALAVAVSLCATSAAFAAENVRLTGSGASFPAPIYLTWFKDFSKNTGVTVDYQSKGSGAGVQDFLNKTVDFAASDSAMSEADIAKVGEGVQLLPMTAGEIVLAYNLPGNPKLKLPRDVYSNIFLGKITQWNDPQIAAANPDLKLPATPITVVVRADSSGTTAVFTKHLSAINADFKQGLGEGNTVNWPAFIKSPKNDGVTATVRQTPGAIGYIEYGFAKLAKVDFAMLQNKAGQYVVPNAESGAEALAPENLVAWLPDPDGAKSYPITSYTWMIFRKD----NGNPEKAKAMREMVEYSLT-KGQTIADSMGYIPLPPSVVDQVRKASANIQ........ 348
35 0.000e+00UniRef50_A0A2T6DUP4 Phosphate-binding protein n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2T6DUP4_9BACT  ali  33  4..ALLSLSLACVALCVAVAGRAETALNGGGSSFDQPAFAKWFEAYRKDPTVTFNYQANGSGFGQSALLSQTIDFGASDFTMDDQKMAKSNNGPVQLPIVAGAVVLSYNLPGSPKLKFDGETVADIYLGKITKWNDPKIAALNPGVSLPNSDIVAVHRSDSSGTSYIFTDYLSSVSSAWDSSIGRSSTPKWVGGIGGKGNAGVAGQVKQLPGAIGYVELAYAVQNKLPYATMKNRAGKFVEASPESVSVALGPDDFRFSMVNAPGDAAYPIAGPSWVLLYQQQ----KDAAKGAALAKFFKWVVT-EGQKISPELDYAPLPESVQKRILAKLASVK........ 337
36 0.000e+00UniRef50_A0A235I0Y9 Phosphate-binding protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A235I0Y9_9NOSO  ali  30  25.....VILTTGLLSCQSQTPGNQVSLIGAGASFPAPLYQTWFDVYQQNPNIKIDYQSIGSGAGVNQYLRRTVDFGATDAPLTEEERAKYNTEPIQVPLTGGAVVFAYNLGGNNNLRLSRQAYCGIIQGDIKTWDNPLIAKQNPNVKLSNTPIRFVHRSDGSGTTFLFTNHISEVCPNWKA--GVGKSINWPIGVGAKGNEGITAQVQQTQGAIGYVEYVYAKQSNLNMATLENKAGQFVDPSPESAARALQPQNFALEVPDPPEQQAYPIVGLTWLLLYNQYD----NPAQATTLKNFVDWALT-QGDKYALQLGYIPISNELAQRVQSTVSE.......... 355
37 0.000e+00UniRef50_UPI0009DBCE6E phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidobacteriaceae bacterium KBS 83 TaxID=1267533 RepID=UPI000  ali  31  57.........................ISGAGSTFINPAMGRWAAEYQAHKTVQINYQSIGSGGGIQQVKAGTVDFGASDAALTDQQLGQMK-PMLQFPESAGPVCITYNLPELKPLHLSAAALAGIFLGTIKNWQDPVIKAANPGVDLPKTGIAVVHRAESSGTSAIFTSYLFEVSKDWATKVGKGTQVNWPAGNGGKGSEGVTGQLRQTPGSIGYVELTYAQQNNLPVAAIENQAGHYVLPSPQSTTAAINGQDPRVPIVNPPASEAYPIAGLTFLIVPKD----GVDVEKRQALKDFIKYIVT-DGQSVATSLNYAPLPDGVKQNDLNLLNELTAEGKPL.. 376
38 0.000e+00UniRef50_A0A1Q7ZWR4 Phosphate-binding protein PstS n=7 Tax=Bacteria TaxID=2 RepID=A0A1Q7ZWR4_9ACTN  ali  34  15GVAAMVATACGGTNTPTSTDVGQGSLTGAGATFPGPFYDKAFLDYSKYPQVKVNYQAVGSGAGIQQFIKKTVDFGASDVPMGATDIASAGGDLTQIPTTLGVVSVAFNVKGVDKLNLDPDTLAGIFLGKIKNWNDPKIAAINSGTMLPNKAITVVHRSDGSGTTFHFTDYMSKISADWKTTVGTAKSVKWPTGVGASGNQAVAQAITSTDGAVGYVELAYVVQTGMKQAALKNANGKFVQASIDAATAAAGTSPTNYSITNAACDACYPIAGFSWVMLYTSYS----DAAKGKAVVNLFKWLVT-DGQSDSQDLQYAPLPAAVQQLALTNLKAIKAGGSPVL. 358
39 0.000e+00UniRef50_A0A2E2D8F0 Phosphate-binding protein PstS n=24 Tax=Bacteria TaxID=2 RepID=A0A2E2D8F0_9GAMM  ali  32  13......LITALVGAMSSTAAHAELKLNGSGASFPAPLYNKWFKDYSKQTGVRVDYQSKGSGAGIRDFINETVDFAASDAAMKDSEIEQVKKGAILLPMTAGEVVLSYNLEGVKELKLPRDVYPAIFMGKITQWNDPKIQAANPGVKLPDEKITVVVRSDSSGTSYVYTNHLSAINAEFKETIGAAKSPNWPSSVKAPKNDGVTATIKQTPGSIGYIEYGFAKLTKMPTAILENQKGKFVEAGPEGNLPGSDVPDLRAWSTDPAGEDAYPIASFTWLLVYKDQED-----DKAKALRDLIEYMVTT-GQESSEAMGYIPLPENVVEKVRNAAKMIK........ 352
40 0.000e+00UniRef50_A0A1F9S683 Phosphate-binding protein n=1 Tax=Elusimicrobia bacterium GWA2_69_24 TaxID=1797927 RepID=A0A1F9S683_9BACT  ali  31  11ALLILGLAPLRAQDLVHHDANREIVLNGGGATFSYPVLSKWFAEYQQRPSVKINYQPIGSGGAIRQILEHTLDFAASESWLSDEQLGKLGEPLLHIPAVLGAVVPAFNLPGIPELKFTGPLLADIYLGRVARWNDPAIGKLNPGVRLPDAPIALVHRADGSGTTFCLTDYLSKTSKDWETKVGRGVALSWPSGIGAKGNQGVTAYVQQTQYSLGYLELTYALQSGLTYGSVQNRAGRFVKASAQSASDAAAPRDYRISITDAPGVKSYPIVSFSWLLLYGKNP-----PDKSLALRDFLHWMI-ADGQKSARALNYAPLPLNIVAMVRVSIEEI......... 345
41 0.000e+00UniRef50_A0A218PAC5 Phosphate-binding protein n=1 Tax=Thermococcus sp. P6 TaxID=122420 RepID=A0A218PAC5_9EURY  ali  30  54........................TLRTTGATFPQYQIQKWISVYMKHPDVKIEYEGGGSGHGQDAFLKGLTDIGRTDPPVKEETWKKFGDQPLQFPEIVGAVVIAYNVPGVSELKLDGETLAKIFMGEIEYWDDQAIKSLNPDVNLPHEKIIVVHRSDSSGTTAIFTTYLSVVSPEWKEKVGAGKLVDWPVGIGGKGNPGVVQALKSTKYSIAYTELSFAIEEKLNVAALKNKAGNFVKPTDETIKAAVAGVKSTAQLLNAPGDNSYPIVAFTHILVWQNKGGKHYSKEKAEAIKEFLRWVLT-EGQKIAP--GYVGLPPEVAQIGLKAVDMIETG...... 387
42 0.000e+00UniRef50_A0A0Q0VKA9 Phosphate-binding protein n=1 Tax=Candidatus Cloacimonas sp. SDB TaxID=1732214 RepID=A0A0Q0VKA9_9BACT  ali  32  5...IIALFAVIILVLSCTSSSKSTVLEGAGATFPYPLYAEMFQEYFELTGIEINYQPIGSGAGIKKFLKKQVDFGASDIYLSDDTIRKSEINILHIPICLGAVALSYNLPVSDTLNLSPQVISQIYRQEITAWNDPLLAALNPGVDLPDWDIVPLHRSDASGTTFIFTEYLTQSDPEWRDRIGSGQKVEWTEGIAVKGNQGLADKISETEGALGYLEYNYALSKNLKVAKVLNRSGNYIFPEIENVIASAQPEDSRIILTNTEIAEGYPLSGFSWLLIYEDLDFLS-NKAKAYNLVNLIWWM-THEGQEISSKSHYGLLPEIMKIHTEKFLKKIKYNNEFIIK 345
43 0.000e+00UniRef50_Q1AXU2 Phosphate-binding protein PstS n=3 Tax=Actinobacteria TaxID=201174 RepID=Q1AXU2_RUBXD  ali  33  45.....................AAQRINGAGASFPAPFYSAVFQRFAQEEGIEVNYQSIGSSGGREQFIQKTVAFGASDEPMSEEEMREAGGNPLHIATVGGAVVPVYNIEGVDSLNFTGRVLADIYLGNITRWNDPAIAELNPGVELPDAKIAVVHRSDGSGTTNIWTSYLAAVSPEWKSGPGAGGEIKWPTGIGGDGNEGVAGLVKQTPNSIGYVGLEYAVQNELAYGDVG-EEGAFVRPSVESARAAIEDLRFTISSANPQGEGVYPITGLTWILVRQQMDDPAQCRAVAQAA-----WYLTHEGQSLAPDLNYVPLPENIVSRDEELIRSMEAGGEKCY. 368
44 0.000e+00UniRef50_A0A2H1EJA9 Phosphate-binding protein n=3 Tax=Candidatus Nitrosotalea TaxID=1078904 RepID=A0A2H1EJA9_9ARCH  ali  35  25...............SAQTNSQSYTLTGAGSTFVFPLMDTWRVEYNKHQNINLNYQSIGSGAGIKLLQQKSVDFAASDAPLSASDAANAP-GVLTIPESIGGITIAYNIPGVDKLKLTGPVIAKIFMGSITSWNDPEIANLNPGVNLPDQKIVVAHRSDGSGTTYAFTDYLSKISPDWKTKVGQGKTVPWPIGTGGSGNAGVATIVKTTQYAVGYIELAYAFQNKMTYAFVQNADGTFVEPTIDSVSAAADGDWSQVSIVNQPGNNSYPISTLTYVMVYKDLTVNGETQDKANEVINFLNYII-HDGQQYASGLLYVPLPDTIKKIDEDGLAKITFNG..... 359
45 0.000e+00UniRef50_A0A1J0AE71 Phosphate-binding protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A1J0AE71_9CYAN  ali  30  14GLGAVACSKPVPPPETTPAPGEPVFLNGAGATFPSFLYLKWFAEYQKYPEVQISYQPIGSAAGIQQFLTGTLDFAGSDVAMTDAEAAKLKQGALFVPMTAGSVAVVYNIPGIPTLKLSRQLLPAIFLGQITRWNDPELAVLNPELTLPNLPITVVYRSDGSGTTAIFTSHLSAIDPLWQNQVGTGLTVNWPVGTGIKDNAGISAQIQQGEGVIGYVETAYAQQLKLATAALENQSGKFLLPTKNSVEKAVADAKLRGFIPDPASPEAYPIVSYSWFLIYQKY----EDKNKGETLRKFIKWAL-VEGQKFGLELGYVPLPGPVVAQAQTLMQQ.......... 348
46 0.000e+00UniRef50_A0A0D5C478 Phosphate-binding protein n=6 Tax=Thaumarchaeota TaxID=651137 RepID=A0A0D5C478_9ARCH  ali  33  15GAIITPMYADAATSPDVPDPNQEFTITGAGATFPYPLIDLWRVEYNKENNVNLNYQSIGSGGGIKQHIEKTVNFAASDKPMSQKERD-IAVGTLHIPESIGGVTLVYNVPEIPNLKLTGEAVSKIFLGEITRWDDPVIANENPGLNLPDHEIVTAHRSDGSGTTFIFTDYLATVSPTWDEQIGKGKSVPWPSGLAAAGNEGVAGIVKSTEYSIGYIELAYAFQTGMTYASIQNGDKTFIEPTLDSISAAAEESWVGVSLVNAPGPDSYPLASFTYLLLYDDLKSVTDNKEQAKALIHLVYWMIT-DGQQHSASLLYVPLADKVVELGKQGLSKITYDGETIW. 368
47 0.000e+00UniRef50_B5E9J0 Phosphate-binding protein PstS n=8 Tax=Geobacter TaxID=28231 RepID=B5E9J0_GEOBB  ali  32  8.....TLALVVALSVGAGAAYADTTLKGAGATFPHPLYSKWFRDYQAEPSVTFSYEAKGSGHGIKRIISGEVDFGATDKFLTDQELKGAPGKLLHVPTVIGAVAVAYNIPGIGALKLTPQALAGIYQGKITKWNAPLLAKLNPKLRLPAQEIVVVHRSDSSGTTSIFTDYLSAVDKSWATSVGKGTSVAWPVGEGAEGSSALVKKIGETPNSIGYVEIAYALENDLNTAALKNKSGKFVKANVLSTRAAAVQADFRLSLVDQPGKESYPVVGLTWLLVYQEQ----RDAVQGKKLVEFLRWQL-RKAEKMTSTLHYTPLPDTWTRQVEQTIDSIRV....... 348
48 0.000e+00UniRef50_A0A128A1Q8 Phosphate-binding protein n=3 Tax=Archaea TaxID=2157 RepID=A0A128A1Q8_9ARCH  ali  36  24................SAQTSQSYTITGAGSTFVFPLMDTWRVEYNKHQNIQLNYQSIGSGAGIKLLEQKNVDFAASDAPLSASDMQQAP-GVLTIPDSIGGITIAYNIPGIDKLKLTGPVIAQIFMGDITSWNDPAISNLNPGVNLPSQKIVVAHRSDGSGTTYAFTDYLSKVSPDWKTKVGQGKTVPWPIGTGGQGNAGVASIVKSTQYAIGYIELAYVFQNKMTYAFVQNADGNFVEPTLDTVAAAADGDWSQVSIVNQPGSNSYPISTLTYVMIYKDLTVSGETSDKSTEVINFLHWII-NDGQQYSTGLLYVPLPDSIKKIDEAGLSQVAFSG..... 357
49 0.000e+00UniRef50_A0A2T5XCF6 Phosphate-binding protein PstS n=1 Tax=Asticcacaulis sp. CF398 TaxID=2135738 RepID=A0A2T5XCF6_9CAUL  ali  32  22..........GAATAEGADAPAAGDITGAGSTFFAPLGAKWAETYKDTTGVRLNYQSIGSGGGVRQIKVKTVDFGATDKPVKPADLD--ESGLLQFPIVMGGIVPIVNLPDVKQINLTGPLIADIYMGKVKRWDDPAIGALNPGLKLPHLPITVVHRADGSGTTFLFSNYLAKVSPTWKEEVGAADALEWPVGLGGKGNEGVSAFVKQTLGSIGYVEFAVAARTGTAVANMRNHDGHMIAPSIDAFAAAAAGADWANALLDQPGANAWPITATVFIVMHKKQDK----PASARAALTFFDWAYTH-GDPLATKMHYVPLPAEVKQMMRAQWTQIAPDGKPVY. 355
50 0.000e+00UniRef50_A0A2H2XST5 Phosphate-binding protein n=2 Tax=Calothrix TaxID=1186 RepID=A0A2H2XST5_9CYAN  ali  30  23..........LSPLFATVANAQQVSLNGAGATFPQPLYERYAREIRKKPNLRINYQGVGSGAGVNAVIAGTVDFGASDAAMTDAEIARVQRGVILVPTAGGAVSVVYNLPGVNNLKLSRKTLPAIFSGQITNWNDPQIRADNPGVNLPNSPIRPVVRADGSGTTFIFTNHLSAISGYFKGRVGTSRAPKWAGILRAKGNPGVAGSVSRTQGAIGYVEYQYARENRLNAAQVQNRQGQFVAPSLQGANQALANVQFPNNFRVFVGDQGYPIVGLTWIMVYRQYP----NAAKATAIKQFINWALT-DGQQFNDDLNYTSIPASVRTRVLSQVNAI......... 347
51 0.000e+00UniRef50_Q7VZ63 Phosphate-binding protein PstS n=141 Tax=Bacteria TaxID=2 RepID=Q7VZ63_BORPE  ali  32  26........................DVTGAGASFPYPIYAKWASDYKAATNNAVNYQSIGSGGGQQQIKAKTVDFGASDDPLKAEDLEKNG--LLQFPAVIGGTVPVINIDGIGQLKLSGAVLADIFLGKVKKWDDAAIKALNPDLKLPSADIVVVHRSDGSGTTFGWTNYLSKVSSAWKEQVGEGKAVKWPTGQGGKGNEGVAAYVGQLKNSIGYVEYAYAKQNKLAWTQLQNKDGKFVQPEQKAFAAAAANADWKVVLTNEPGADSWPVTAATFILVHKSQDK----PVQGRAVLEFFDWAFKN-GAKSAEALDYVPLPEAVTTEIRAAWGEVKADGKAVWQ 346
52 0.000e+00UniRef50_A0A075GW16 ABC-type phosphate transport system periplasmic component (PstS) n=7 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075GW16_9ARCH  ali  30  16..ILLIPASAFATTPVEPNPNVDVQIDGAGASFPFPLIDLWRVEYGEYPSVQLNYQSIGSGGGVKNHISKTLIFAASDAPLKPAEREAA-LNTLHIPEAIGAVTVAYNVPEIPELKLTGTIIADIFLGKITKFNDPAIQELNPEISLPDEDIVVAHRSDGSGTTFVFVSYLAEVSSEWDEKVGAGKSVEWPAGIGGKGNEGVATIVKTTPYSIGYIELAYAFQNDIPYASVENADGNFVAPSMQSIADASAGAWYGVSLLNAPGKNSYPIATFTYLLLYEDLNKVTNDPNTVQALMHMINWMIT-DGQKFNQELLYVPIAPEVQKIGIDGLKRVQFNGQSAW. 367
53 0.000e+00UniRef50_A0A0D6PAA4 Phosphate-binding protein PstS n=15 Tax=Bacteria TaxID=2 RepID=A0A0D6PAA4_9PROT  ali  36  3.LVATVLTGLLTFGATASAVSAATQITGAGSTFDYPLFSKAFYIYSEHSDVTVNYQSIGSGGGIQQFTAKTVDFGASDVPMDAKELARAKDPVLQIPITLGGEGIAYNLPGIKGLHLSREVVADIYLGKIGKWDDPAIVTLNPGMKLPSMPITVVHRSDGSGTTYIFTDFLSSVSPAWKQKVGAGKSVSWPSSVGGKGNEGVAGLVRQTPGAIGYVELAYLLQNDMTYALLQNKAGSYLYPDIATVAAAADVSSTDFSIVDTSCKDCYPISGYSWALVYKKPS----DPHRGALVKQVMEWMATT-GQPIAKTIGYVPLPENVQKRAAAILEQMEVK...... 341
54 0.000e+00UniRef50_A0A2A6RFF6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium Kir15-3F TaxID=2024553 RepID=A0A2A6RFF6_9CHLR  ali  32  56........APVVTTDGFQPRDLSVTLTGSGASFPDPVYQAWIERYREAPNVTINYQAVGSGQGRRDFYADITDMGGTDRYASDEELEAYGAPFFHIPTVLGAVVATYNLPGVDELQFSGETLVEIFFGRVTNWSDPLIAEDNPGVDLPDLPITVVHRSDGSGTTSIFTEFLSAISDEWATEIGASDSVEWPTGIGGQQNAGVAAAVAQTEGAIGYVELIYALSNNLPAPAVRNAVGNFVKPTLESTSQAAAPADMRVNIVNPPGENAYPIAGFTWLLVREE----MSDLTTAQALADFLFWAIT-EGDEEALALRYAPLPEEVKLRTLAMIARINVNGTPAIE 393
55 0.000e+00UniRef50_Q8PAF6 Phosphate-binding protein PstS n=31 Tax=Proteobacteria TaxID=1224 RepID=Q8PAF6_XANCP  ali  32  50........................DVTGAGASFIYPVMSKWSADYNTATKKQVNYQSIGSGGGIAQIKAASVDFGSSDAPLKPEELAAAG--LAQFPSVIGGVVPVINVPGIGAVKLDGKTLGDIFLGKVTTWNDAAIVALNPGVKLPDSKITVVHRSDGSGTSFNFTNYLSKVNPDWKSKVGEGTAVQWPTGIGGKGNEGVAAYVKQIKGGIGYVELSYALQNKMAYTAMKNAAGKFVQPSDETFAAAANSADWGSSMTNAAGDNAWPITATNFILVQKKP----KNPAGLKNTLEFFRWVYS-KGDAQAKALDYVPLPDTLVSQIEAYWAK.......... 359
56 0.000e+00UniRef50_A0A2H0WIY8 Phosphate-binding protein PstS n=1 Tax=Bdellovibrio sp. CG10_big_fil_rev_8_21_14_0_10_47_8 TaxID=1975526 RepID=A0A2H0WIY8_9PROT :  ali  34  15....LITLLTVLGLFSSINASAAPSINGAGSTFAEPIYTRWMSDFQKKDGTTYNYQGIGSGAGIRQLLEGTVDFAGSDDPMSEKDAAKAKSEVLHIPVAMGAVVVSYNVPGLKPLRLSGPVIAKIFNGGIKKWNDAEIAKLNPSEKMPDLAITVATRADGSGTTAVFTEYLAKVSPDWVGKNG-KTVNWFIGSLGAKGNAGVAGLISQNPGAVGYVELLYATENKLAFALVENKKNQFVEASAKSVMVAAEGKKFKISLTDSDRKGAYPISSFTWMLIYSQMP-----KEKGQAIEKFAKWVLSEEAQKTALSVHYAPVPKDIRAAALKAIGEIKLN...... 350
57 0.000e+00UniRef50_A0A2C6ZE41 Phosphate-binding protein PstS n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2C6ZE41_9PROT  ali  34  6.LLALAAGVVATIGLSMTAHAQQATITGAGASFPNPLYQKWGEAAKEGAGIQLNYQSVGSGAGQAQIRNRTVDFGASDAPMTAEQLQEH--NLLQFPATMGSLVAIVNIPGVEDMRLTGELLSEIYLGKITKWNDPKLVEMNPGLNLPNLAIAPVYRADGSGTTYVWVSYLSAVSGEFKQRVGVGTSVRWPAGTGARGNEGVAGTVRNVRGAIGYVEHAYAAQNKLVTTQLRNKAGNFITAEPEAFQAAAANADWSASLIDTQGEKSWPIVSPTFILLPKNP----QDATRAQNVMKFFDWAFRN-GDQMAVQLDYIPLPETVEDAIRAAWAEVKADGKALW. 347
58 0.000e+00UniRef50_C1AB01 Phosphate-binding protein n=6 Tax=Bacteria TaxID=2 RepID=C1AB01_GEMAT  ali  35  48........STNAAGAASVMTSTRVDITGAGATFPYPLYARWFNEYAKTSNTRINYQSIGSGAGIRQVVARTVDFGATDVPMTDSELSASKMRILHIPTVVGAVAITYNLPELSPLNLSADVIADIFLGKLTKWNDTRLAALNPKVTLPASDILVVHRADGSGTSYIFSDYLTVVSPAWASGPGRGKEVPWPVGIGGKGNEGVAGQVKQMPGAIGYLEVVYARQNRLPVAHIRNQAGRFVSPMPFEIATAAAATDLRMSLVDAPGAQSYPIASFTWMLI----APDAIGPVKSHQMASFLRWALLENGD-IASTLGYVPLPSDAAARVVDKVEEL......... 381
59 0.000e+00UniRef50_A0A2S9Q766 Phosphate-binding protein PstS n=3 Tax=Xanthobacteraceae TaxID=335928 RepID=A0A2S9Q766_9RHIZ  ali  35  6...LALAASVALSGTIAATAAFAADITGAGATFPAPVYNAWGSDFKAKTGTALNYQAIGSGGGQTQITNRTVDFGASDAPMATDKLAAA--KLLQFPTVIGAVVPIVNLEGVKALTLTGEIIAEIYQGKITKWNDPKIAELNKDVKLPDLDIAPVYRADGSGTTFVFTSYLSAVSEEWKGNIGAATSVQWSAGSGAKGNDGVAGAVKNTQGAIGYVEYVYAANNALTTTKLKNKDGKAVKPSVEAFQAAASKADWAVSMVNVGGETSWPIVSTTFILLPKDP----KDAKQSAEVMKFFDWAY-KDGAATAEKLHYIPLPKEVIDTVRTAWKSVKADGKAVYE 347
60 0.000e+00UniRef50_A0A2G8T4X8 Phosphate-binding protein PstS n=10 Tax=root TaxID=1 RepID=A0A2G8T4X8_9BURK  ali  34  6...LLASMIIGSSAILTTTGAMAADMTGAGATFPYPIYAKWAEMYKKTTGNGLNYQSVGSGAGIKQIKAKTVDFGASDMPLKAEELAA--DGLVQFPAIMGGVVLVVNMPGLGQMKLTGPVVADIYLGKITKWNDPQIAALNPGVKLSDDEITVVHRADGSGTSFLFTDYLSKTSADFKAKIGAGTAVKWVLGVGGKGNEGVAANVQRIKGAIGYVEWAFAKKNKMAHAQLKNRDGVFVQPDDETFKAAAANADFGVVLTDQAGKAAWPITGASYILMHKTQA----DGVKGKEVLKFFEWAYKN-GTATAAELDYVPMPANVIKLVEAGWKALKAAGKPIW. 347
61 0.000e+00UniRef50_I3Y8Q8 Phosphate-binding protein PstS n=5 Tax=Proteobacteria TaxID=1224 RepID=I3Y8Q8_THIV6  ali  30  8...VAAFAVALTLLLSLPAQAQQVRITGGGASFPFPLYSAWFRHFNRETGVRINYQSVGSGTGVRNFINRTFDFGASDAAMTDEEIAQVRGGALILPMTAGEIVLAYNLPGVDNLRLPRAVYPLIFSGEITNWSDPRIVAANPGASIPDRTIRVVRRSDSSGTTFVFTQHLSAINESFRTRVGTGTSVPWPNIIGAPRNDGVTATVNQTEGSIGYIEYFFATSTGAQVAMLENAAGQFVAPSDASGQAALAGADLRIWVTDPADPAAYPIVTFTWMLFFREHGNERISA----ALRDFVTWAL-ADGQDMASDLGYIPMPKTVVERVQAEIPNI......... 342
62 0.000e+00UniRef50_I1YKD7 Phosphate-binding protein PstS n=13 Tax=Proteobacteria TaxID=1224 RepID=I1YKD7_METFJ  ali  32  11....LLLAGTLMGAMTSLTAQADMKLIGSGASFPAPIYSKWFKDFSKHDGVRVDYQSKGSGGGISDFINETVDFAASDAAMKDEEIAKVNKGTILLPMTAGEVVLTFNLDGVTSLNLPRDVYPEIFMGKITQWNDPKIQAANPNVTLPEKRITVVVRADSSGTSYVFTNHLSAISDAFKETVGTAKSPNWPNAVKAPKNDGIAATVKQTPGAIGYVEYGFAKLTKLPTAKLENQKGNFIEAGSESGAQALASPDLRGWVTDPSSEEAYPIASFTWLLVYKD-----MDDEKAKVMRDLIEYMVTT-GQKSADSLGYIPLPENVIEKVRNAAKMIQ........ 352
63 0.000e+00UniRef50_W6MB55 Phosphate-binding protein PstS n=256 Tax=Bacteria TaxID=2 RepID=W6MB55_9GAMM  ali  31  6..LTSAMIVLLGAASIAPASAQDLRLTGSGASFPFPLYSSWFKDFGKQTGVTVDYQAKGSGAGIQDFTNNTVDFAASDAAMSDEEIAKIKQGVVLLPMTAGEIVLSYNLEGVKELKLPREVYPDIFAGKITQWNDPKIAAANPGVKLPDQKITVVARSDSSGTTFVFTGHLSAINAAFKSSVGHGTTVQWPTFVKAPKNDGVTATIKQTPGAIGYIEYTYAIATKQPMAVLQNKAGQYIAPGDEAGKAALAGADLRVWLFDPAGAQAYPIATFTWMLFYKDQ-----DDAKAKVLRELVEYGLT-KGQAMAPKMGYIPLPESVVAQVRKAAALIQ........ 347
64 0.000e+00UniRef50_A0A0C5CCW0 Phosphate-binding protein n=9 Tax=Thaumarchaeota TaxID=651137 RepID=A0A0C5CCW0_9ARCH  ali  34  7SILLIATLVAADSMPDAPDANVEFNLTGAGATFPFPLIDLWRVEYNKYNNVNLNYQSIGSGGGIKQHIEKTVNFAASDKPMSEKERDLAK-GTLHIPESIGGVVLVYNLPEVPNLKLTADVVAKIFLGEITKWNDPAIAAENPGLNLPDKEIVTAHRSDGSGTTFIFTDYLTTVSPKWDEQIGKGKSVPWPSGLAAAGNEGVAGIVKSTAYSIGYIELAYAFQTGMSFAFIENADSAFIEPTLDSISAAAEESWVGVSLVNAPGSDSYPLASFTYLLVYDDLKPVTKNKEQAKAVIHLIHWMIT-DGQEFSSSLLYVPLADKVKEIGKQGLSKITYDGEVLW. 368
65 0.000e+00UniRef50_A0A1V2GW66 Phosphate-binding protein PstS n=4 Tax=Acetobacteraceae TaxID=433 RepID=A0A1V2GW66_9PROT  ali  34  2.................GAVAQQATITGAGASFPNPLYQKWGEAARSAINIQLNYQSVGSGAGQAQIRNRTVDFGASDAPMTAEQLQEH--NLLQFPATMGSLVAIVNVPGVEDMRLTGEVLADIYLGKITKWNDPRLVEMNPGLSLPNLAIAPVYRADGSGTTFVWVSYLSAVSGDFKTRVGVGTSVRWPSGTGARGNEGVAGTVRNVRGAIGYVEHAYAMQNKLVTTQLRNRAGNYVEPTTAAFQAAAANADWTASLIDTQGATSWPIVSPTFILLPRNPT----DATRAQNVMKFFDWAF-RSGDATATELDYIPVPEAVENAIRAAWATIQVDGKPVW. 326
66 0.000e+00UniRef50_A0A0J1I834 Phosphate-binding protein n=3 Tax=unclassified Peptococcaceae TaxID=208050 RepID=A0A0J1I834_9FIRM  ali  33  18AVSITGCGTAAPNSAQASANSGPVSLTEAGSTFVQPLLTRQVAKYQENPNVKISVQGGGSGFGIAQLQKQLLDFGASDAFMSDADLAKAQGGILELPIALGSVTISYNVPGLPQIKISPDTLADIYLGKISNWNDPKLAKDNPGVKFPNLAIVPVHRAEGSGTTSIFTHYLASVSPEWASKVGKGISVNWPNVIGEKGNPGVAGAVKNTTGAIGYIELAYALENNIPYAYMHNKAGKWVLPSLEGAAADAAPEDMRVNIVNAPGDAAYPISGFSWALVYQKQT----DKAKGEALVNFLKWDFT-KGQSLAPSLQYVPLPDNLTKREIDMLKTITYNGQPLLK 369
67 0.000e+00UniRef50_S0F065 Phosphate-binding protein n=3 Tax=Chthonomonas TaxID=1077265 RepID=S0F065_CHTCT  ali  35  2..........LLLMVSGYALAQSVTLRGAGSTFAAPIYTQWFAEYKKETGVSVDYQAVGSGAGINALKNRTVDFGATDAPLTDSDLKQMPFPVVQIPTLGGAVVMTYNLPGVGSLRLTPEIIADIYMGKIKKWNDPRILAINFIKNLPDLPIHPVHRSDASGTTYIFTSFLTKAVPEWAKQIGSGKSVSWPVGIGGQGNPGVTANIMRTKGGFGYVELAYAIQNHLPLASVRNAAGNFVTPSVTTTNIAIGQYDIRTPTVYAPGVNSYPICGLTYVLIYQHGGSNPGP------VTKLFSWAMGEKAQEMGEKLYYAPLPPSLIKLNLAALK--TVQGAQV.. 331
68 0.000e+00UniRef50_Q89VF5 Phosphate-binding protein PstS n=1638 Tax=root TaxID=1 RepID=Q89VF5_BRADU  ali  32  10......TIVAAGLVAASTTAAFAADITGAGATFPFPIYSKWADAYKKETGNGLNYQSIGSGGGIKQIQAKTVTFGASDAPLKAEQLEK--DGLVQWPMVMGAIVPVVNIEGVKPGEMDGETLASIYLGKITKWDDAAIKKLNPNLKLPSDAITVVRRSDGSGTTFNFTNYLSKASADWKSKVGEGTAVEWPVGVGAKGNEGVSGNIGQTKNSIGYVEYAYAKQNKLTYTGLVNKAGKPVQPTVEAFQAAASNADWAVILTDQPGEKSWPITAATFILMHKDAT----DKAASQEAIKFFRWAFKNGG-KAAEELDYIPMPEGVVTLIEKTWAA.......... 337
69 0.000e+00UniRef50_UPI00037408CC phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Enterobacteriaceae bacterium LSJC7 TaxID=1224136 RepID=UPI000  ali  34  30..........................TGAGATFPAPVYAKWADTYQKSTGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLA--EDGLFQFPTVIGGVVLAVNLPGVKELVLDGATLGDIYLGKIKKWDDPAIAKLNPELKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKSKVGAGSTVKWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNSLAYTRLISADGKSVSPTEDSFSNAAKGADWSQDLTNQKGDDVWPITSTTFILVHKE----TKKPEQAAEVLKFFDWAY-KEGASQANELDYASLPDSVIEQVRAAWKTIKSSGKALY. 346
70 0.000e+00UniRef50_I4ED71 Phosphate-binding protein n=5 Tax=Bacteria TaxID=2 RepID=I4ED71_9CHLR  ali  36  32............PATSNPAGGGTVSLTGAGSTFVNPFFSQAFSQYSKHPNVRVNYQSIGSGGGIKQFTAKTVDFGASDVPMKTEELAQANGNVIQIPVALGAVAIVYNLPGVKSLKLSPEAIAGIFLGKITKWNDLAIAGKNPDLNLPDQDIAVVHRSDGSGTTYIFTDYLASISPEWKQGPGTGKEVAWPVGVGGKGNEGVAAQVQQAPGGIGYVELAYANQAELTHADIQNKDGQFITPTLDATTAAAEQSPENFSIVNAPGAQSYPIAGYTWGFLWEKYA----DQQKAKELTTLMGWVVTSAQNQFAAALTYAPLPVQVRKLATDSIAKVQSG...... 361
71 0.000e+00UniRef50_A0A1H7C8K6 Phosphate-binding protein n=1 Tax=Deinococcus reticulitermitis TaxID=856736 RepID=A0A1H7C8K6_9DEIO  ali  38  4......TLLGLSALLTISTAAAQGTITGAGASFPFPLYSKMFSEYKAAN---VNYQSVGSGSGQKQILERTVDFAGSDNPMTDAQMKDAPGKLLHIPTAIGAVVPAYNLPGVTALNFDGPTLANIYLGKIKTWGDPAIAKLNPGVTIPPLPITVARRSDGSGTTYVFSDYLSKVSSEWKSEVGTGNSLQWPVGTGAKGNDGVAGVVKSTPGAIGYVELVYAKQNKLAFGAVKNRAGKFIVPASAAALGVVIPNDTRVSLTNSANANAYPIASFTYVIFYQDQKYGNRAEAQGKSLKNMLTWMVTT-GQQYNEALDYAKLPANVAAKARTIINSMNYGGKKL.. 339
72 0.000e+00UniRef50_C2MDU3 Phosphate-binding protein n=60 Tax=root TaxID=1 RepID=C2MDU3_9PORP  ali  49  8..ALVLIPIALMTASCAGKGGRVTQLDAAGATFPLPYYTEAFKAYEELSGIHVNYGAVGSGGGIRSLKDEVVDFAASDAFLSDEELAEMPREVIHIPTCMGAVVIAYNCPEITSLQLTGEIIANIYLGKITRWNDPAIAAINPDQKLPDKEISPVYRSDGSGTTNVFSDYLTKVSPDWAAQIGTGKSLKWPTGMAAKGNPGVAGVIAQTDGALGYVGSEYSFSLDIPTAKVQNQAGNFVLPSLESISAAAAGEDTRQMITNSAHPEAYPISCLTWLITYKDLSYSNHSEAEATETARLLNWMLSDKAQAITSQIHFAPLSPEMLAAAKAQLAQLTYGGNPI.. 349
73 0.000e+00UniRef50_A0A1L1PKJ6 Phosphate-binding protein PstS n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1L1PKJ6_HYDIT  ali  35  33.......................QDITGAGATFPAPAYAKWAEAFSRETGIKVNYQAIGSSGGIRQIDSRTVDFGATDAPLKDEELERKSQ--LQFPALIGGVVPVVNLRGVKPLRLTGAVLADIYMGKLTRWSDPAIKALNPNLPLPDATIAPVYRSDGSGTTFIFTNYLSKVSSDWRSRIGEGATVGWPLGTGGRGNPGVAALVARVSNSIGYVEYAYVQQSRLTHAIVQNAAGQWVAPGTEAFRAASTGVDWNASLTQQTSPEAWPITGATFVLMPRKPER----PEQAANSLRFFHWAFQN-GAELAQSLGYAALPPAVASTLVTRWEGITADGKPLFK 352
74 0.000e+00UniRef50_A0A0C1XDG4 Phosphate-binding protein n=7 Tax=Bacteria TaxID=2 RepID=A0A0C1XDG4_9CYAN  ali  31  39GATSGTATETTASSPGKLDLGGNVTLTGAGASFPAPLYLSWFDALNKYPTLKVNYQSVGSGAGVEQFTKGTVDFGASDVAMKDEEISKADQGVLLLPMTAGSIVMAYNLPDVPDLKLPRAVYTDILLGKIKSWNDPKIAAANPGAKLPNQPITVIYRSDGSGTTGVFTKHLSAISPEWKTKVGDGKSVKWPVGVGAKGNEGVTAQVTQTQGAIGYTEYGYAKQNELKFAALENKAGKIVVADDQSAAKTLEPADFRAFISDPEGADSYPIVTYTWILAHKKYP----DAAKAKAVEAMIEYGLT-EGQKQAVELGYVPLPATVVTKVAAAADAISPDYK.... 379
75 0.000e+00UniRef50_UPI00073819D0 uncharacterized protein LOC107046961 n=1 Tax=Diachasma alloeum TaxID=454923 RepID=UPI00073819D0  ali  33  6..TTIAGLVMATFSLTAVNASAAVNLTGAGATFPAPVYAKWADSYQKETGNKVNYQGIGSSGGVKQIQAKTVDFGASDAPLTDEKLA--EDGLFQFPTVIGGVVLAVNVPGIKELTLDGKTLGDIYLGKIKKWNDAAITKLNPGVKLPDQDIAVVRRADGSGTSFVFTSYLAKVNAEWKEKIGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKAVQPTGQSFSNAAKGIDWSQDLTNQHGADAWPITSTTFILVHQKQEK----PEQGAEVLKFFDWAFKKGGEQAVA-LDYATLPTEVVEQIRAAWKTISYGG..... 349
76 0.000e+00UniRef50_Q7NZI4 Phosphate-binding protein PstS n=115 Tax=Bacteria TaxID=2 RepID=Q7NZI4_CHRVO  ali  33  7.......LAAILGSTLIAGSVYAADITGAGATFPYPLYAKWAATYKGSTGNNMNYQSIGSGGGIKQIQSKTVDFGASDMPLKPEELEKAG--LTQFPTVMGGVVPVYNIPGIGQIKFTGPLLADIYMGKVSKWNDAAIAKLNPGVKLPDQRISVVRRSDGSGTTFIFTNYLSKVSPEWAKDVGSNTAVSWKGSVGGKGNEGVANYVSRIKGAIGYVEYAYAKQNKLAYGLLQNQAGAFVKPDEASFKAAAANADWYLLLTNQPGKASWPIAGATFILMHKKQDK----PAQAAEVLKYFDWAYKN-GDKTAQELDYIPMPDNVKGVIRTSWKQITDGGKAVW. 344
77 0.000e+00UniRef50_T0RQS4 Phosphate-binding protein PstS n=3 Tax=Bacteriovoracales TaxID=2024979 RepID=T0RQS4_9PROT  ali  39  18.....................AATQINGAGATFPYPLYSKWFSEYSKNKDIQINYQAIGSGGGIRQLIQETVDFGASDAPMSDNDKSKATRQILQIPTVLGAVAISYNVSEVTAIKLDGDTLAKIFLGEISKWNDPKIAALNEGLKLPAKDILVVRRADGSGTTSIFADYLSTVSKDWETQVGRGKTLKWPTGIGAKGNDGVTGAISQNDGAIGYIELAYAINNNLKVAALKNKAGEYKLPTVQGVSLAAAKSEVTNSIVDADGKGVYPISSFTYILLPVKEKD-----AKIVEVKKFLKWALS-KGQNFAAPLHYAPLPKRL---ALEMLKEIK........ 328
78 0.000e+00UniRef50_A0A223NTF1 Phosphate-binding protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A223NTF1_9SPHI  ali  40  26.....................QDNTLLGAGSTFVYPLFSKIFAEYATKTNVKVNYQSIGSGGGILQLTNKTVDFGGSDAPLNADQAKKIGAPVLHIPMASGAVVVTYNVPGTTGLNLNGAVLGDIYLGKITSWNDPKIAALNKGTKLPETPIVVIHRSDGSGTSFIFTDYLTKVNADWAAKVGKASAVNWPAGLGGKGNEGVAGLVKQTPGAIGYNELAYAIQNKMAYADIANKTGKFITPTLESTSNVELPANAEVSLTNTDNPKGYPITSFTWALIYKEQKYSDRSAARAKELLKLLWFNI-HDGQKNCAPLNYAPLSKSAVKVAEKILKSATYDGKAIL. 349
79 0.000e+00UniRef50_A0A1F4TMH5 Phosphate-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F4TMH5_9BACT  ali  35  36..........................NGAGATFPYPLYMKWNNVYAKETGVKVNYQGIGSGGGQRQFIAGITDFGGSDAPMTDKQINSAGGDVLHIPTVMGAVAVSYNLSGVGSLNLDADTLAGIFLGKIKKWNQV-------DSSFPDKDIIVCHRSDGSGTTDIFTSYLAKVSLDWASKVGAGNAVAWPVGLGGKGNAGVAGLIKVNDGSIGYVELSYAIENKLTVAALKNKAGIYVVPSLDSTSAAADGADFRLDLTNALGARSYPIVGMTWLLVHKKQA----DAKKGQALVDYLKWVL-NDGQQYAPELLYAPLPQNIKSKVLAVVEGIK........ 345
80 0.000e+00UniRef50_K1Q6S2 Phosphate-binding protein pstS n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1Q6S2_CRAGI  ali  37  10ATTLFTALFVGFATLVTACGKEEKTILGSGASFPYPVYSKMFEDYLEKTGVRVNYQSIGSGGGIRQLLAQTAEFGATDAFMDDEELQQSEDEILHIPIVLGGIAVAYNLSEKIELRLDGDTLAKIFMGDIKKWNDPQISALNQSVNLPDKEIIVIRRSDGSGTTFGFSDFLAFSNEKWKNSYGVSKSIKWKDTIGAKGNEGVSGQLKNTDGSIGYVNLNYAKTLDIPLAAIKNGSGNFVKPTIKSISLAADDTRVRLSASSTLGEG-YPISSFTWIVLYKEQAYNDRTKEQAEKLHDLLSWMVT-EGQQHAEPLYYSPLPQKISGKVLKVLETMT........ 348
81 0.000e+00UniRef50_Q7N9U7 Phosphate-binding protein PstS n=821 Tax=root TaxID=1 RepID=Q7N9U7_PHOLL  ali  30  6..TTVTGIMAAAFSLTTLPVFAATSLTGAGATFPAPVYAKWADSYQKETGNKVNYQGIGSSGGVKQILANTVDFGASDAPLSDEKLAA--DGLFQFPTVIGGVVLAVNIPGIKELTLDGKTLGDIYLGKVKKWNDPAITQLNPGVKLPEQDIAVIRRADGSGTSFVFTRYLSKVNKAWQEKVGVGSTVSWPIGLGGKGNDGIAAFVQRLTGSIGYVEYAYAKQNHLAYTKLVSANGNIVSPTEESFSAAAKKAEWAQDLTNQQGENVWPMTSTTFVLVHQQQ----KDAVKGAEILKFFDWAY-EKGSKQANDLDYATLPKEVIEQVRAAWKTIKSNGKALY. 346
82 0.000e+00UniRef50_A0A235IB37 Phosphate-binding protein n=39 Tax=Cyanobacteria TaxID=1117 RepID=A0A235IB37_9NOSO  ali  30  22...AIAILLSIASCTAGNKSIKHVSLVGAGASFPAPLYERWLADYQQNPNVQINYQAIGSSAGVQQLIEGTVDFAASDVGITNEQAAKIKKGVIALPMTAGSIVLAYNLANLPNLNLSRQVYVDIFLGKITNWNNPRIAVANPGVNLPNLPIQVVHRTDGSGTTSVLTQHLSTISLEWKSQVAAGKAVAWPVGIGGKGNEGVTALIQQIPGAIGYVEYVYAKQNKLPMAALENKFGNYITPTPESVAQTLEADNLIAFINDPTGSQSYPIVTYSWLLTYQQYP----NRVKGKALKKFIDWAL-IEGQKSSLELGYIPLSKKVVLQVQSAANKI......... 362
83 0.000e+00UniRef50_W9UZW1 Phosphate-binding protein PstS n=2 Tax=Chromatiaceae TaxID=1046 RepID=W9UZW1_9GAMM  ali  29  9SLSLILACWMATSVGTSALAAETMKIVGAGASFPAPIYLRWVRDYYAHPDVQIDYQAIGSGGGIANLINGMLDFAGSDVPMKPEDAAKVEGGIVQLPMTAGAIVIAYHLPGFSELKLSREAVSGIFLGNISNWNDPAIAATNPGVDLPDMPIFVVTRGDSSGTTFVTTRHLGAISTQFAEDVGIDMNPDWPKALKGLGNGGVAAYIRAIPGSIGYLQYAYAHLTNMQMVELQNRAGEFVPPSGEYFRQAIESFRADLDLSDPKGDGSYPVLSLSWMILHKDYPD-----DKAAVIKDFLRYALT-DGQQVADLLGYIPLPAEAVKAILEKVEEI......... 347
84 0.000e+00UniRef50_A0A136JZS4 Phosphate-binding protein n=1 Tax=Chlorobi bacterium OLB4 TaxID=1617411 RepID=A0A136JZS4_9BACT  ali  34  9AVILFSVILLSCSRKSGNPKKGSEQINGAGATFPFPVYSKWVHEFQKNPKAKINYQSIGSGGGIRQVTEKTVDFGASDIPLSDEIMSKYSTRLLQFPTVIGSVVLTFNLPGLQNINLTQNAVVGIYSGSIKKWNDTGIVNSNPGVNFPDKEIVVCFRSDGSGTTYVFTDFLGKVSTDWREKVGVGQSIRFPVGQGAKGNEGVTGLVKQIEYSIGYVEYVYAVQNNLNYANIQNPAGQFVTPSIESLMKAAEPDDLGQSITNSGGDNTYPISSYTYIMVYENQD----DPVKGGILKSFLLWAVT-EGSIFAKNLGYAPLPEVVIQKVKGRLNLLNHNGKSL.. 358
85 0.000e+00UniRef50_A0A2U1W1V7 Phosphate-binding protein PstS n=2 Tax=Azospirillum sp. TSO22-1 TaxID=716789 RepID=A0A2U1W1V7_9PROT  ali  31  10...AALGLCAAVAFSGASVAAQAADISGAGATFPYPIYSKWADAYKKQTDVGLNYQSIGSGGGIKQIKAKTVTFGASDMPLKPQELDEAG--LVQWPQIMGGVVPVINLKGLKEIKLSGTVLGNIYLGEVKKWNDDQIKALNPGVNLPNTAIAPVYRSDGSGTNFLFTDYLSKASPKFGTQIGANTSVQWPAGIGAKGNEGVANMVKQTEGAIGYVEYAYAKQNNIPYAALKNKDGNVVMPTIQAFQAAAANADYYVILTDEPGAESWPITGASFILMHKAP----QDPATATEALKFFDWAFKDGG-KLASDLDYVPMPDNVVQMIRKTWDQIKAGDKPVW. 350
86 0.000e+00UniRef50_A0A1M3N7A6 Phosphate-binding protein PstS n=1 Tax=Myxococcales bacterium 68-20 TaxID=1895795 RepID=A0A1M3N7A6_9DELT  ali  33  8.LAVVIGFVASGALAAASSCTRSGDIDGAGATLPYPLYAKWSSEFARDTSVRVNYQPLGSGAGIRQTCDGVIDFGATDEPMTDEQMKSSPVPLVHVPMTIGAVVVTYNVPGVKELKLTPGVVADVFRGAVRSWDDPRVRETNPNVTLPAKPITVVHRADGSGTSATFTTFLSKSSDAWRADVGSGVSPRFPIGVGARGNDGVTAYVKATPYAIGYVELAYARQANLPIALVKNRAGNYVEPTLAALDRAAQPDDLRLSIVDSEAEAAYPIAALSFLVIPRD----AENRPKAEALARFVWWGL-HDGQRYAADLGYAPLPPEIVTRATEAVRGLRAEGKPI.. 353
87 0.000e+00UniRef50_D3P7G1 Phosphate-binding protein PstS n=37 Tax=Bacteria TaxID=2 RepID=D3P7G1_AZOS1  ali  31  9..AAFGALAVLSVSVAPLSVASAADISGAGATFPYPIYAKWADAYKKDTGTGLNYQSIGSGGGIKQIKAKTVTFGASDMPLKPEELEQAG--LIQFPMIMGGVVPVVNLKGIKAVQLSGTVLANIYMGEVTKWNDPQIKALNPNVNLPNTAIAPVYRSDGSGTNFLFTDYLSKTSPKFKTQIGANTSVQWPAGIGAKGNEGVANMVKQTDGSIGYVEYAYAKQNNITHLDLQNKDGKTVSPKIEAFQAAAANADWANSLTDEPGAGSWPITGASFILMYKAP----QDAASSAEALKFFDWAYKN-GAKMATELDYVPMPEAVVSLVQKTWQSIQADGKPVW. 350
88 0.000e+00UniRef50_UPI0001746050 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Verrucomicrobium spinosum TaxID=2736 RepID=UPI0001746050  ali  33  46......................QVMLKGAGATFPYPVYSRWFSEYQKHDSVSFEYGYIGSGGGQKEILARNVDFGASDAPLSDEQLAKADGKILHIPTVAGAVVVACNVPGGDAIVLNGDAVAALFLGNITRWNDPRIAQLNPKLNLPDLPVTVVHRSDDSGTTAIFTEYLAKVSPEWKDKLGHGKSVAWPTGQKGKGNKGVAEVVKATPGAVGYVELAAALQEKLPHAALINSEGNPVRASVETILAALTTADFRFSVTNAPGESAYPIVGATWLLVYRD----GKDLARNRKLVQFIRWALT-RGDDLAINMHYAPLPTPLEQQVLTALKKVKV....... 359
89 0.000e+00UniRef50_A0A2E0HEJ3 Phosphate-binding protein PstS n=9 Tax=Bacteria TaxID=2 RepID=A0A2E0HEJ3_9GAMM  ali  35  9..TLVAGLCLVLGTLSTAGFAEEVRLQGSGASFPFPIYSKWFRDFSKHDDIRVDYQAKGSGAGIRDYINEVVDFAGSDAAMNDEEIKDAKRGVVLLPVTAGEVVLTYNLDGVKSLKLPRDVYPDIFSGKISKWNDPRIAKANPGVKLPDSDITVVVRSDSSGTTYVFTGHLSEINDTFKQEVGQGKAPQWPRFVKSPKNDGITATVKQTPGSIGYIEYGYAKLTKMPVAMLENKSGNFVSPGPESGSAALASADLRAWVFDPAGAKAWPIASFTWLLIPQEMP-----KEKAEAMHKLVEYSIT-EGQKIADSMGYIPLPENVVETVRDVAKHVKAK...... 354
90 0.000e+00UniRef50_A0A1J5PQ48 Phosphate-binding protein PstS n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5PQ48_9ZZZZ  ali  29  245..TITLGAAVATFTITLAGASFAAEISGAGSSFIYPVFAKWGDTYKKATGTGLNYQSIGSGGGIKQVEAKTVTFGASDMPLSDADLTKNG--LTQFPMISGGIVPMYNIEGVKPLVLDGKTLVGIYMGTITMWNDPAIVALNKDLKLPAEPIVVVHRSDGSGTTFNFTDYLSKMSPEWKDKIGSDTAVEWPVGLGAKGSEGVANTVKQTAGAVGYNEYAYVIQNNLGYAKMLNAAGKVVSPSLETFASAASNADWAGTITNQPGDKSWPIAASTWVLIHTNPA----DPKAAGEALKFFDWAY-KSGKDEAKTLDYVAIPDNVVALIEKAWSTILSGGKPVM. 586
91 0.000e+00UniRef50_A0A1F9ISP0 Phosphate-binding protein PstS n=9 Tax=Bacteria TaxID=2 RepID=A0A1F9ISP0_9DELT  ali  30  4...LIVCIALAISLLVSGKGFAADTLNGAGATFPYPLYSAWAYSYEKETGVRLNYQSIGSGGGVRQIVNRTVDFGASDDALKPEDMTK--DSLLQWPQVIGGIVLVVNVAGIKSEEMTLDAVCSIFLGNIKKWNDPALSGLNPKLNLPNKEITVVHRSDGSGTTAVFTHYLDETCKSWHDKVGYGKSVEWPAGIGGKGNEGVANYVKRVADSIGYVEFAYAKQNNLAYILLKNPAGNVVKPTLESFAEAAASGDFNPWVTNAKGPGAWPITAATNILLAKD------KAESNKKVVKFFEWTFSAEADKTAKDLVYAPLPDALKKKVREYW---KANG..... 335
92 0.000e+00UniRef50_UPI000B3CD2DE phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Nostocales TaxID=1161 RepID=UPI000B3CD2DE  ali  33  647....................GGNVSLTGAGASFPAPLYQTWFQALRKYPNLQVNYQSIGSGAGVEQFIKGVVDFGASDVAMTDEEIKKVERGVLLLPMTATSLVLAYNLPGVQELKLPRDVYIGIFLGTIKSWNDPKIAVANPGVKLPNQPITIVHRADGSGTTGVFTRHLSAISPEWKSKVGDGKTVNWPAGIGAKGNEGVTAQIQQTQGSIGYVEYGYAQQNKLNCAALQNKAGQFVTPSERSASKTLEPENLRVFITDPEGQSSYPIVTYTWILAYKKYPDAAKAKAMEAM----IEYGLT-EGQKVAPQLGYVPLPENVVKKVAAAADAISPDYK.... 966
93 0.000e+00UniRef50_P0AG82 Phosphate-binding protein PstS n=1242 Tax=root TaxID=1 RepID=PSTS_ECOLI  ali  33  25.....................AEASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQ--EGLFQFPTVIGGVVLAVNIPGLKELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSQDLTNQKGEDAWPITSTTFILIHKDQKK----PEQGTEVLKFFDWAY-KTGAKQANDLDYASLPDSVVEQVRAAWKTIKSSGKPLY. 346
94 0.000e+00UniRef50_A0A2H0XY09 Phosphate-binding protein n=1 Tax=Candidatus Saganbacteria bacterium CG08_land_8_20_14_0_20_45_16 TaxID=2014293 RepID=A0A2H0XY09_  ali  36  16.................ASIACANMLNGAGATFPYPIYVKWNKMFADKTGIKVNYQGIGSGGGVQQFSAGVTDFGGSDAPMTDKEIAKAGGNVLHVPTVMGAVVVIYNLPGNPKVKLDGETLADIFQGKIKNWQQV-------DRSLPDLEIKVCHRSDGSGTTSIFTGYLAKVSLDWASNVGAGKAVAWPTGIGGKGNSGVAGSVKNIKGAIGYVELSYAMTNDLPMASLKNKAGVYVKASLDSTSAAASGADFRLDLNNAPGKDSYPIVGMTWLLVHKTQN----NSAKGQDLVAYLKWALT-DGQKYAADLLYAPLPKNIAAKVLEQVDTIK........ 334
95 0.000e+00UniRef50_A0A2T6NVC5 Phosphate-binding protein PstS n=2 Tax=gamma proteobacterium symbiont of Ctena orbiculata TaxID=1968598 RepID=A0A2T6NVC5_9GAMM :_  ali  33  17........LAILSIGLKGCLGEHIEVHGAGASFPAPIYARWRALYREHPDISIHYRAVGSGRGIKAITAGEVDFGASDALLKKSEERALRQPLLSIPTVMGPVVLAYNLPRLGEVTLSGDLIAGIYLGEITHWNDERIALLNPGINLPALPIRVAHRSDSSGTTHIFTDYLSEVSEEWRNDVGRGKRVFWPTGNAGDGNDGVAHRILLEPGGIGYLELKYAQNAGLNYAALINRAGKRVRPTAKAVQEAEQNTPASPSIVNAPGEGSYPISAFTYLLVYRD--ISDMESHRAHALIDFLKWVL-NEGQPEARKLHYVPLPEELRLQVLEDVASIK........ 350
96 0.000e+00UniRef50_F8EU60 Phosphate-binding protein PstS n=7 Tax=Proteobacteria TaxID=1224 RepID=F8EU60_ZYMMT  ali  32  6.......AALVGFMSLLGSSAYAMTISGAGATFPAPVYGKWANDYRSKTGIVINYQPIGSGGGIKQINASTIDFGASDKPLKTDELSK--GGLYQFPTVMGGIVPIVNLPGSGRLHLTGSLLADIYLGKITKWNDNRIASINPWLKLPAVPITVVHRADGSGTSFQFTSYLTLKSSEWASRVGASDAVQWPSGLGGKGNDGVAAFVKQTVGAIGYVEYAYTRQSTVPYALIANYEGQFPHPSTESFTAASAAADWTISLLDQKGKNSWPLVSTTYILLHKTPNK----PETTTEVLKFFDWAYQN-GDSAALSLDYAPLPKEVKTFIRQQWHNIQVNGKPVY. 342
97 0.000e+00UniRef50_A0A2V7KGD8 Phosphate ABC transporter substrate-binding protein PstS n=3 Tax=Bacteria TaxID=2 RepID=A0A2V7KGD8_9BACT  ali  37  22......................QVQLNGAGATFPNIIYSNWMLTYNKHPDVQLNYQSIGSGGGIRQFSDGTVDFGATDAPMTDSAITAIGGNALHIPTVLGAVVAAYTLPDVQPVRITADVLADIFFGKVTKWNDARLASTNPGVTLPNQDIIVVHRSDGSGTSFVWTDYLSKVSPEWAQKVGKGPSVNWPVGLGGRGNEGVAATVRQTPGAIGYVELGYALINKMPFAVLRNQAGNWITASLESVTAAAAGGDFRVSITNSPGAQAYPAASFTWLLVHKTYS----DTAKARALVQFIWWAET-EGQAKTHELGYAPLPQELRPWIQARLKTVSAGGRAVWK 347
98 0.000e+00UniRef50_E1YHX1 Phosphate-binding protein PstS n=1 Tax=uncultured Desulfobacterium sp. TaxID=201089 RepID=E1YHX1_9DELT  ali  37  15.........................IKGAGATFPYPLYKTWVETYYNKTGIRIDYQAVGSGSGIKQLFNGKVDFGATDAYLSDAELKKAPGQILHIPTCVGAVAICYNLPLKSILKMTPELLSKIFMGKVTNWSNNEISRINPGIDFPDTKITIVHRSEESGTNFVFTNYLSKASREWKDNIGCGKTVRWPVGIGVEGNPGVVNYLKKIPGSIGYVELTWAKKNQMPAAMIQNRKGNYIEPTLKSLSEAAKPSDTRVLITDTDAPEGYPISSFTWLIFYKEQANNQRNREEAAALLKFLLWAI-KDGQHFNKTLHYAKLPEEAVSYAEKIIKSITYGEIPI.. 336
99 0.000e+00UniRef50_A0A1G3ZEK7 Phosphate-binding protein n=1 Tax=Verrucomicrobia bacterium RIFCSPHIGHO2_12_FULL_41_10 TaxID=1802433 RepID=A0A1G3ZEK7_9BACT  ali  31  54.........................VNGSGATFPAPLYQRWAADFQEHPDIVVNYQGVGSGAGVSDFIRGLTDFCASDVAVKDEEIARLHGNVLMIPVTAGTIVLSYNIPGITQLKLNRDAYVGIFLGKITQWNDPAIAKSNPGITFPDLPITVVTRSDGSGTTALFTGHLMTISSEFSDKVGFGKSVKWPTGLSGKGNDGVTALIKRTRGSIGYMEFGFAQSTHLPMAELENKAGAFVAPSDATGSLTLAPENLRDFSFDPIGQGTYPITGFTWLLLKKEYP-----AEKSAAIKAFVTYALT-KGQVVAPQLGYLSLPSPVVEKAQKALNGVK........ 362
100 0.000e+00UniRef50_A0A0U1HPW0 Phosphate-binding protein PstS n=50 Tax=Proteobacteria TaxID=1224 RepID=A0A0U1HPW0_YERRO  ali  34  6..TTVASIVAATLSMTTVSAFAAASLTGAGATFPAPVYAKWADSYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLAA--EGLFQFPTVIGGVVLAVNIPGIKELTLDGKTLGDIYLGNVKKWNDPAIVKLNPGVNLPDQNIAVVRRADGSGTSFVFTSYLAKVNADWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSAAAKGIDWSQDLTNQKGADVWPITSTTFILLHKEQ----KNPEKGTEVLKFFDWAYKNGAQQ-ASALDYAPLPNEVVEQIRAAWKTIKSSGKALF. 346
101 0.000e+00UniRef50_UPI0009DCD5C9 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Thermorudis peleae TaxID=1382356 RepID=UPI0009DCD5C9  ali  32  3.ATTASGGTVTTVRITGPYTGEAKALTGAGSTFAAPLYTKWSSDYEKLTGVKINYQAIGSGGGIKSLQDMTVDFGATDAPMTDEQMQQAKGGPIHIPTALGGVVLTYNIPGKDPLKFTPETLAGIFLGTITKWNDPKLVADNPALANINKPIVVVHRSDGSGTTFILVSYLAAVSADWKSKVGVGTSVNWPVGIGGKGSEGVSGAVKQNPYSIGYVELIYALQNKIAYGMVKNKAGNFVTASLDTVTAAAAPADLRAIIVNADGANAYPISGFTWILAYQN----MQDQAKAIALTRYLWWGLT-DGQQYHKDLGYAPLAPEVTALALQKVRQITVNGQPAF. 348
102 0.000e+00UniRef50_A0A2H0QKQ1 Phosphate-binding protein PstS n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2H0QKQ1_9PROT  ali  36  4.......ILAVVLLGLGFNAFGMTKINGAGATFPYPIYSKWFSEYKKNAEIEINYQSIGSGGGIRQVLKQTVDFGATDAPMNAKDKSEAPYKISHIPTVLGAVVPVINVKAVNGLKLDGETLAQIFMGKITKWNHPTLLKLNPKAKLPNEDILVVRRADGSGTTSVFADYLSTVSKDWESTVGRGKSLQWPVGIGSKGNEGVTATVKQTEGAIGYVELSYAITNKLSMVAMKNKAGQFVSPTVESISKAAEGANYTASIVDSSAKGAFPIAAFTYLLLPEK-----NDDMNNKEIRKFIKWALT-DGQKFAKDLYYSPLPKKVAKQVLEKLK........... 328
103 0.000e+00UniRef50_A0A2G8HYF6 Phosphate-binding protein PstS n=2 Tax=Bacteria TaxID=2 RepID=A0A2G8HYF6_9PROT  ali  37  21.......................TKVNGAGATFPYPMYSKWFSEYNKNKDVQFNYQSIGSGGGIRQLIKQTVDFGASDAPMKEKDKKKAAWPVKHIPTILGAVSIAFNLEMSGTLKLDGATLSEIFMGSISKWDDERIKNLNPGLKLPNKDILVVRRADGSGTTSIFSDYLSTVSKKWEEKVGRGKSLKWPVGIGSKGNEGVTATIKQTDGAIGYVELAYALKNNLPTVALKNKAGEFTKPSVKGVSLSAANAAVTTSIVDAAGKGVYPISAFTYILLPVKKED-----AQLKEVKKFLNWALT-KGQSMAEELHYAPLPKSLATRMLNEIK........... 328
104 0.000e+00UniRef50_A0A0J1FXJ8 Phosphate-binding protein n=10 Tax=Bacteria TaxID=2 RepID=A0A0J1FXJ8_9FIRM  ali  32  18AISLVGCGSTQSSSGTQQTSDAAVTLTGAGSTFVQPLLMQQVAEYQKHSNVTINYQGGGSGFGIQHLSDQTIDFGATDAFMTDDQLSKAGGKVLQLPVALGAVTLSYNVPGIPEIKISPENLANIYFGKIKNWNDPALAKDNPDVKFPDLAIIPIHRSEGSGTTSIFTHYLSAISPDWNSQVGSGTSVNWPNALGAKGNPGVAGAVKSTSGAIGYIELAYALQNKIPYAYMFNKDGKWVLPSLEGASADAAPDDMRVNIVNGPGAAAYPISGFSWALIYQNQT----DKAKGTAMVNFLNWAL-HDGQKLAPSLSYVPLPDNLTARETAMLKTVTSGGQPLLK 369
105 0.000e+00UniRef50_A0A1G1CEG8 Phosphate-binding protein n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1CEG8_9BACT  ali  40  15.........................LTGAGATFPAPLYMAWFERYCRDTGQRVIYDSVGSGAGTQKILKREVDFGASDAFIGDDDLAFAPGKLLHLPTCVGAVAITCNLPGNPTLRLSPETLVDLFKGKIQRWSDPRLARENPDIKLPDLGVVVVHRADASGTTFIFSDYLTRVSNQWRNTVGRGKTLRWPVGMGADGNPGVADMVQRIPGAIGYMETMYATARNLPTVAVRNLAGQYVTPTLASVSAAAQPDDTRVYLANTSAATGYPITGFTWVIFYREQAYGQRSPDRAQRLANLLWWMI-HDGQADTQGLHYAPLPPEAVAKAEAVLRSIRYNGKPIL. 333
106 0.000e+00UniRef50_A0A2N2GLC8 Phosphate-binding protein PstS n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22 TaxID=2013750 RepID=A0A2N2GLC8_9D  ali  30  44...........ASPGAPSDLKVASELTGAGATFPFPLYSKWADAYGKEKGLKLNYQAIGSGGGVAQIKKKTVDFGASDEPMKPADLEK--EGLFQFPMAIGGVVPVVNIDGDGALKLSPSVLCGIYLGTITKWDHEEIKKLNEGLSLPARDIAVVYRSDGSGTTWIFTDYLGRVCPAWKDKVGVGKSVQWPVGMGGKGNPGVAAYVKQTGGAIGYVEFAFALQNKLPVAQLQNRAGMYVRPAIESFMAAAKNADWYMVLNDQPGDETWPIAGATFILIHREQA----DASKIRAIFGFFDWCY-RSGAELAKKLHYVPMPESVFSLVQSRWESISSGGKPVWK 378
107 0.000e+00UniRef50_A0A1G0JN71 Phosphate-binding protein PstS n=7 Tax=Bacteria TaxID=2 RepID=A0A1G0JN71_9GAMM  ali  36  10AGTAAALLTSGNPALANCPTKGVKEMTGAGATFPYPLYSKMFDEYNKICGVKVNYQSIGSGGGIRQLQQQTVEFGGSDGIMNEKQKQQAGGNVMHIPTVAGAVVVIYNLPGAEKTQLTPDVLADIYLKKIKTWGDARIKALNPSAKLPTQDIAVVHRSDGSGTTFIFTSYLSKVSSEWKDRVGNATSVNWPGDIGGKGNEGVANSVKQIPGAIGYVELAYAEQNKIAYAQLRNKAGKYVQPSLESAAKAADVANLPVMVTDSSNPDAYPITGFTWLLVYENQT----DLAKADAVAQLAWWMI-HDGQKFATPLGYAPLQGVAVKKAEALIKKIKVGGKSVL. 353
108 0.000e+00UniRef50_Q9CNJ4 Phosphate-binding protein PstS n=206 Tax=root TaxID=1 RepID=PSTS_PASMU  ali  33  5......AMLLAILFSTFALTTQAQTITGAGASFPYPIYAKWASMYEKQTGNKVNYQSIGSGGGQQQIIAKTIDFGASDDPMKAELLAQHQ--LLQFPAIIGGTVPVVNLPEIGQLKLSGEVLADIFLGKIKKWNDPAIAKLNQGANLPDKAIIVVHRSDGSGTTFGWTNYLSKVSTEWKETVGQGKSVKWPTGQGGKGNEGVAAYVSKIKYSIGYVEYAYAKQNQLAWASLQNKAGQFVQPSAESFMAAAANAQWEVILTNEEGDTSWPVTAASFILLHKHAEK----PEITKAVFDFFDWAF-KQGKVAATELDYVPLPEEVIQKIQAQWKTKSSDGKTLWQ 344
109 0.000e+00UniRef50_B5E9I4 Phosphate-binding protein PstS n=207 Tax=root TaxID=1 RepID=B5E9I4_GEOBB  ali  35  10....LALALVATVGAAAGQASAETLINGAGATFPYPLYSKWFSEYAKDKSVKFNYQSIGSGGGIKQITAQTVDFGASDKFLSDQELSAAPGKLLHIPTVMGAVVVTYNVPGVPSIKLNSEDVANIYLGKITMWNDKRIADDNKGINLPAKPIIVVHRSDGSGTTSIFTDYLTGVNAEWAKKVGKGASVKWPVGLGGKGNEGVAGQIKTTPYTIGYVELAYAFENKLPFASLKNGAGVFVAPSIKSTSAAAAPADYRISLVNQPGKDAYPVVGFTWLLVYEKQ----KDAVKGKKLVEFLNWSMT-KGQKMASPMLYAPLPNSVVKMVQKTIKTIK........ 343
110 0.000e+00UniRef50_A0A0N8WAA9 Phosphate-binding protein PstS n=8 Tax=Bacteria TaxID=2 RepID=A0A0N8WAA9_9DELT  ali  44  8.......IFCLLGIFLSIGTVYSLDILGAGATFPLPLYTKMFDSYKQSTGIQVNYQGIGSGGGIRSLLDRTVDFGGTDAFMSEEEMSMAENNQIHIPTCLGAIVVTYNLPGNPTLKLTSEVVSDIFLGKITKWNDNKISQLNPGVELPDMDIIVVHRSDGSGSTFIFSDYLCKVSKEWEETVGRGKSLEWPTGLGASGNPGVAGLVKSTPGAVGYVELIYALSNDMPTAHIKNKSGNFIQPSIESVSASANPADMRVSITNTDASNGYPISGFTWIILYQEQNYDNREKTRAEEVVNLIWWMI-HDGQSHNTPLHYAPLPDEAVRNAEIILKSITYNGSPLL. 345
111 0.000e+00UniRef50_P45192 Phosphate-binding protein PstS n=999 Tax=root TaxID=1 RepID=PSTS_HAEIN  ali  31  17....................AQANSITGAGASFPYPIYAKWASLYEKETGNKVNYQSIGSGGGQQQIIAKTVDFGASDDPMKSELLQQHQ--LVQFPAVIGGIVPVVNLPEIKPLKLSGKLLAEIFLGKIKKWNDPDLVALNPTLPLPNKNIIVIHRSDGSGTTFGFTNYLSKISNDWKNQVGEGKSVKWLTGQGGKGNEGVASYVRQMKYSIGYVEYAYAKQNQLAWISLQNQAGQFVQPSNESFMAAASHAKWGVILTNETGEKSWPITAASFILLNK----YSDNPETTKNVLAFFDWAFS-RGQDAATELDYVPIPADVVSTIKSQWKT.......... 330
112 0.000e+00UniRef50_A0A2G6H7J5 Phosphate-binding protein n=26 Tax=Bacteroidetes TaxID=976 RepID=A0A2G6H7J5_9BACT  ali  43  6....FLMVVALAFLFTSCGNKNSQKISGAGATFPAPFYKVVFQNYNQATSNTVTYGAIGSGGGYRSLKDQTVDFGASDVFLKEEEMSQLNGKIIHIPAVLGAVVLSYNLDGVTDLNLTAEVVSDIFLGKITNWNDNKIKSLNPNATLPEQTITAVFRSDGSGTTAVFSEYMAKVNDAWKNIIGVGKALKFPVGVSAKGNAGVAGLIAETKGAIGYIGSEYALALNMPMAAMQNQSGNFIKATIKSISASANPEDTRVYITNSENPEAYPISTFTWLLIYKEQAYNNRSLEEAKGLKELMQFMLSKKAQSLAETVNYAPLSGMALEKAQKALEQMTYKGEPLK. 346
113 0.000e+00UniRef50_A0A1F5QQA1 Phosphate-binding protein n=1 Tax=Candidatus Eisenbacteria bacterium RBG_16_71_46 TaxID=1817856 RepID=A0A1F5QQA1_9BACT  ali  39  23...................PAAAQNLTGAGATFPYPIYSKWFDTYRQKTGVTINYQSIGSGAGIQQIKAGTVDFGASDAALSNDRLKELPRPVLHFPTVAGAVVLACNLPGKGTLHLTPEVLAGIYLGEITIWNDKRVAAVNPGVALPSAPILAVHRADGSGTTNIFTTYLSAVSGKWKELVGANTSVSWPSGVGGKGNDGVAGLVRQTPGAIGYVELAYAKQNRLPIAVLRNRAGRFVEPTLASTTAAVKGADVRAPIVDSPAPDAWPISGLTYLLVYRDQ----KNRVKGRALAELIRWAM-RDGQEMVEALDYARLPEAVVKVNEANLLELTSGGKPLL. 347
114 0.000e+00UniRef50_U5QFV7 Phosphate-binding protein n=1 Tax=Gloeobacter kilaueensis JS1 TaxID=1183438 RepID=U5QFV7_9CYAN  ali  34  29....................ALALTLSGAGATFPQPLYEKWFFEYNKNPDVKISYQGIGSGGGINQFTNKTVDFGASDAAMNDEQLQKAGGKVLMLPLTAGAVAVTYNLPGVKSLKLTRLALVNIFLGKITKWNDPAIASVNRDVKLPDLPVAVVRRSDGSGTTFIFTNHLSAIKGDWGDKVGKGTSVNWPTGIGAKGNQGISAQVQQTPGAIGYVEYAYATENNLPVAAVENREGKFVLPSVPATKAALDPENFRVFIEDPDGPASYPIVGLTWLLVYKD----NADKSKAAEIGKFVDWALT-EGQQYVEPLKYTPLPPALAERVKKAADQIK........ 347
115 0.000e+00UniRef50_A0A285NVU8 Phosphate-binding protein n=1 Tax=Hydrogenobacter hydrogenophilus TaxID=35835 RepID=A0A285NVU8_9AQUI  ali  33  4.........TTLALLTFGTITIAMEITGAGATFPQPIYTRWAAEFYKATGNKVNYQGIGSGGGIRQIINRTVDFGASDAPLEPEELNKHG--LLQFPTVIGAVVITYNVPGKTVLNLDAKAVCDVYMGKIKKWNDPYLKQLNPNVNLPDRSIVVVHRSDGSGTTWIFTNWLSKTCPEWKEKIGYGTSVKWPTGVGGKGNPGVTNYVKRSQGGIGYVEYIYAKENNLPMARIKNREGVFVEPSIKTVQSAASYAKWDKSLTDQPGKNTYPIAGATFILLAKDQPERSKKATT------FFKWAYQN-GDKYAEELHYIPMPSNVKNMIFEYWKE.......... 326
116 0.000e+00UniRef50_A0A1V5E777 Phosphate-binding protein PstS n=1 Tax=Syntrophaceae bacterium PtaU1.Bin231 TaxID=1811718 RepID=A0A1V5E777_9DELT  ali  38  37..SLCLFAGLIWLASAAASAKAQPILSGAGATFPHPLYERWIHSYSQKAPVRVTYRGTGSADGIQDLLQRKIDFGATDVSLSDREMQEAAAPILHLPTCVGAVAVIYNLEGDPDLRLTPDLLADIFLGRIPSWDHPRLRALNPSVDLPSLEIMVVHRAEGSGTNYILSDYLSKVSPHWNRERGVGKTVAWNTGLGVRGNSGVASMVKKIPGAIGYVSLNYAVGNRLPVVRVKNAGNRFVKPTVESATEAASPADWRRPITNTEAPEGYPISGFTYLIFYQEQSYSGRTKEKARALASFLWWCV-HEGQRECAPLHYAPLPETVSIQCRKILRSMTFAGSPL.. 377
117 0.000e+00UniRef50_A0A2N2PHX7 Phosphate-binding protein n=1 Tax=candidate division BRC1 bacterium HGW-BRC1-1 TaxID=2013722 RepID=A0A2N2PHX7_9BACT  ali  37  31...............ASPAKAGANRLTGGGSTFVYPLMSKWASVYHQKTKVQVNYQSIGSGGGIKQFSAGTLDFGATDGPMTEDELKLANSPVLHIPVTMGAVVVTYNIPGLKPLNLSGPTISKLFLGEVKKWNDAVVAAENPGVTLPDKGVVIVHRSDGSGTTYIFSEYLSKTSPDWQPKVGVGKSLNWPAGIGAKGNEGVAAQVMRTPGAIGYVELLYAQQSKMHVASVKNQAGEFVAPVPDAVTSAAEPDDLRMSITDSPGKGAYPVSGIVWVLAR----PEMKDRATASAVKAFLTWVLSDEGQAYAVPMNYSKLPASLLDKARAKVALIK........ 352
118 0.000e+00UniRef50_B3DYT0 Phosphate-binding protein n=4 Tax=Verrucomicrobia TaxID=74201 RepID=B3DYT0_METI4  ali  35  43.........................LNGAGGSFPYPLYSKWFFEYTKDPSVHFNYQPIGSGGGIQQLISQTIDFAGSDSPLPDTLISGKEKKIIHIPTVAGAVVIAFNLPRIPTLCLDKDILGAIFLGEISRWNDPRIAALNPNIALPNLPIVVIHRSDGSGTTYIFTEYLSKISPSWARTSGKGTSVYWQRGIGAKGNAGVAATLKTIPGSIGYLELAYALQNKFPMAAVKNQAGEYVLPSLQSVAQSLNRDDFRISLTDSPRAGAYPIAGLTWILLNTQTT----NRTTMEYLSQFLSWALT-EGQSFALPLDYAPLPFALRQKVLTVLETLK........ 352
119 0.000e+00UniRef50_K0ILL2 Phosphate ABC transporter, periplasmic phosphate-binding protein n=4 Tax=Nitrososphaera TaxID=497726 RepID=K0ILL2_NITGG  ali  33  2...LLASFVVPIAMPAKAHAQSAITLNGAGATFPFPLIDTWRVEYNKNPNVQLNYQSIGSGGGIKQFTEKTVDFGATDAPLTQAQFDAAP-GAIHIPETIGSVVPTYNIPGNGELKLTGTVLADIFLGKITKWDDPAIKNLNQDLALPSEDIIVVHRSDGSGTTYVWTDYLSKASPEWEAQIGKGTSVPWPVGLGGPGNEGVANLVRQTTNAIGYNELAYAITTGMSHAQVQNREGNFIHASLETVRNAVDAPWHTVTMTNARGADSYPIASFSYLLVYKELSPSINSMARAKALVDFIHWAIT-DGQEFAPPLEYVPLPDEVVNHNLETLQMLTYNGEPVFE 354
120 0.000e+00UniRef50_B5YBX3 Phosphate-binding protein n=3 Tax=Bacteria TaxID=2 RepID=B5YBX3_DICT6  ali  36  19....................GQQVIINGAGATFPYPLYSRWFYEFERETGIKINYQSVGSGAGIQQAKAGTVDFGATDAPLPGKEQE--ESKLIMIPTVAGSVAIVYNLPNVKGLKLSREVIADIYLGKIKKWDDPKIKALNKDINLPSIPIVVARRSDGSGTTAIFTNFLSAVSSEWKEKVGAGTSVNWPVGIGGKGNEGVAGIVKNTIGAIGYVEFAYAVQNKLSYAQIKNKYGSFVEPSIDTVKYAASPEDFAVYIVDAPGKNSYPIAGYTFLLLKREY----QDLEKAKAIVKFIRWAY-EKGDKYAEELLYVPLPDNVKKLALKKLDLITYQGKKV.. 337
121 0.000e+00UniRef50_A9GF56 Phosphate-binding protein PstS n=36 Tax=Bacteria TaxID=2 RepID=A9GF56_SORC5  ali  36  36.............SAPQPTADGDITLTGAGATFPYPLYTKWIAEFQKNSKVKINYQSIGSGGGIRQITERTVDFGASDAPMNEEQIGKA-AGILHLPTCLGAVVLTYNLEGVPSLKLTPEAAAHIFLGKIKKWNDPALQKENPDVKLPDKEIATVHRSDGSGTTKIFVDYLSAVSPEWKSGPGTGTSVNWPGGLGAKGNDGVSALITSTPASIGYIELAYAMQNKLTFASLKNKSGKFITPSLESTTAAGAPDDLRISLVDAEGEDAYPIAGFTYLLVYQEQ----KDLAKGKVLSSFIKWAM-QDGQKFTNDLHYAPLPAAVIEKVNKKLAALVPDGKPLL. 367
122 0.000e+00UniRef50_K0IIL0 Phosphate transport system permease protein n=1 Tax=Nitrososphaera gargensis (strain Ga9.2) TaxID=1237085 RepID=K0IIL0_NITGG  ali  36  29.......................VTINGAGATFPYPLIDTWRTQYQSEPSVNINYQSIGSGGGVKQFLEKTVDFGASDAPLSSSELERA-QNAVHIPETIGSIVVSYNLPSVPELKLTGPVIADIFLGNIRKWNDPQIQSLNSDISLPDREIIVVHRSDGSGTTFVWTDYLSKVSREWHDKIGTGKSIQWPRGIGAPGNEGVANAIKGNLFTIGYIELSYALSTGMPYAFLQNREGVFVEPSFETIQAAIDESWEEVSTTDAPGANSYPIASFSYILLYKELTDPSIDHRKAETLVNFLLWAIT-DGQQYADDLGYVPLPESVVKLNQETISSLTFNGQPI.. 358
123 0.000e+00UniRef50_A0A1Z4LHR1 Phosphate ABC transporter periplasmic phosphate-binding protein n=1 Tax=Calothrix parasitica NIES-267 TaxID=1973488 RepID=A0A1Z4L  ali  33  375....................GGDTTLNGAGASFPRLLYERWFKDINKYPNLRINYQSIGSGAGVRQFIAGTVDFGASDVAMKDEEIAKVDRGVLLLPMTGGSVVLAYNLPGINELKLPRQVYTDIFLGQITKWNDPEIAAANPSTNLPDQNITVVTRSDGSGTTAVFTKHLSAISDEWKNGPGDGKTISWPTGIGAKRNEGITAQVQQTPGAIGYVEYGYGKNQGLTMATLENKAGKFVAPSDESASKALGAIDLRAFILDPEGEESYPIVTFTWLLAYKNYD----NPATAKAMEAMIEYALT-EGQKAAPELGYVPLPANVVEKVAAAADAIS........ 689
124 0.000e+00UniRef50_A0A2E5JIL8 Phosphate-binding protein PstS n=4 Tax=Bacteria TaxID=2 RepID=A0A2E5JIL8_9PROT  ali  37  3...LFSLLFISLALCSTSASALT-KINGAGATFPYPIYSKWFSEYQKNKDVQFNYQSIGSGGGIRQVLKETVDFGATDAPMLEKEMAKAKSPITHIPTVLGAVTVAYNLPEVGDLKLDAKTLVNIFLGTITKWNHKDIAILNPDLKLPAKDILPVYRADGSGTTNIFTDYMSAVSKDFKDKVGVGKAVSWPIGIGGKGNEGVTNMVKQTPGSIGYIELAYALNNNLKTVAIKNKSGKFVSPTIEGISASAAKTDFKGSIVNADGDDAYPISAFTYILLPTKTNNV-----QLEEVKKFLVWALT-KGQSFTKELHYAPLPANLAKQLLEVVKK.......... 332
125 0.000e+00UniRef50_A0A1M4SM64 Phosphate-binding protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1M4SM64_9BACT  ali  38  22..SLMACNGGDNATPGQMAEKGSGTILGAGSTFIYPLFSKLFSEYHKKTGLQVNYQSIGSGGGILQLTNKTVDFGASDAPLNEEQEQKMGVPALHIPMCAGAVVLSYNLSNMKDTKLTPEIIANIFLGKIKTWNDPQIAAVNSGTQLPSTPIVVVHRSDGSGTTNIFTTYLSKVNAQWNTKPGKGSSINWPIGLGGKGNEGVAGLVKQTPGAIGYIELAYAIQNKMAFASVQNKAGKFITPSVASTSAAGNPADAKISLTNTDAADGYPISGFSWALIYKEQSYNNRSQEKAGKLLDLLWWNI-HEGQEYCEPLNYARLSPEAVTVAENILKSATFNGQPILK 368
126 0.000e+00UniRef50_A0A151AVW3 Phosphate-binding protein n=17 Tax=cellular organisms TaxID=131567 RepID=A0A151AVW3_9THEO  ali  40  43................QAQETKTVTLNGAGASFPYPLYSKWIAEYRKAPHVTIDYQSIGSGGGIKGITEQTVDFAGSDAPMKDDQLAKAPGQIFHIPTVMGAVVITYNLEGVKTLKLTPEVISDIFLGKIKKWNDKAISSLNPDLKLPDKDITVVHRSDGSGTTNIFTDYLSNVSKEWKEKVGKGTSVEWPVGIGAKGNEGVAGTVKQTPGGIGYVELAYAVQNQLPYAFIKNQAGKFVEPTLDTTTAAAAPEDMRVSIVNAPGENSYPIAGYTYLLVYKDQ----KDKDKGTELVKFLWWAI-HDGEKYAKDLLYAPLPDNVVKLAEARIKQINYQGEPLYK 372
127 0.000e+00UniRef50_A0A212PD76 Phosphate-binding protein PstS n=3 Tax=Bacteria TaxID=2 RepID=A0A212PD76_9DELT  ali  33  5.LRLSICLVLILPSFLIAPTAFAETLNGAGATFPYPLYSKWFSEYAKDPTVKFNYQSIGSGGGIKQITAQTVDFGASDKFLSDQELKAAPGKLLHIPTVMGAVVVTYNVPGIGKLKLSSENVAEIFLGKLTKWNDPRIVRDNPGMQLPNQPIIVVRRSDGSGTTSIFTDYLSGVSPEWAQKVGKGASVKWPVGLGGKGNEGVAGQIKTTRYTIGYVEMAYAIENKLSYATIRNKAGAFIEPSIKTTSAAAAPADYRISLVNQPGKEAYPIVGFTWLLVYEKQ----KDPVKGKKLVEFLRWSMT-KGQKMAAPLLYAPLPQNVTKMVEKTIKTIQ........ 342
128 0.000e+00UniRef50_UPI00056FD53B phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Bacteria TaxID=2 RepID=UPI00056FD53B  ali  33  27...................ASHKKFLNGAGASFPYPLYANWADKYYKLTGIKINYQSIGSGGGIRQIIERTVDFGASDKPLTPQEIEKN--KLLQFPTVIGAVVPVINLPELKSLVLDGETLCKIFLGKITKWNDPEIKKLNPDIKLPDKNITPVYRSDGSGTTAIFTHYLSQVCPAWKKEIGFGTSVKWKTGIGAKGNEGVSNYIKRTPYTIGYVEYAYAFQNKLTCIGLKNSKGNIVAPEEKTIKEAAKTVDFYAWLTNAPGEKAWPITGATYILLAKDNLKINKD------VVKFFDWAFKH-GDKIAKKLTYVPLPEEVKEKIRNYWKQ.......... 339
129 0.000e+00UniRef50_A0A0U5AYZ0 Phosphate-binding protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0U5AYZ0_9BACL  ali  38  34.........TAKPGSEKAASGDTGLLNGAGSTFVNPLFSKMFSEYSKHADVKVNYQSIGSGGGIKQLTAKTVDFAASDAPMKDDELKAAGGNVLHIPVTLGGVAIAYNLEGVKNLKLTPENIADIYNGKIKKWNDPKIAADNKGVALPATDIFPVHRSDGSGTTHIVTTYLNAAVPAKWTKEQTGKSVKWANGTGAKGNEGVAGQVQNTPGSIGYVELAYVIQNNMTAASIKNKDGQFVAPTLETVTSAAKGADLKVKLSNQPGKDSYPIVGTTWVLVPENLT---LDKAKAEKMLTMLKWAVT-DGQKYAGELNYAPMPKELQDKGVEALKKVKVNGEAVLK 371
130 0.000e+00UniRef50_A0A0N9YZB9 Phosphate-binding protein n=1 Tax=Candidatus Nitrocosmicus oleophilus TaxID=1353260 RepID=A0A0N9YZB9_9ARCH  ali  35  14....LLAVSLLVPIYVNSVHAQKGSINGAGATFPYPLIDTWRVEYQKNPDVNLNYASIGSGGGIKQFTEKTVDFGASDAPLSETEFQKAGS-AVHIPETLGSVVLAYNIPEVTPLKLTGPVIADIFLGKITKWDDPKIKELNPDVTLPSENIVTVHRSDGSGTTFVFTDYLSKVSPDWNQTIGKGKSVQWPVGIGAPGNEGVAASIQGTPYTIGYVELAYALTTQMNYASVQNKEGNFITPSVNSTRAAVSASWSNVTITDPSGPDSYPISSFSYLLLYKDLTNPSIDEQKAKAIAEFIEWAIT-DGQQFAEPLGYVPLPQSVVDVNEATLKSLTFKGNPL.. 361
131 0.000e+00UniRef50_D5WV29 Phosphate-binding protein n=6 Tax=Bacteria TaxID=2 RepID=D5WV29_KYRT2  ali  35  53....FGAGSGSTGVPLPGSGGRAALLNGAGATFPYPLYSRWIDEYGRTPNVRINYQSIGSGGGIEQISKKVIDFGASDAPLTDDMLKKMPGEILHIPTVLGAVSITYNLPGIKPVQFSPEVLADIFLGRITKWNDPRIVALNPVTKLPAQNIVVVHRSDGSGTTNMFTDYLSKISPTWNAQVGMGTSVNWPLGVGAKGSEGVSRQVQSTVGAIGYVELSYALLNNLPYALIQNRAGKFVAPSLETTTAAAAPDDLRVSIVNAPGDNAYPIAGFTYILVFKDQA----DPDKGRALAKFLWWAV-HDGERMAPPLAYGPLPPEVLTKVEQKLKSMTAQGRPLL. 393
132 0.000e+00UniRef50_Q2JUA4 Phosphate-binding protein n=6 Tax=Synechococcus TaxID=1129 RepID=Q2JUA4_SYNJA  ali  32  17SAVAAGFAASQAGWQRVFAQQKTITINGAGATFPAPLYQTWAQEFKKNPNIQVNYQSVGSGAGRQQFVARTVDFGASDSVPRPEEISKIPKGMVAVPMVGGALVAAYNVPGVPEIRLSRLALANIFLGKIKKWNDPLLAGLNPGVTFPDMPITVVHRSDGSGTTDIFTTHLNAISPEWRQKVGRGSSVNWPTGVGARGNEGVSEQIKQIPGSIGYVEYGFAKLNNLNFARLENRAGKFVVPKVETEQAALADERLLGVDPDPEGEDSYPIVGYTWILAYQVYPK----AETSKAVKEFLRYALT-EGQSFAEPLGYVPLPEETRKKALAALEKIT........ 358
133 0.000e+00UniRef50_M1E671 Phosphate-binding protein n=3 Tax=Thermodesulfobium TaxID=227388 RepID=M1E671_9FIRM  ali  35  25...........SSSNAPQSASQVKQLTGAGSTFVYPLFSKMFEEYKKEKGVEVNYQSIGSGGGINALKDGTTDFSASDAYMSEKEMQAVPGGVVTIADAAGAVSISYNIPGVKDLVLDGKAIADIYLGKIKKWNDPYLEKLNPGVNLPDKPITVAHRSDGSGTTFIFTNYLSLISPEWKDTVGAGTSVKWPVGLGGKGSEGVTAIVKQNPYSIGYVELTYALQNNITTAKVKNKSGNVVAPTLDSTKKAFEPSDMRALVLDTSNPEGYPITGFTFILLHKEMNYKGNTLARAKAVLDLVKWIIT-DGQKYCEPLDYVQLPKEAVDINMKNLESITWDGKPIL. 358
134 0.000e+00UniRef50_A0A1I7ND78 Phosphate-binding protein n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1I7ND78_9BACT  ali  37  13SMALLASCGGGGQKQTSQTAASSQTLLGAGSTFIYPFYSKVFNVYTQQTGIKVNYQSIGSGGGILQLINKTVDFGDSDAPLTDDQEKQAGTPVVHIPICAGAVVLTYNLPGIQDLQFTPDVLANIYLGKITRWNDPAIQAINPKVKLPNLPIAVVHRSDGSGTTNIFTNYLSKISPEWKAKVGASTSVNWPVGLGGKGNEGVSGLIRQTPGGFGYVELAYAIQNQMPVAKIQNASGHFIAPTIASTQAASNPADAKVFVTNTTAPDGYPISGFTWAILYREQHYGDRSLDRAQELVKLFWWV-THNAQSYCADLHYAPLSAEAQATAENLLKTITFDGKPVLE 361
135 0.000e+00UniRef50_A0A1V4WLM5 Phosphate-binding protein PstS n=23 Tax=root TaxID=1 RepID=A0A1V4WLM5_9DELT  ali  41  8ALSLMAVVLALVCFATDAP-ALDMELLGAGATFPQPLYSKMFDAYNQQYKVKINYQGIGSGGGINQLIRKTVDFGGTDAFMAAKELQAAGAPVLHIPTCLGAVVVTYNLPGNPKLNFTPDAVAGIFLGKITKWNDPKIASANPGVKLPDLPVSAVHRADGSGTTYIFSEYLTKVSREWKEKIGTGKSLNWPASQGQKGNPGVAGYVKQTPGAVGYVELLYAIQNRMPYGNIKNRAGRFIEPTLKSVSAAANPDDTNVSLTDTEAAAGYPISGFTWLIFYKEQNYGGKAKDRAEALAKLLLWMVG-DGQRYVEPLEYAPLSKEAAAKANKLVRSMTYNGTPLMK 352
136 0.000e+00UniRef50_A0A1V5CUM8 Phosphate-binding protein PstS n=76 Tax=Bacteria TaxID=2 RepID=A0A1V5CUM8_9DELT  ali  42  8..LCIVALITFALFAGTELRAADQELLGAGATFPQPLYSKMFDAYNQQYKVKINYQGIGSGGGINQLTKKTVDFGGTDAFMTEKELKAAGEEVLHIPTCLGAVVVTYNLPGNPKLNFTSELIADIFLGKITKWTDPKIAAANPGIKLPDLPISVVHRADGSGTTYIFSEYLTKVSPEWKEKIGTGKSLNWPAGQGQKGNPGVAGYVKQTPGAAGYVELLYALQNKMPYGNVKNKAGKIIEPTIKAVSASANPDDTNVSLTDSAAANGYPICSFTWLIFYKEQNYGGRSLERAETLAKMLFWVV-NDGQKYVEPLQYAPLSKEAVAKAVKIIRSMTYNGKPILK 351
137 0.000e+00UniRef50_A0A1F3SXW1 Phosphate-binding protein PstS n=8 Tax=Bacteria TaxID=2 RepID=A0A1F3SXW1_9PROT  ali  36  11..VLVTTLLAIQATVTIAHSAAATRLTGAGATFPYPLYSKWFFEYQKNPEAEINYQSIGSGGGIRQFTEGTIDFGASDAPMTDEQLAKLAQPAFHIPTVLGAVVLTYHVPGTSTLKLTPDVLADIFLGKLTKWNDPRLTKLNPGVSFPDTPILVAHRSDGSGTTGIFTDYLSKVSPEWKKKVGQGTAVKWPVGLGGKGNEGVTGLVKQTPGAIGYVELIYAENSKLPYASVQNAAGHFTLPSMKSVSAAAAGADFRVSITNPPGKDSYPISGFTYLLVHQT-----VSGAKGRTLVEFLEWAVS-DGQKLAEPLSYAPLPHSLAKKVEATIKKIQVK...... 347
138 0.000e+00UniRef50_A0A1I4VX34 Phosphate-binding protein PstS n=97 Tax=Bacteria TaxID=2 RepID=A0A1I4VX34_9DELT  ali  47  26.......................ESLTGAGATFPYPLYDKWFSIYHQVTGVKVNYQAIGSGGGIRQLLSRVVDFGGTDAFMSDEELSKAPGEILHIPTCLGAVAITYNIPGNPELKLTGDVIADIFLGKITRWNDSRITELNPGIELPDMKIIVVHRSDGSGTTFIFSDYLSKVSPEWKEKVGRGKSLNWPAGLGAKGNAGVAGMVKQMAGSIGYVELIYAEQNKMPVALVKNRAGNFIKPSLASVSAAANPPDTRVSITDTESPEGYPISSFTWIIFYKEQSYDNRSRERAEALAKLLWWMI-HEGQKYNESLLYAKLPPKAVEKAEAIIKTMTYNGAPL.. 345
139 2.000e-98UniRef50_A0A024K842 Phosphate-binding protein PstS n=4 Tax=Mycobacterium simiae complex TaxID=2249310 RepID=A0A024K842_9MYCO  ali  33  59...................DGGANTLSGAGSTFVAPVMSIWTKDYSTSDGVQVAYQSIGSGGGVQQISAATVDFGASDTPMKDSELALAKGGPIHIPLVLGAVVPAYNIKGIDSVKFDGETLGKIYAGKITKWNDDALKTLNPGTNLPDEPIAVAHRSDGSGTTAVWTDYLTKESPTWADTLGGGKEVAWPVGIGGKGNEGVSGVVNQTEGGLGYVELAYAIQQNLKYGQVKNKAGNFIQACTATITKGTDPDDLRVSLTDGTDPNAYPITGTTYGLVYANQT----DAAKGKALVNFFAWVLSS-GQDEVAAVNYAPLGKDLQQKAAGQLKKITIAGAPV.. 386
140 2.000e-98UniRef50_A0A268TQX2 Phosphate-binding protein PstS n=1 Tax=Helicobacter sp. 12S02634-8 TaxID=1476199 RepID=A0A268TQX2_9HELI  ali  29  20.........................INGAGASFPAHAYMVWVKSYQKLTGNKINYQSIGSGGGVKQIKAGTIDFGATDEPLTSADLAQHA--LMQFPTLTGGIVLVYHIDGIPDLKLSNAVLAEIFLGHIKQWNDPKIIKDNPDLKLPQAPIEVVHRSDGSGTTYNFTLFLSKISQKWKDTIGYGKAISWPVGFGAKGNEGITHLIKQTKNSIGYVELSYKEQMGLTGAKIQNAQGEWVEANAKSIALASANADFYTDLIDQKGKGVYPLTSATFVLLPKK-------GKNTQNVLKFFDYAFKN-GDQEAIQMGLVPLPSALKDKIRAYWQANT........ 327
141 2.000e-98UniRef50_A0A1E4NCM1 Phosphate-binding protein PstS n=9 Tax=Bacteria TaxID=2 RepID=A0A1E4NCM1_9PROT  ali  33  7...LARGTLAAAVGLAFSVSALAADITGAGATFPYAVYTKWAEAYQSATGNKVNYQGIGSSGGVKQIKAKTVDFGGTDAPVKEEDLDAAS--LVQVPTVMGGVTIVMNVPGSGQIRLDGTTAANIFRGAITKWNDPAIAALNPGANLPNLAITVAHRSDGSGTTFAFSNYLAKQSLPFKRDVGAGNNVNWPNAVGGKGNPGVAANVQKIKGAIGYVDIADAMKNNMDFVALKNKAGNFIVPNQQAVADAAAGANFAPDLLDQTHKNAWPITTATYMLAYEK----GGDATKQKGVVDFFTWSL-NNGQKMAEELGFVPLPPNVVKMVEAEMKNIK........ 339
142 2.000e-98UniRef50_E8U7I1 Phosphate-binding protein n=1 Tax=Deinococcus maricopensis (strain DSM 21211 / LMG 22137 / NRRL B-23946 / LB-34) TaxID=709986 RepID=E  ali  33  13..................STAHAVTLTGAGASFPYPLYSRYFYEYAKREGVQVNYQPLGSGLGQTQFLRRTVDFGASDTPLSAADAARAPGRVLQVPAALGAIVVAYNLPGVTERKLSADVLADMYLGRIRTWRDPRITGLNDGVTFPNLPVSVVHRSDASGSTQLFSTYLAHASADWQRAAGIATRLNWPGGTPARGNDGLARIVNDTPGAIGYMELVYAARLKLPYAQLRNRAGAFVSATPATIDEAARTATNPGSVVDAP--RGYPLTSYSYLLAYADQGYGARTEAQARALKGLLKWILTDA--QRLRVNGYQPLPEGALRDALSAVAGMTYKGKPL.. 332
143 4.000e-98UniRef50_A0A101XSE3 Phosphate-binding protein n=2 Tax=Acidibacillus ferrooxidans TaxID=1765683 RepID=A0A101XSE3_9BACL  ali  34  11ALAVVAILVAGISLQSFAASSTGVSLTGAGSTFDYPFFNRAFYLYAMQNHVNVNYSAIGSGGGIQQFSEGTVNFGASDVPMNAGELQRIGGAVIQIPIALGGEAISYNLPGITRLRFTPHVIAQIYLGQIKSWNDPRIEAINPGVKLPKLPIVVVHRSDGSGSTYIFTDFLSAISPQWAHRVGCGKAVNWPVGIGAKGNQAVAQSVKDTVGAIGYVELAYVLQSKMHYGYVQNREGQYVLPTPATIANEAAQKPSVTSIVWLPGKNAYPISGYSWALLYRNQ----RTAALKKMLVNLLTWMEGP-GQDQAAAIDYVPLPANIRRQALYLLDTVK........ 349
144 5.000e-98UniRef50_A0A2N6QMX1 Phosphate-binding protein n=19 Tax=Bacteroidales TaxID=171549 RepID=A0A2N6QMX1_9BACT  ali  62  23..........GSVVKAPSAASHKTVVTAAGATLPLPFYNKAFELYWEKNDVPVTYAGIGSERGLKALQRRQIDFAGVDVLPTKAERDSLPGKVLALPTCMGAVTVAYNLKGTDNLRLTGELLADIFMGKIVKWNDARIAAVNPKLSLPDREITPVFRLDGSGTTYVFSQYLSKVSDAWKNAMGVGKKIGCKVGVAANGNTGVAGLVERIPGSIGYVATEYTTAFDTQRAWLRNAAGTFVLPTQESIMAAAEQEGNATDITNATDAGAYPISCYTWVLVYQEQSYALRSYHEAQETVSVLRWLLSPEAQELTTRLLYSPLPTRTAAAAARLLDSMTYEGKKMK. 354
145 6.000e-98UniRef50_I3VIG3 Phosphate ABC transporter periplasmic phosphate-binding protein PstS n=1 Tax=uncultured bacterium F25-01 TaxID=1191433 RepID=I3VIG3_9  ali  33  98................PTAAPGELLINGAGSSFDNPLFSKAFSEYNKNPKIKINYGSVGSGAGIQQFTKGTVDFGASDAPMTDQQITDSGGDAIHLPVTLGPAAVSYNLPGIAEVKLTGVVLGDIFMGKITAWNDPAIVKLNPDVKLDNTPIAVVHRSDGSGTTDIFTSYLTSISPDWKTNVGFGSSVKWPVGIGGKGSEGVAGQVKQTPGGIGYFELAYAQANKLTSAAIDDGSGNYLLPGPDGASACAANVRIRIAGCGGGVKGAYPISGFSWVILHKTQ----KDTEHGQALANLFWWMI-HSGQSFAKDLNYAPLPDAIVKLGEEKLKGITADGKLAL. 429
146 6.000e-98UniRef50_D8INV1 Phosphate-binding protein PstS n=193 Tax=Bacteria TaxID=2 RepID=D8INV1_HERSS  ali  35  26......................AAEITGAGASFPYPVYAKWAELYKAATGNSLNYQSIGSGGGIKQIKAKTVDFGASDAPLPQNELAEAG--LTQFPAVVGGVVPVVNLDGVGQIKLSGQVLGDIYAGKITKWNAPEITALNPGVKLPNEDITVVYRSDASGTSYVFTSYLSKANADFKSKIGAGTAVKWPTGVGGKGNEGVAANVQKVKGAIGYVEYAYVKKNKLNYTQLKNKDGNFVSPDDSSFKAATAHGDWAVDFTDAAGKESWPISSATFILLHKEQAG---DGAKGKEVLKFFDWAYKNGG-KVAADLDYVPLPDSVTKLVEDSWKSNVKDGKAIW. 349
147 7.000e-98UniRef50_W0JCY5 Phosphate-binding protein PstS n=2 Tax=Desulfurella TaxID=33001 RepID=W0JCY5_DESAE  ali  25  6AKLLLFGVFALSSLAFSPTRSYAGSINGAGSTFAYPVYTKWAYEFERATGNKVNYQGVGSGAGIQEVSQGTVAFGGTDMCLSKEELEK--KDLVQFPSMVGGILIVVNIPGNNELKLSNAVIPEIFMGQIKYWNDPRIEKDNPGLKLPHLSITVVHRADGSGTNWNVTYWLSQISKAWNEKVHYGLSVNWPVGVGGKGNMGVSNYVKQIKGSIGYVEYAFWLQNHLTSVELQNKAGKWVIPSIAAFKEAAAKAQWAPSLAYQPGVNTWPIVSGTFVLIPKKPTLPH------KEAAEFFKWGFAH-GDKAAESLGYIPLPQSTKNTISKYLQ........... 337
148 1.000e-97UniRef50_A0A258ZDN8 Phosphate-binding protein PstS n=1 Tax=Gallionellales bacterium 24-53-125 TaxID=1970510 RepID=A0A258ZDN8_9PROT  ali  31  8.......CLSILCMLSASPSLFANSIHGAGATFPALLYQKWAVSYTLHKGINVEYLAVGSGEGIKRIDAGSVDFGGSDMPLTLDELNQ--KGLIQFPMVMGAITPVINLPGVHILKLDGETLAAIFMGKIRRWNDPALLRLNPKLRLPKMPISVIYREDKSGTTFNFTNYLSKVSGDWQNSLGEGLSVNWPVGRAAKGNAGVAARVKETEGSIGYVDYAHAMEKNLDYVQLKNHDGYYVVPNAASTEAAAAGARWDTILTNAPGVASWPIAATTFILLRKE----VTDFEQTRRILKLIDWNYRT-GELQAMYLDFVMLPKQVAVQVRASWKNVKDKGRSVW. 344
149 2.000e-97UniRef50_Q2JHD8 Phosphate-binding protein n=24 Tax=Cyanobacteria TaxID=1117 RepID=Q2JHD8_SYNJB  ali  31  9....SLTALTVGFLTATSAQAQTVQISGAGATFAAPLLQRWFDAYNRDPTVQVSYQSVGSGAGLEQVINGTVDFGASEAPFSGARLEKYRYEPLQLPMAGGSIEFAYNLPGDGELILKRKTYCGIVTGEITRWDDIRIKAENPRIKLPPLDITWVHRSDGSGTTFVFTNHIRTVCPNW--TAGAGTSVEWPVGIGAQGNEGVAATIKQEPGAIGYVNQSYAKLEKMATARLENKAGNIVEFSTEAATSALDPDNFALLVPDPEGPNDYPIVGLFWVMLYREYP----DQQKLTKLVEALKWTQGPEGQAITKELDYIPMPEAAIQRIFAELDAITVNPNAV.. 352
150 2.000e-97UniRef50_A0A2W5XNN8 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=candidate division WPS-2 bacterium TaxID=2052317 RepID=A0A2W5XNN  ali  36  2..LLISAAFVALAFAQPQASRADTQITGAGSSFDFPFFSRAFYEYRRHGGIQINYQSIGSGGGIQQFTAKTVDFGASDVPLNAAETKAANGPVLQVPVALGAEVIAYNLPDVGHVRLSAGVLADIFLGKLTTWDDARIAGLNQGVHLPHLPILVVHRADSSGTTYIFTDYLSKVSSEWKQKVGTAKSVSWPAAIGAKGNEGVAGQVRNMPGAIGYVELAYALENNISYAALQNRNGDFVLASVDTVRRAAAQSPSNFSIVDMAGRDSYPICGYSWAMLWQNQA----DKSKSKQLMDLFRWLVT-AGQSYADQVHYVALPANVQAVAEKALAGI......... 339
151 3.000e-97UniRef50_A0A0U5F293 Phosphate-binding protein PstS n=35 Tax=Proteobacteria TaxID=1224 RepID=A0A0U5F293_9PROT  ali  30  9....MCLAVMTTFLTALPAASRAESVTGAGSSFAAPIYEGWGAVAKSATGVTINYQSVGSSAGQNQIVAGTVDFGASDAPMDAQKLETNH--LFQFPTVMGGIVPVVNIPGPDTLTLSGDVLADIYAGSITSWNDPKIAALNPGVKLPDVAIAPVHRADGSGTTFVFTSYLAGSSASWKENYGAGTSISWPGGLGARGNDGVAATVQNTEGGIGYVEYAYASRNHLTTVRLRNHAGASVAAGMNSFSDWAHASHFAVNLLDTDGQEAWPIMSATYVLVP----VPARHADRDQAVQKFFSWSFSN-GDSIATKLDYVPLPNAVKDSIMSAWKSGK........ 341
152 3.000e-97UniRef50_A0A2V7TN54 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7TN54_9BACT  ali  36  17........................QIDGAGATFPNPIYSKWFAEYNKHPNVKINYQSIGSGGGIRQLTNQTVFFGATDGPMTNEQIQAAGARILHLPTVLGGVVPVYNVPGVGDLRFSGPLLADIFVGKVTKWNDAAMAKENPGVSLPASDITVVHRADGSGTSYIFCDFLAKSSPEWKQKVGVATSVNWP----------------------GYVELIYALQNKISFGAVKNSAGEYVKASLESVTAAAAPADFRVSITNAPGKNAYPIASFTWLLFYESP----KDKAKAKAMVEFMRWAL-AEGQKYAPDLGYAPLPPSVVSLETEALKKIK........ 308
153 3.000e-97UniRef50_A0A2D7A142 Phosphate-binding protein PstS n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2D7A142_9RICK  ali  35  27.........................IMGAGATFPYPLYSKMFNEYYKQTNQKINYQSIGSGGGQRQLKAKTVDFGATDAYVYDKDMPSFEXEILHXPITAGGVAITYNLPGIKDLKLNADVLAEIFLGKIKRWDDEKIQLLNPGKKLPKFNVXTIQRADSSGTTFIFTDXMNKASXIWKKEGSVGKSVKWPKGLAGKGNNGVASLIK-IKGSIAYLGSVYALQNNMDIALIENKNKVFVXPSIASISEAANPDDTRVNISNTEAKNGYPISGLTWIIVYKNQKYDSRKQKDSDEIKKLLNWMVT-KGQSHCEELNYAPLSENVKKLAINIINEIHYK...... 339
154 4.000e-97UniRef50_A0A1X4XXC3 Phosphate-binding protein PstS n=2 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XXC3_9DELT  ali  24  10.LFVIAVFLVGSVVFNAKLSQADGSINGAGSTFAYPVYTKWAFEYEKVTGAEVNYQGVGSGAGIQQVSQGIVAFGGSDMCLSKKELDK--KNLLQFPSLVGGIVLVVNIPGIKDLKLSDAVIPKIFMGQIKYWDDPQIRKDNPGLRLPHIPITIVHRADGSGTNWNVTYWLSQINKEWDEKIHYGLSVNWPTGVGGKGNMGVSNYVKQIKGSIGYVEYAFWLQSHLTSVVLQNKEGKWVVPTVAAFKEAAAKANWQASLVNQSGPKTWPIVSGTFVLIPKQ-----SNPQHKQAVK-FFKWAFEH-GNKAAESLGYIPLPQSTKGLIFKYLNE.......... 340
155 4.000e-97UniRef50_A0A0M0EL78 Phosphate-binding protein PstS n=98 Tax=cellular organisms TaxID=131567 RepID=A0A0M0EL78_KOMEU  ali  31  18....IGLGAAVMLGLAGATAAHATEIIGAGSSFGAPIYGAWGEGAAHATDIRLNYQTIGSGAGQNQVKARTVDFGASDAPMTAAQLAQFH--LIQFPTVMGAIVPVVNLPGVDTLCLTGELLARLYAGDITMWNDPRIVAENPGLSLPAIPVAPVRRADGSGTTFVFTSYLGRVSPRWAKEQGSGTSIEWPVGEGARGNDGIAAAVRNTEGSIGYLEYAYAAGNHMAIAEMRNHHGDLVSAGPDSFAQAVTTAHWAADDLDGDGPGAWPIMAATYVLIPTDRAGTP----QGRAVRAFFDWSMQH-GNDAALALRYVPLPDDIRVTIRDLLKT.......... 347
156 7.000e-97UniRef50_W6LRI9 Phosphate-binding protein PstS n=4 Tax=Bacteria TaxID=2 RepID=W6LRI9_9GAMM  ali  30  35....................SGPVALRGAGATFPAPLYQKWIDIYTKNPSLAIEYQAVGSGEGVKRFLENSVDFGGSDAALSDEQIAKAPGGATLVPATAGAIVLAYNLPDVKALKLSREVYADIFLGRIRNWNDPKIQTLNPDLKLPNQTITLVARQDSSGTTYAMTNHLSAISATWRNQPGVGKVIDWPGSMVAPGNEGVAGRIKRSWGSIGYVEYGFAKRLGLPMVHLENKAGRYIEPGLNSGQAALAPGNLRVFLPDPEGDDSYPIVTFTWLLLHDRYP----NPQKSTALKGFVNWAL-IEGQSYSSDMGYIPLPADVVALARVAVDRVQ........ 354
157 8.000e-97UniRef50_A0A0V8RWF7 Phosphate-binding protein n=3 Tax=Pyrodictium TaxID=2308 RepID=A0A0V8RWF7_PYROC  ali  31  59...........GTTTSGAAAGGKITLIGSGSTFVWPAMNKWIAGFEAHPNIHIEYTGGGSGKGVNDILHHLVDFAGSDPPLPRSIWEKHRGQILQFPVELGAVVVVYNVPGNTQLNLTGEVIAKIYLGEIKYWDDPAIKQLNPGVKLPHKEIIAVHRSDASGTTQIFTTFLSKTSKEWAEKVGSGKSVNWPVGVGQNGNPGVTQAVLSTKYSIGYVELAYALKYHMPYARIQNPAGKFVAPTPETVSAAFALKNPPSPLDDNASPDAYPIAGQTFLLVWKKWS----DPAKCNAMKQFLEYIAT-KGQENLPP-GYAPLPQVLRNVVLKAASLLECG...... 399
158 8.000e-97UniRef50_UPI000BA920A5 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Paraferrimonas sedimenticola TaxID=375674 RepID=UPI000BA920A5  ali  34  19...............TPAQASAETRLQGSGASFPFPIYSKWFRDYSRATGVRVDYQSKGSGAGISDFTNQVVDFAGSDAAMNDKELANVKDGAVILPVTAGQVVLTYNLPGVSELKLPRDVYPLIFTGEITKWNDERIAAANPGVKLPNRDITVVVRADSSGTTYVFTGHLAKVNGAFADSVGQGKAPQWPRFVKSPKNDGITATVKQTPGAIGYIEYGYAKLTKMPTIKLENAKGNFIAPGAESGAQALATADFRAWVYDPTGADAYPIASFTWVIFPQTQ-----DAAKAKAARDLVEYMIT-DGQKSADAMGYIPLPKNVVEMVRAEAQKI......... 348
159 9.000e-97UniRef50_A0A1G0Z8A0 Phosphate-binding protein n=2 Tax=PVC group TaxID=1783257 RepID=A0A1G0Z8A0_9BACT  ali  28  12........AALISGLLNISPLQALTIDGEGASFPASVYRLWAYRYSQITGSEINYRSSSSGAGTARIKEGTIDFGGTDMPLSQAELDKAG--LIQFPMLIGGIIIAANLPDNYQIKLTPQLLADIFLGKINRWDDPALQKINPELKLPSIPIIIVYRSDNSGTTWAFTEYLSQISPEWAASYGHNKAIQWKKGVGGKNNAGVANNIKKISGSIGYLEYSYAEGAGLKSISLLNKSGNYTMPGITSFSEAGQNAGLADDLINRPGEKSWPITTVSYILLKKEQ----RDPDKIREMLKFFLWCYLN-GAPVAKKLYFVPLPENVMKSVRLLWEKLICNGKQVF. 344
160 1.000e-96UniRef50_A0A2N1W960 Phosphate ABC transporter substrate-binding protein PstS (Fragment) n=1 Tax=Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 Tax  ali  37  1........................................................PIGSGGGIRQFTRGTVDFGGSDAILKDDQIEAVQGNVIQIPTIIGSVVLTYNLKGNEQLRLDPALLADIYLGRVTSWQDPRIKALNPDIDFPALDIVVTYRSDGSGTTYVFTDYLSKVSPEWAQQVGRGTAVRWPAGLGGKGNEGVTAQVKLLEGGLGYVEMGYAIANGLPFAALKNASGNFVAPSLESASIAADDTDFRVSITNPDGANAYPISSFTWLLIYRDNPK----AETAARIRDFLNWMITPEAQDQARRLYYAPLPARVVSLIKARIPTLQSGGKPI.. 289
161 1.000e-96UniRef50_A0A1R0HFY5 Phosphate-binding protein PstS n=1 Tax=Polynucleobacter sphagniphilus TaxID=1743169 RepID=A0A1R0HFY5_9BURK  ali  30  5.LRLFPAAVLLLSMGAVPFAHADSEIDGVGATFPMPIMQSWAEAYQSQKNIKVNYLGIGSAEGIKRITARTVDFAVTDIGLTQSELSQ--DDLMQFPLVAGGITPVIHLPGIGQLRLTGSVLADIFLGKVTYWDDVAIQNLNATISLPHLAITVIHRKDGSGTSFTFTGYLAKVSPEWDQRFGIGSSLQWPVGEAAAGNSGIAKTVAQTEGSIGYVEFRYAQKSKLTTINLINRDGNNVAPSLDTFMQAYKQAHWYQSLTDLPGANSWPIVAMSYVLIH----ATRNEREDALQTLHFLEWIYAN-GALAAQEASYIPITDELIQAFAARWKQVKEQGNAVLK 348
162 2.000e-96UniRef50_A9H9X2 Phosphate-binding protein PstS n=118 Tax=cellular organisms TaxID=131567 RepID=A9H9X2_GLUDA  ali  29  4SVTVFAAVLLGTAPVALSV-AHAANITGAGSSFAAPIYEAWGSAGRSASGVAVNYQSVGSSAGQNQILAGTVDFGASDAPMDPAKLQKGA--LFQFPTVMGGIVPVVNIPGIAALRLTGEVLAGIYSGDISSWNDAKITALNPGVNLPDLPIATVHRADGSGTTFVFTSYLARSSQAWHDGTGAGSSISWPGGVGARGNDGVAASVRNTEGGIGYVEYAYASRNHMTTVQLKDKAGDFVTADLDSFSDWKGAANFAVDLLDTSGKGAWPIVSATYVLVPKQ----AKDAAQGAAVRKFFGWAF-DNGDGIARGLDYVVLPAEVKASIRAAW............ 334
163 2.000e-96UniRef50_A0A229FT64 Phosphate-binding protein PstS n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A229FT64_9BURK  ali  32  8......SLVAGAIALSTVTTALAADITGAGATFPYPIYAKWAEAYKAKTNNGLNYQSIGSSGGIKQIKAKTVDFGASDNPVKFEDLEK--DGMVQFPAIIGGVVPVINVDGIKPGQITGDVLAQMFSGYIVKWNDKQLADLNPGVKLPDANITVVHRADGSGTTAIFTDYLAKVNANWKKDVGAGAAVKWPAAIGGKGNEGVAANVSRVKNSIGYVEYAYAKKNNMTFLQIKNKNGQFVSPDDETFAAAAAGTDWSKVITDAPGAKSWPITGASFILMYKEP----GNKANAAEVIKFFDFAF-KEGKKMAADLDYVPMPDATTEFIRKNV............ 335
164 3.000e-96UniRef50_F9UG28 Phosphate-binding protein PstS n=2 Tax=Thiocapsa TaxID=1056 RepID=F9UG28_9GAMM  ali  31  10.LALAFGALVSTTFWQPSIAADPIKINGAGASFPAPLYQRWFRDYLAHPNIQVDYQPIGSGPGVNSFIEGRLDFAGSDQPLTDELAQRAGDNILQLPLTAGAVVLTYNLPGIDALRLSREALAGIFLGSVARWNDPLILAANPGVEIPDLPIVVVTRVDASGTSLVMTRHLSAISEAFANEVGVSMSPDWPGLIRGNGNGGVAAFVQATVGAIGYVQYSYAHLPNMQMASVENREGDFVSAGSESFRAAIEAFRAKLDLTDPEGAGAYPILSLSWLVMR-----SGGDDAKSQAMRDVVRYAL-VDGQADASKLGYIPLSEKAVSLILEELDSRK........ 348
165 3.000e-96UniRef50_A0A1H7EIR2 Phosphate-binding protein PstS n=5 Tax=Paraburkholderia tropica TaxID=92647 RepID=A0A1H7EIR2_9BURK  ali  32  6..ILIAALLGASMSGLPFGVAHADGVTGAGSTFAAPLYARWAADYLKSGGGKVSYLPTGSTDGIKQVLARAVDFAGSDAPLTDDQLRKAG--LRQFPTAIGGVVPVVNLPGLKALMLTGDVLADIFLGKIQYWDDPAIARLNPKLKMPDTPIAVVRRLDGSGTTLIWTHYLAQVNPEWKRRVGEGTSVHWPLGIGGKGNEGVATFVGYLPGAIGYIAWDFTKHNRLTYTAMTNAAGAVVEPGAASFNAAAANADWSGSLTNQPGKEAWPVMGATYVLLGTTPAKPGRDKET----LKFFDWALTH-GETTIQALDYVPLPGAVVAKIRAQW............ 333
166 5.000e-96UniRef50_A0A2U0WQN2 Phosphate-binding protein PstS n=2 Tax=Paraburkholderia unamae TaxID=219649 RepID=A0A2U0WQN2_9BURK  ali  33  7.......LIVALICGVCAVTTRAEGVNGAGSTFAAPLYTRWAADYQKSGGGKVSYHGTGSSDGLKAVEAHTVDFAGTDAPLSAEQLNK--EGLRQFPTAIGGVVPVVNLPGIKALMLTGEVLGQIFLGKILYWDDPAIARLNPKTKMPDTPIAVVRRLDGSGTTLIWTHYLSQVSPEWKRKVGEGTSVRWPLGIGGKGNEGVATFVGYLPGAIGYIAWDFTKQNRLTYTAMTNAAGVIVQPGAQSFSAAAANADWSGSLTNEPGKDAWPVMGATYVLLQAAPDK----PARNEETLKFFDWALTH-GEPSIQALDYIPLPAPVIATIRAQWK........... 330
167 6.000e-96UniRef50_A0A0C3RBI6 Phosphate-binding protein PstS n=3 Tax=Nitrosospira TaxID=35798 RepID=A0A0C3RBI6_9PROT  ali  32  24................AQSNTESLVLSGAGATFPAPLYKAWIAAYRKEPGTIIKYAEVGSGEGVKRFLANTVDFGASDAAMTDAQIATAQHGAVMVPVTAGMVALAYNLPGNGLLKLDRNTYAAILLGKITRWNDARIQATNPGLNLPDREILLAVRQDSSGTTFVLSNHLSTASPEWHDGPGTGKLVRWPNAMFARGNEGVSSLVQRSVGSIGYVEYNFAKRLDLKVAHLENKEGSFVAPSERIGVATLAPADMRAYIPDPVGADSYPLVSFTWLLLKEHYS----DKIKGGALKRFITWSL-QEGQNFSGELGYIRLPAEVAKRSNEALARV......... 345
168 8.000e-96UniRef50_D6Z3Y7 Phosphate-binding protein PstS n=8 Tax=Bacteria TaxID=2 RepID=D6Z3Y7_DESAT  ali  30  26..........TVTVGAGSAAAQRVDLLGAGATFPAPLVTAMADEYRSKTNVTLNYQSIGSGGGIRQFIEQTVMFGMTEAFLSDEVMARTGGNAFNLPITLADVVPTYNLPGIQKLVLNGEVLVELFLGKITRWNDPKIAALNPGVRLPVLPVTIVHRSDGSGTTNIWTSYLSRVSPEWANRVGFATSVNWPTGIGGNGNEGVAGVVMNTPGALGYNSLSYALLNDIAFAYVVNASGNLIEPSYAATTAAADPTDTRVLFTNTPAPDGYPAAGFAWMLVYENLEKNRSNRAQAEALLQFLIWAIT-DGQELSESLGFARLPQAAIDRNFDMIRQIKWQGEKL.. 367
169 1.000e-95UniRef50_A0A2V5BKY2 Phosphate ABC transporter substrate-binding protein (PhoT family) n=2 Tax=Novosphingobium sp. GV010 TaxID=2135477 RepID=A0A2V5BKY  ali  30  2...........................GAGASFPAPLYTAWAKAWKTLSGDEVNFQPIGSGGGIRQIRERTVDFGATDRPLDRHELDA--GHLIQFPAVIGGIVPVVNVPGVGRMRLTGPVMGEIFMGHIRRWNDPAIARLNPGMALPPLPITVVHRSDGSGTTYLFTTWLARVSPAWGQGPGASDAVNWPAGIGAKGNDGVAVFVKRTIGAIGYLEYTFARKVNVAQALLQNRAGQWVAPTPQGFAQAAASVPWATLMLDQPGAGSWPISGASFILMQRRGPRPLRDA----AVLRFFDWAL-RAGDATAARLDYVPLSGPIKAQVMQAWHK.......... 308
170 1.000e-95UniRef50_A0LR07 Phosphate-binding protein PstS n=1 Tax=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) TaxID=351607 RepID=A0LR07_ACIC1  ali  29  57...........AAGSPSADQCQSGNLTGGGSTFQAPMQQKWISEYSRCKNATINYSSIGSGAGIQQFSAGTVDFAGSDVLMKDDEQAACASPAIHLPITAGGVGIQYNLPGITTLRFSPDTLADIFQGKVTKWNDPEIAADNPGVSLPATAITVFYRSDASGTTGIFSSFMAAASKKW--TLGTGKTLNWPTAQGAKGSEGVSAGVAQTVGGITYAEQAYALQHKLPLALVKNAGGQYVALTSETVSKALQGATIQPMNYLPTDPQAYPISSVSYVIVCSTYP-SSVSKDTVNLLRSYLAYAVT-GGQQFASTLGYAPLPTDLAQKVQASIDAIS........ 391
171 1.000e-95UniRef50_A0A2N9LFV6 Phosphate-binding protein n=1 Tax=Solibacteres bacterium SbA2 TaxID=2043162 RepID=A0A2N9LFV6_9BACT  ali  30  25......GCGSKTSTGAASGAEPTAVLGAAGSTFIAPLMTKWVGAYQQHPTVQINYRAIGSGGGIEELKHGYLSFGASDAPLNDDQLKGMSS-VVQIPVSAGPVCVVYNLPHLSPLRLSAKTLSGIYLGNIYTWQDAAVAKDNPGVSLPKGAIIVVHRSDGSGTTNIFTSYLSKVSQDWSLKSGHALSVTWPTGLGADGSKGVLAIVKQTPGTIGYLELNYAKENGVPFASIENEAGHFVQPSPESAAAAISAKDVRTPIVDPPAADAYPIAGLSFILIPKD----RADSGQQEAVKEFVAFAITT-GQDLAEELAYAKLPDAVQKQGQALLSQLTANGQPLK. 364
172 2.000e-95UniRef50_D7A8C0 Phosphate-binding protein PstS n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=D7A8C0_STAND  ali  32  18..................SPAHADELSGAGSTFAYPIIWQWAQAYRQAHGTIVGYQSVGSSAGVNRIRDKAVDFGASDKPLKPEELQRLGLG--QFPIVFGGVVPVFNIPGVKPMRFTGAVLADIYMGKITKWSDPALKALNPDLPLPDSLIAVIHRSDGSGTTFNWVSYLSKASQEWKETLGEGNSVAWPVGSGARGNEGVALEVQRVENSIGYVEFTYVTQAKLAYGLVQNRAGNFIAPSAASFQAAALSVDWYATINDSPAPDAYPIAATTFALMYRAPVSPDRSRTAFAFFAFALG-----EGSEYASKLGYVPVPEPLVRQVKEYWAT.......... 333
173 3.000e-95UniRef50_A0A0U1CLR0 Phosphate-binding protein n=9 Tax=Bacteria TaxID=2 RepID=A0A0U1CLR0_CHLTH  ali  36  20...............ASSCGDQEVSLSGAGATFPEFFYKDITQQFGDEYGIRVGYGATGSGAGIRNLQDLTVDFGGTDVFLSDKEMEAMPD-VLHIPTCIGGVVMGYNLPGVSQLNMTPDLVTKIYTGIVTNWNDPLIASINPGTNLPDRAITPVYRSDGSGTTAVFTGFMSEVDDTWLTSIGEGKSVDFKKGVAAKGNPGVAGVISQTVGAIGYLGSEYSMAQDIPSANMLNQQGQYVAANMETISAADMPADTRVKISNSSQVDAYPITTFTWMIVYKEQAYNNRSIEQAKALQHFLLYVVGDKGAMSAKKNYFAPLPEVARTRAIDVINSMTYEGKLIK. 349
174 4.000e-95UniRef50_H8YXT8 Phosphate-binding protein PstS n=2 Tax=Chromatiaceae TaxID=1046 RepID=H8YXT8_9GAMM  ali  30  9AALLLGASLSGCGPSGPADDAPSAALTAAGSSFAAPLMSQWMKTYEQHPDLALSYASVGSGEGIKRFIAGEVAIGTTDAPLKPEEAAQVQGAFAQIPITGGMIALAYNLPGVGPLNLPRAVYADIFLNKIHRWDDPRIQAANPGLELPSKLIQVVARRDSSGTTFAFTNHLASISPEWAAKYSAGKQIGWPEGILASGNEGVAQRIKITHGAIGYVEAGFASRLHLPLAWLENRSGGLIAPTAETGQRAAMPDNLTVTVPDPAGARSYLIVTLTWALVRAAYPEPF----KTRAVHEFLHWILT-EGQEQADGLGFVPLPTTLSKASLLELDRL......... 354
175 4.000e-95UniRef50_A0A2G2PIX8 Phosphate-binding protein PstS n=38 Tax=Bacteria TaxID=2 RepID=A0A2G2PIX8_9HELI  ali  30  5.....IALAALVVSATISSSFAADKINGAGASFPAPLYYGWAYVYKKDTQNRVNYQSIGSGGGIKQITKRIVDFGASDKPLNSNKLQKA--KLFQFPAVIGSIVVALNVSGDSKLKLSNENVADIFSGKISKWNDAKIAKDNSGLNLPNQKIVVVHRSDGSGTTYNFTYYLSGSSKSWKENYGTGKAVDWAVGIGGKGNEGVANLVKQTPNSIGYIENTYKEKNHLSAAVLQTASGKWVVANDENFKAAAKYASWSAMLSLQPGDTSYPIVAATFILLPKEKVKMN------KKIIKFYEYSFKN-GDKQAKKLGYIPLPEDTKNMIREYWDK.......... 331
176 5.000e-95UniRef50_A0A011QH45 Phosphate-binding protein PstS n=13 Tax=Proteobacteria TaxID=1224 RepID=A0A011QH45_9PROT  ali  32  11....ISGVAAAMAMGFGSIAAQAADLTGAGATFPYAVYTKWAEAYQAATGKSVNYQGIGSSGGIKQIKAKTVDFGGTDAPLSAADLNAAG--LVQFPSVIGAVTIVLNLPGIGQLKLDGPTAANIFRGAITKWNDPAITSLNPDLKLPPTAITIVHRSDGSGTTDVMTRYLAKQSADFVRDVGVGKSVNWPNEIGGKGNPGVAANVQKIAGTIGYVDYADAKKNGLAFAALKNKAGNFVLPSGEAFAAAAAGADFAPDMLDQTAKEAWPIVSATYILAYEK----GEDAAKQQGVVDFFSWAL-NKGGTLADELDFVPLPANVVGTIEAEMKRIK........ 342
177 5.000e-95UniRef50_B0JWH3 Phosphate-binding protein n=21 Tax=Cyanobacteria TaxID=1117 RepID=B0JWH3_MICAN  ali  29  11..VCAVSFATAAALAGTMGEAFAQTLNGAGASFPAPLYQRYFADYKNATGVTVNYNSVGSGAGVRQFIAGTVDFGASDAAPSSSEKSQMKNGLLLVPTAGGAVAVVYNLPGVNNLQISRANLGKIFSGEITNWKQV-------DPKLPDRPIKVVVRADGSGTTEIFTSHLSAISSSFKSKVGTSKEPNWGTVLKGPKNDGVAALVKQTEGSIGYVQDTFARKNEMRTARIQNKAGQFVEPSLAQANKAMEGIKFNADFTANVDDNGYPIVGITWLLVPKDYA----DNKKAAEIKRLLTWILTT-GQGINNQLEFTRIPQSVTEKVLAEVNKIK........ 337
178 6.000e-95UniRef50_A0A060NQE5 Phosphate-binding protein PstS n=3 Tax=unclassified Comamonadaceae TaxID=83494 RepID=A0A060NQE5_9BURK  ali  29  8..TVAATAALAMTGGFTKLATASTIITGAGASLPFPIYSRWAEAYQAATGVRLNYQSIGSSAGIRQIRARTVTFGATDAPVSGADLER--DGMVQFPAIIAGTVPMFNLEGPGEVRITGPVLADMFLGRIVNWSDPRIAALNPGRTFPNQAITVVHRADGSGTTFNFTEYLTAVSPDWASTVGRGASVRWPAAIGGRGNEGLAAIVARTRGAVGYVEFSFARRNNIPHMQLQNAAGNFVQPDDRTFSAAAAGVDWFVSIVNAAGANAWPIATASFILMYRQPA----NVAESNAVLAFFDWAFRN-GDQMAIELDFVPIPDTLADAIRARV............ 339
179 7.000e-95UniRef50_A0A1T5A1C3 Phosphate-binding protein n=2 Tax=Alkalitalea saponilacus TaxID=889453 RepID=A0A1T5A1C3_9BACT  ali  35  20.AVLSACGGRSGSETSEAARAQRVDILGAGATFPAPLVTAMADEYRQATNITINYQSIGSGGGIRQFIEQTIMFGMSEAFLSDEVMAKTGGKAFNMPITLADVVPTYNLPGIKGLVFNSEILVDIYLGKITRWNDAKIKALNPDVNLPNIPITVVHRSDGSGTTNIWTSYLTRVSDEWKNRVGMGTSVNWPVGVGGNGNEGVAGVVINTPGAIGYNSLSYALLNNMSFGYVKNAAGNIIEPTYAATTEAANPADTRILFTNTPAPNGYPIAGFAWMLVYQNLEKNNSNQSEAEELIEFLVWSIT-EGQELSEGLGFARLPDAAIERNIEMIKQLKWNGELI.. 373
180 9.000e-95UniRef50_A0A1V6FU46 Phosphate-binding protein n=2 Tax=PVC group TaxID=1783257 RepID=A0A1V6FU46_9BACT  ali  30  5......LSVLGLTFAISATLTAQTVINGAGASFPAPVYQSWTYTYSQTGPSKVNYQSVGSGAGVNQLKAKTVDFAGTDNPLTKEDQEK--EGMEQFPMLLGGVVVIVNLPGVKELKLERSVLADIFLGKITSWDDARIAKANSGLKLPKTKITVVRRADSSGTSFIFTNYLSKISKEWETKVGAGASVNWPVGIGGQKNPGICNNVAKIRGSIGYTEYTYAVEANLACAAIENQTGKFITADVDSFRASAANAEWDMVLTDQPGEQSWPITGVTYILIRKD-----ADPAMRQAMINYFNWCFTT-GATAAQKLNYVPMPENVVKMVEAQV............ 329
181 1.000e-94UniRef50_A0A2V8F145 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8F145_9BACT  ali  37  38ATSAPSGSNAPANAGVPAPASAQVTVTGAGATFPKPLYDVWFQTYQQYGNVQFNYQAIGSGGGIKGITEQTVDFGASDAAMKDDELAKLPAGMLHIPTALGAVVVIYNLPGVTDLKLDGETVGSIYAGKISKWNDPKIAALNSGVTLPASSILVVHRSDGSGTTNAFTAYLNTASTDWKATAGAGKDVKWPVGQGAEKNDGVAAGVKNTPGAIGYVELQYATQANLTSAKLKNADGNFVAGSTAGVTAAANADSRQAPIINGPGADTYPIASYTYLLVYRDQ----KDKDKGTDLVSFLAWALT-DGQGIEEGLGFAPLPAGVQQKALAAVHTITTGGASIW. 385
182 3.000e-94UniRef50_A0A0P0G4G0 Phosphate-binding protein n=1 Tax=Candidatus Xiphinematobacter sp. Idaho Grape TaxID=1704307 RepID=A0A0P0G4G0_9BACT  ali  33  30.........................LQGIGASFPSPLYQRWIAEFRKRPDIEVNYQAIGSGAGIKGLKRNVVDFAASDV-IAPEESVAIPKGIVTIPAIGGSIVLGYNLPGITSLKLSRKAYTDIFLGKITCWNDPNIASINREVVLPNLPVLVVTRSDGSGTTFAFTRHLSAISQDFKKAIGANKSVAWPIGVAGKGNDGVTTLIKQIPGAIGYMEYSYAVSSKVTFPKLQNKSGNFVRATPASGYAALSSVSSSEDSTDPDGREDYPIVTFSWLLLHRSY----EDTEKGRALKAFVGYALTT-GQSFATQLGYVPLSSLMVKKTQEKLISI......... 334
183 3.000e-94UniRef50_A0A2D0I7J9 Phosphate-binding protein PstS n=6 Tax=Campylobacterales TaxID=213849 RepID=A0A2D0I7J9_9HELI  ali  29  8........GLVIAAIAATSMVAADKINGAGATFPAPCYYDWAYNYQKATHTRVNYQAIGSGGGVKQISERIVDFGATDAPLTPKELDAA--KLTQFPAVIGSIVVAHNIPGIADLKLKNSVVAEIFAGQITMWNDPKIAADNPGINLPAQKIIVAHRSDGSGTTFVFTDYLSEASKMWKSKFGTGKAIGWATGVGGKGNEGVTNLIKQTPYSIGYIENAYKEKNNLAAATLQTAEGKWVSATLPNFQAAVKQAKWSKKDHFYSSDNAYPIVAATFILMPRDADK----ADTRNDVIRFFDFSFKN-GDAAAQKLGYIPLPVETTNLVRQYWNETK........ 333
184 4.000e-94UniRef50_A0A2G7GIQ3 Phosphate-binding protein n=36 Tax=Cyanobacteria TaxID=1117 RepID=A0A2G7GIQ3_9CHRO  ali  33  38..............SPAAEQGPSANISGAGASFPAPLYQRWFTEYNRNQGVQVSYQSVGSGSGLEQYINGTVDFAASDAPIQGDRLAKYNAEPIQVPMAAGAVPLAYNLPEIQELRLSREAYCGIVTGQVTRWNDPLIAQANPNLNLPDREIIFARRSDGSGTTFIFVNHIDSACPNW--QAGVGTSVDWPVGVGAQGNEGVAAQIQQNEGTIGYIEYAYAKLNEIPTAVLENASGEYVAATPESAGAVFDPDDFALLVPDPENPAAFPIAGLTWIMVYPTYD----DANKWQAMRNVFEWSLT-EGRPIAEELGYIPMPESVVERIRQVFDRVKAG...... 366
185 5.000e-94UniRef50_A0A0K1PSL8 Phosphate-binding protein PstS n=1 Tax=Labilithrix luteola TaxID=1391654 RepID=A0A0K1PSL8_9DELT  ali  31  16ALLVLPLVVACSRSGSVPSETSPQVLVGAGATLPSPLYSKWASSYATEPTVRVNYQSVGSGAGIRQTTDGVVDFGATEEPV--------PGTLVHVPMTVGAVAFAYNATIDGELALTPNLAANILLGRIKRWDDEAIRAENPGRSLPSEPITIVHRADGSGTSAALTTWLSARSDAWRTEVGAGTAPRFPVGVGAKGNEGVAALVKSTPNSLGYVELAYAKHAGLRTALVANRAGKRVAPSVEGIARALASSPALGDDFEATDESAYPIVAVSFVVLREN----THDQARSAALAKFLWWAI-HDGQQFAQPLDYAALPSSLVTRGEVALHALKVDGKPVL. 350
186 6.000e-94UniRef50_A0YMX3 Phosphate-binding protein n=3 Tax=Oscillatoriaceae TaxID=1892254 RepID=A0YMX3_LYNSP  ali  31  10..TLTASVAVVTLSFATIGQAIAVSLKGAGASFPAPLYKRYFEEFNKQTGISVGYDAVGSGAGIEQFIANSVDFAGTDAPPSQSQIDTMPNGVVQVPTAGGAVAVVFNVPGVSELKLPRSTVADIFQGKITQWNDSKIAKANPGVNLPNLPMKPVVREDGSGTTYIFTRHLSSTSPLFQKTVNVSPLPNWPGSLKAPQNTGVANTVQQTQGAIGYVQDTFARQKNLPTAQLENLAGEFVAPTFEETSKALESVRFYNDFRAADPEQGYPIVGITWMLVKQNYD----SAQKADAVKKMVGWVMS-EGQGLNQSLEYTRIPQAVSNNIVEVVQQ.......... 339
187 6.000e-94UniRef50_A0A2T1EWH3 Phosphate-binding protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A2T1EWH3_9CHRO  ali  28  22SIALIGLVATACGGGGGGGSKSLPSISGAGATFPAAAYQRWGGDFASETGNKMNYQSVGSGAGVRQFLAGSVDFGATDEQLSEEDFAAGERGAVQIPMLGGTVTPAYNNPDCPDLKLTQAQLADIFLGKITNWKQLG---------CPDRPLTVAHRSDGSGTTYVFTNSLSCFSKEWEEKVGKGKAVQWPVGVGGKGNEGVAGVISNTPGSLGYLNQAYVQGL-IKPAKLQNKAGNFVLATGESGAAALNGIKLDERLGNPAGADSFPIAAFTWILAYQ----SGQGKEKAEAVRTFLTWALQEGPQATAAELGYVPIKGEVLERAKAEIAKIK........ 349
188 7.000e-94UniRef50_A0A1F4NBN3 Phosphate-binding protein PstS n=4 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1F4NBN3_9BURK  ali  31  29........................DITGAGATFPYPMYAKWAEVYKKETGVGLNYQSIGSSGGIKQIRAKTVTFGATDAPVKGEELDR--DGMVQFPAIIGGTVPVINLEGPGELRVSGTVLADMFLGKITKWNDAKLVALNPGKNLPDQSITIVHRADGSGTTFNWTDYLSAVSKEWADKVGKGAAVKWPSSVGGKGNEGVAANVNRVKGALGYVEYAYVKKNNMNYMQLQNKDGKYVKPDDTTFSAAAAGVDWNVSMVDAKGANSWPVTTASFILMYKSP----EDKTASQEALKFFSWAFKN-GKKLAIDLDYVPMPDAVTAQIQSKWSQIK........ 343
189 8.000e-94UniRef50_A0A2D1IEU6 Phosphate-binding protein PstS n=1 Tax=Micromonospora sp. WMMA2032 TaxID=2039870 RepID=A0A2D1IEU6_9ACTN  ali  24  18..ALTACGPAPTREPTPGVACARGTLNGQGSSAQANAVQVWSTAFQRAPGTTINYEPSGSGAGITSFIAGVADFAGTDSPLSPDELEQAGAAPLALPMAVGPVAVTYHLPGNPPLRLTPGTVAAIFSGAVRRWDDPAIRADNPGTALPSIGITPVHRADSSGTTEAFTTFLAETASGRWP-YGASRKWPLPGGVGVSGSKRVPDAVEEKQGRIGYLELSYLRGRDLPAAAVRNGAGEFVAPSSRATVKALGPDLRLSLERATRAPGAYPLALVTYEVIC----ERGLAVDKAPLARAFFRYTISSQGQGAAGDLGYAALPEAVRRRVGTAVDRIS........ 354
190 1.000e-93UniRef50_A0A259F4R9 Phosphate-binding protein PstS n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A259F4R9_9PROT  ali  35  32........................DITGAGATFPYAVYTKWAEAYQSATGNKVNYQGIGSSGGVKQIRAKTVDFGGSDAPVQEAILDEVG--LVQVPTVMGGVTIVTNIPGIKQLKLDGVTAADIFRGAITKWNDPAIAKLNPGVALPDLAITVSHRSDGSGTTYAFTHYLAKQSMAFQREVGAGNTVNWPNAVGGKGNPGVAANVQKIKGTIGYVDIADAMKNNMNFVALKNKAGNYIVPSQASVADAAAGADFAPDLLDQSHKNAWPITSATYMLAYEK----GSDAAKQKGVVDFFSWSL-NNGQKMAADLGFVALPANVVKMVEAEMKKIK........ 343
191 2.000e-93UniRef50_Q2J531 Phosphate-binding protein PstS n=18 Tax=Frankia TaxID=1854 RepID=Q2J531_FRACC  ali  25  31....SGGTAAKPSNGASAIACEKGSITGSGSSAQKNAMDEWVKAYQNADGAKINYQSTGSSTGRQQFVAKQVSFAGSDSALKDQQKTDAPGTAVDLPMVVGPVALIYHLSGVDKLQLSAPTIAKIFSGAITKWNDPAITAENSGVTLPDAPIASVHRSDGSGTTDNFTKFLKGAAGAAW-TFDSGSDWKAPGGQGAKGSDGVTATVKSTENSIGYTELSYAENAGLSTVAVKNGAGEYVKASTDTAKVASGDDLKLTFDYTAATKGAYPIYLVTYEIACT----TGLPADQAKLVKSFLTYTASDAGQSSIADLGYAPLPDSVATRVRAVVDKLS........ 369
192 3.000e-93UniRef50_UPI0002F0B92E phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI0002F0B92E  ali  36  483............TPQPQAGPFAGVILNAGGSTFVNPVLSRWTGVYEKSRGVRIDYQPVGSGKGVTGMTDRVFLFGCTDAPMTDGQLAKSGGAVIHIPLVMGAVVPAYNLPGVDQLMFTGPILADIYLGKITRWNDPAIVANNPGVKLPDMPIQVVRRSDSSGTTHIWTDYLAKVSAEWRDKHGVGTEVRFPVGQEAKGNNGITGVISRNIGSLGYVELTYAMQNNLRYGKVKNREGSFVNPSLESVTAACSPADLRYSLTDAPGEESYPIAGTAWAVLFVDQTGN----ASGRELIDLLRWA-THEGQSYARELKYAPLPPELVPLIDGKLNSV......... 809
193 3.000e-93UniRef50_UPI000C1EEAEB phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Microbulbifer TaxID=48073 RepID=UPI000C1EEAEB  ali  31  57..........VSPAPSTPDNGAQIQLNGSGASFPFPIYTKWFRDFSEETGVQVNYQATGSSAGIEDFIAGTVDFAASDAAMTENEIAEVSRGVVLLPVTAGEVVLAYNLAGVDALKLPRDVYPDIFLGKIDHWQDPRIIAANPNVVLPDLKITVVTRADASGTSYVFSGHLSAISVNFLSAIGQSTTPNWPNFVSAPKNDGIAAEVKQTPGAIGYMTYGFAKQTGLPVAQLENKVGNFVSPGPTGTLPGSTVPNLIAWVPDPGGNSAYPIVSFSWLLLYVDQ-----DNDKAAALRRLVDYVLGDDAQAEASALGYIPLPQNVREKVREAAQYLK........ 393
194 4.000e-93UniRef50_A0A127PY38 Phosphate-binding protein PstS n=9 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A127PY38_9BURK  ali  28  5....LFVLSCTLVLGVSHVTAHAADINGAGSTAAAPLYLKWDAAYNKKTGNKLAYELVGSSAGIKKIKEGATDFGASDAPMSLADLKK--SNLLDFPTVISGVVPIINLPGDGELRLTAEAITGIYLGKIDKWNDAVIARDNPKLTLPNLRIVPLARADGSGTTYTLTDYFSAVSPEWKQQYGRNFSIPWQAEIALKGSNDLVAALKKTPGAIGYAEFAYVIENNLNYAQMKNRDGQYVRPDANSFSSALANSSWKTTLTDKPGSGSWPITGATYVYVPR----VTSKPEQTKAVIQFFTWAFM-EGDTIANSLDYVRLPDNVQARVVHEMGNVVASGKQL.. 344
195 4.000e-93UniRef50_A0A258DT35 Phosphate-binding protein PstS n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A258DT35_9RHIZ  ali  34  24........................EVSGAGSTFVYPIIWKWSEVYRETRGTNVAYQSVGSSSGVNRIRDKTVDFGASDKPLKPEELERLGLG--QFPIVFGGVVPVVNIPGVAPIRFTGSVLADIYMGKITRWSDPALKALNPDLALPDSLIAVIHRSDGSGTTFNWVSYLSKASAEWKRTLGEGNSIAWPVGSGARGNEGVAVAVQRTPNAIGYVEFTYVTQAKLSYGLVQNSAGRFIAPSAAAFQAAALGIDWTATINDSPVADAYPIAATTFILLYKAPANAARNRAALA----FFGFALG-EGSAYASQLGYVPLPAPLVQQVKDYWAA.......... 333
196 5.000e-93UniRef50_UPI00069043CF phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Microbulbifer sp. HZ11 TaxID=1453501 RepID=UPI00069043CF  ali  31  47.....................GRARVVGAGASFPAPLYERWFKEYSRDQKYQVDYQSVGSAAGITNFLQGRVDFAGSDYPLEDASTARLDGGVLQLPMAAGAIVFIYNLEGVAELKLSRDVLAKILLGEIRRWNDPQVQKNNPEADLPDQKITLVARAEASGTTLHMSRHIEAYSKSFAERIGASKDPQWPSEIRARGNAGIARMVGSVPGAIGYVQYAYAENSKLPMALLENRAGNMVAPGPASFQSALEGRLTRQNIADPEGVNGYPIISFSWLIMRKSY----RNPDVYPVMSAMIHYGLG-EGQEVVEEMGYIPFPESGRRKLLEYFDS.......... 364
197 5.000e-93UniRef50_UPI00031C8C22 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI00031C8C22  ali  32  562..........STTTGPIVTPTSAIVLRGGGSTFIRPAMEQWSRVYEQQTGIKIEYSAVGSSKGVDGMISNFLDFSCTDAPLTADQLASAGSPIVHVPLALGAVAPVCNVTNEASIRFTGAVLANIYLGKIKTWNDPGIAVSNPGRELPNLDITVVHRSDGSGTTAIWTSYLSKVSSAWKSQIGEGVVVNWPAGIAAEKNDGVADAVSRTAGAIGYVELSYALANDLSVGQVKNKSGVFIGPSVDGISAAAAPADLRFSLVDAPGTEAYPIVGTCWAIMRINQPS-----ERGEDIVHFLRWI-TAEGQNELAHLQYGRLPKELAEKGSALLEKV......... 888
198 5.000e-93UniRef50_A0A1X1QKD5 Phosphate-binding protein PstS n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1X1QKD5_9GAMM  ali  30  7.......LALGLLGLTIGTAAHAAKIEGTGSSFAYPAYKAWSKVYYDETDNQVNYTPTGSGSGIKEVIAGHVDFGGSDKPLKPKALRKHG--LIMFPTAIGAITFAYNVEGVDNLRLSEAAISGIMLGKIKYWDDEPITRENAGASLPHKEILFVHRSDKSGTTFAFTYYLSKMNKEWRKKFGAKKVVEWPNRIAGKGNFGVATAIKSNAYSIGYVDYADAKKNGLDMAIIENREKAFIKPTPGSFEAAAVFADLDPYANIAYPPKGYPVVTATFALVPK-------DGKNSKEVIKFFEYALTKKNQ-LIEPVGYVPLPEAVIKKIQGYW............ 326
199 1.000e-92UniRef50_A0A2V9ZT24 Phosphate ABC transporter substrate-binding protein PstS n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9ZT24_9BACT  ali  28  12..SLVAIAGCLLLFAASDAPQSKISLVGSGSNVPINLYTAWTEEFNKNPSIQVRYLSMSTMEGIRQISEGSGDFAAGEIPLSQEQMHGGKVSLVQLPTVIVGIVPIYNLPGTPDLYFSGEVLAQIYLGTIKNWKDSRVAKLNPGASLPDLPIEVVHRTPGKGSNYIFSDFLSKTSPEFRAQVGRSASPKWPVGMEANRGEDMVEKVSAHPGAIGYVELNFARRSDIGYGSVQNSAGRFVRATPDTITAACKAADFNISMTEAPGKNSYPIASFTWIYVP----ASGAPAERSRAVKQFLSWGLS-DGQEMARGMGYATLPTGILSKAKATLNSVQ........ 346
200 1.000e-92UniRef50_A0A2M7W8B5 Phosphate-binding protein PstS n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2M7W8B5_9PROT  ali  32  23................PQPSRADNGILGAGSTFAFPVLAVWGYDLLNKGG--FDYRAIGSGGGIKSIVANAVDFGASDAPMKPEELR--ERGLVQFPFIMGGVVPAANLPGINKLNLTGPLLAKIFMGQVRRWNNPEIRQLNPDLTLPPIDITVVHRADGSGTTWIFSDYLTKVSSDWANTLGTDKEIAWPVGIGADGNSGVAEKVRSTVGAIGYMEFGAAMAKKLTLLRMQNRQGNFIAPSMESFQAAAAHADWKMVLTDQPGAEVWPIAGVTYALLP----AHSDHPTQTRRVLAFFDQCF-EQGQKTAAILQYVPMPPSLVDTIRHRWDE.......... 338
201 1.000e-92UniRef50_A0A2W6AWI7 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6AWI7_9CHLR  ali  36  315..................QPGGATSLTAGGATFPDPLYQKWFADYGAKYGVTVNYQAKGSGFGKQNLQNQTLDFGGTDAPMTDAELAAAKGGPVHIPTCLGAIVVIYNIPGSGTMKLDGDTLAKIYLGTIKDWSDPAVTAANGGAALSPGAIQVVHRSDSSGTTFQFTTYLANVNADWKAGPGASQSPSWPAGQGASGNAGVAGQVNATPFSIGYVEIAYAKQNNLKFADLKNKNGKYVTASLESITAAAAPADLRFSLINTPGDATYPITTATWQIVYKNQT----DKAKAIALVNLLNWELTI-GQTYNNSLLYGQLPPNLRDAALSKVKEI......... 632
202 2.000e-92UniRef50_A0A2K2V3G6 Phosphate-binding protein n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2K2V3G6_9ARCH  ali  37  35............................AGASFPYPLYMTWIKEYSRNPGAIIDYQSVGSGAGIRLLNEGKIDFAASDMPLYDE-------RYLVIPSVTGAVVLAYNLP-FDKLKLTPDLIADIFMGRIKRWDDPRIAELNPGLK---GDITVVHRSDGSGTTYIFTSYLSAISEEWNRTVGRGLVVGWPVGVGGKGNEGVAAVIMQTEGSIGYVEYTYAVQARLKTAVIRNKAGNFVEANETTVKAAISSADPRAPIINSGAANAYPICSNTYIVIPKELRG-----EKGKAILDFLKWAVKH-GQAYAPSLGYVPLPEELVEIDERLLEGIK........ 331
203 2.000e-92UniRef50_A0A1I1EWC7 Phosphate-binding protein n=1 Tax=Brevinema andersonii TaxID=34097 RepID=A0A1I1EWC7_9SPIR  ali  31  5....FAKITALLLSINSCSSNAVINIQGAGSSFANPIFTKLFADYAATHKTQVSYQATGSGAGIQNIASGIVDFSATDAFLNDQDLKNYGIEMLHIPAVLAGVNFTYNIPADEPIYLNPELIYQIYSGQITKWNDPQIVSLNQQLSFPDINIIPVFRSDSSGTTFTMSEFMTKANKKWADIFGTGKSLNWTTGVGQKGNSGMMAFTKENTGSISYVDYVYAKQNNFPVAAIQNKAGNYVIGDIQNTFAAADPADSRVSLTYTDGANAAPMTTFTYILVRKEQNYNNRSKEQAQALVDLLAWMFTEEAQAQHESLYFAPLPQNVIDTGKNILTQIKYNGETLY. 361
204 2.000e-92UniRef50_A0A1J4YSU5 Phosphate-binding protein PstS n=2 Tax=Hydrogenophilales TaxID=119069 RepID=A0A1J4YSU5_9PROT  ali  34  29.........................ITGAGATFPAAVYSKWAEAYKGATGNQVNYQAIGSSGGVKQIKAKTTDFGGTDAPVKEADLDAAG--LIQVPTVMGGVTITINLPGAKQIKLDGATAAEIFRGAITKWNDPAIARLNPGIRLPVTSITVVHRSDGSGTTYVFTNYLAKQSTAFMREVGAGNVGNWPNAVGGKGNAGVAANVLKIAGAIGYVDIADAMKNKMTFVALKNKAGHYIVPNQNAIADAAAGANFAPDLLDQTHKNAWPITSATYMLAYEK----GSDSAKQKAVVDFFKWSL-NNGQKMAKDMGFVPLPANVVKMVEAEMKNIK........ 339
205 2.000e-92UniRef50_A0A166TEW4 Uncharacterized protein n=2 Tax=Haladaptatus sp. R4 TaxID=1679489 RepID=A0A166TEW4_9EURY  ali  32  1.....................................MNKWADEYNKKNDVEVNYRSIGSGAGVSNLMDKTVVFAGSDAPLSKDQYKKVEGGCVHIPESLGAIAPVFSVEGVDSLKITGEVLADIFLGNITKWNDSKLKKLNPDANLPSANITVAHRSDASGTTYGFTGYLSQVSSKWKSQIGQTETPSWPVGVGGKGNEGVSAAMKKQKNAIGYVELTYAKQNDLDVFKMKNKSGKFVEASPENDLPKGTDDWSDVSISNAPGEKSWPISTFTYVIMYKDFGKAYEDKEEMKKALKFVKWAV-NDGQQYAPKLHYPKLPSPAAKLDNSTLKNMTFNGDTVL. 318
206 2.000e-92UniRef50_UPI0009EB7D1B phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0009EB7D1B  ali  29  31...........TATATAGAESATMAVSGAGSSFAAPMFNHWFKTYAAHPDLSLSYDSVGSGAGIDRFLDGSVDIGATDAPIGADEAEQVGGDFAQLPITGGMIAITYNLPEDGPLNLPRDVYPAIFLGDIYRWDDPRIAAANPGINLPSKLIQVVGRRDSSGTTFAFTNHLAAVSEAWAAAPGVGKKIDWPGGMEANGNEGVAQRLKITPNAIGYVEAGFAQRLGLPLAWLENRTGGFVQPNVDTGRRGLAPDDLTRTIPDPQGSRSYPIVTYVWALVRADY----GTPEKTQTVNDLLRWILT-DGQTDAESLFYVPLPANLAQAALAELDALK........ 358
207 3.000e-92UniRef50_G8S973 Phosphate-binding protein PstS n=408 Tax=Actinobacteria TaxID=201174 RepID=G8S973_ACTS5  ali  28  16ATIALTACGSTGAAAPSAGTCVGGTLAAQGSSAQKNAMAEWIKAYTASSAAKIDYQPTGSGAGVKALISGLADFAGSDSALKDDEQAKCASPALNLPMVVGPIAVVYNIQGADGLQLSPSLIAKIFSGKITKWNDPAIAAENSGAKLPDATIEAVHRSDESGTTDNFTKYLSKTAEGDW-TYDHAKAWAAPGGTGAKGSDGIAAKLKSTPNTISYVELSFAENSDLQKAKIKNGAGEYVELTGDAAGKTIEGAKVTGKGNDTATAGAYPIVLATYEIVCSKYA----DAAKGKAVQGFLKYTSSAEGQKKLADLGYAPLPESVRTKVATSVAALS........ 366
208 3.000e-92UniRef50_A0A1F8VBG3 Phosphate-binding protein PstS n=1 Tax=Coxiella sp. RIFCSPHIGHO2_12_FULL_44_14 TaxID=1797697 RepID=A0A1F8VBG3_9COXI  ali  30  29...........................GAGSTFVYPLIARWAVSFKKQTGHEINYQSIGSGGGLNQLRQRTVDFAAVDMPQSPHFL--NHQQWIQFPLAMGAIVITINVPGIASLKLTGPVIADIFLGKITRWDDPAITALNPTLKLPAINIAVIHRADGSGTTFNFTHYLSLVSPTWANEVGANTDVNWPTGIGGKGNTGVAMFTQRIPGSISYTEYSFAKLTGLSTVQLQNRAGNFLSPCIENFQAALESMDWNAFILNPNGANSWPIMATTFVLLPIK----AKDTAKTALILQFIYWGYT-QGVTAAKQLDYIPLSSSLMGTIKNYWQQ.......... 335
209 3.000e-92UniRef50_A0A1D9HBA4 Phosphate-binding protein PstS n=13 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1D9HBA4_9BURK  ali  34  19..................PAAHGSEITGAGSTFVYPVLAKWAASYYSKTGKAVDYQPIGSGGGIQQVKAGSVTFGATDMPLRPEEL--HSAGLAQFPLVVGGVVPVVNLDGIQPLHLTGPLLARIYLGTISNWNDPAIAADNPGLVLPDRKIVVVHRSDLSGTTFNWTDYLSKVSDGWQRQVGAGTTVRWPVGFGASGSDGVSLYIRNVKGAIGYVELTYALQRKLAYAAVRNQAGVFVQPTWDSFSAAVASAQWTPVITNASGDKAWPITGVVYVLM----QRRGKSAGDARDALAFFRWVL-QEGQADADREHYVALPEPLVRQVEGYWSE.......... 334
210 4.000e-92UniRef50_A0A2E2WP60 Phosphate-binding protein PstS n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E2WP60_9GAMM  ali  29  6...LLKTVSLGACLLSGTALAAGTSVTGAGSTFIYPVLSKWTTTYAKTAGVQINYQPIGSGGGIQQLTDKTVTFAASDMPLNIKTLQQ--KKWVQFPMVTGGIVLAIHVQGIKNNQLTGKTLADIYMGKVKYWDNPEIKALNKGVTLPHNMIVTVHRADGSGTTFNFTNYLSKVSPAWQKQVGANTVVSWPSGLGAKGNAGVAAQVMNTPNTIGYVEYDYAIQNNMAMTKMVNAAGKTVSANLAGFASAAKSANWQASLTNQPGAASWPIVATTFILMPTK----GVSPQTVHATLSFFKWAFT-QGANTATQLDYVTMPPSVAQTIMAQWASV......... 338
211 5.000e-92UniRef50_G6F396 Phosphate-binding protein PstS n=3 Tax=Commensalibacter TaxID=1079922 RepID=G6F396_9PROT  ali  30  13...........AVVLPSAHAQDTATVTGVGSSFAAPLYQNWAASALKDINLKVNYQPLGSSAGQNQIIAKTVNFGALDMSTSVEQLSQA--NLVQFPTAIGGIAVVVNIPGIKELRLTGDLIADIYAGKITKWNDPRIVAMNKDLALSAIDIAPIYRADGSGTTQVFTSYLSKESEGWKKSFGSNTSIAWPTGMGGRGNGSVASMVKNMEGGIGYVEYAYALQNHLNTAQLKNLAGEFVSINEDTIQAAAKAADWSIDLIDMKGDDSWPIVSTTYVLIPAFNKDS-------KEVTKFFQWGFSH-GDEIASKLHYVPLPIVVKEKIAKTWE........... 331
212 5.000e-92UniRef50_D7CQN6 Phosphate-binding protein n=1 Tax=Truepera radiovictrix (strain DSM 17093 / CIP 108686 / LMG 22925 / RQ-24) TaxID=649638 RepID=D7CQN6  ali  42  17......................AQDLNGAGASFPDPLYQEMFAAYNEEFGIQVNYQAIGSGGGRSALLDQTVDFAGTDAAFSDEELADAPGTILHIPTASGAVVLGYNLAEEPELTLSGEVVADIFLGNITEWSDPAIAELNPGAELPDLPITVAHRSDGSGTTAIFVDYLAKVSEQWASEVSTGTSVSWPTGIGGDGNAGVTNIIAQTPGAIGYVALEYAIENNVTYANMINAAGNTVEATLDAVAAAADPADLRATFTNSENPDAWPVAGFTWVVMYEDQNYAGRSRERAQQTLDLIRWMIT-DGQRFNNPLNYGQITGFPQERALELLDGVNYGGQPL.. 344
213 5.000e-92UniRef50_A0A2E0EC64 Phosphate-binding protein PstS n=202 Tax=root TaxID=1 RepID=A0A2E0EC64_9ACTN  ali  29  14ASLGVAIGLAACTSSDKGNVEQRGRLSAAGASFPAAIYQRWFQDLAPK-GIQVNYQSVGSGAGVRQFTAGTVDFGASDKPMKAEAIAKVSRGVVQVPMTAGAIAVAYNNPGC-ELKLTQKQLAEIFLGTIRNYNELGCEA---------KGIKVVHRSDGSGTTYNFTKHLSAISPEWNKSVGADKSVQWPTGVGAKGNEGVAAQLSQIDGGIGYVELAYVKGR-LQAAAIENGSGEQVVPTNATASEALGSIDLGPDLINANPMNGYPIVTFSWVLAYANGNGNNTSLLKTT-----FNYMLSEESQAKAPELGYVSLPPDVIAQAKAAANTIK........ 333
214 6.000e-92UniRef50_A0A1E4K6Q5 Phosphate-binding protein PstS n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4K6Q5_9GAMM  ali  28  3.LVLRRFAALCLFAGAMFPAAAQNTVSGAGSTFVEPVLAKWAAQWSQRNSAVIRYEGVGSGAGIDRLKAGRADFAATDAPLKDEELQAGGWR--QFPIVAGGIVPVTNLRGVGRKRLTGPLLARIFQGKITRWNDPALQAVNGVFTLPDEPITVVRRGDSSGITYNFTAYLSKISAEWAAELGTGKTVKWPVGIAAEGNAGLGQRVIETPFSIGYVEYGYALQHEMQIVNLYATAERAISPTQTTIRNALESADWRSLLVGIQGTDTWPIAASTWIVMPRDAQK----AQNVREALAFFDWALQRGG-ETADALGYTPLPPGLIGLIRDSWKR.......... 335
215 6.000e-92UniRef50_A0A220VDZ7 Phosphate-binding protein PstS n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A220VDZ7_9GAMM  ali  29  5...LSLLVPVIAGICVSSSAFAASTISGAGSSAIAPALYKWAEAYNKATGNKVNYAAIGSGGGLRQITAGTVDFACSDKPLKW----LNDHKLVQFPMVMGGIVAIFNIPGVGKLVLDGPTLSAIFQGDIKKWNDPKIAKLNKGVKLPDLAITVVHRSDGSGTTYNFTNYLSKVS---NWKPGVDSAIQWPTGLGGKGNAGVAQYVKTLPGSIGYVEYAYALQNKLTVTSMKNKDGKVVTPKFETFSAAASNANWDMILTDQPGAQSWPMAMSTFCLVHYKDENGKKVSAKATDALNFFKWSYKN-GQELAKQLDYIPIPDAVYGKIETSW............ 341
216 6.000e-92UniRef50_A0A225CZ22 Phosphate-binding protein n=2 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225CZ22_9BACT  ali  31  18ALLAVGCSGKTPPTAATTPGGPATTISGRGSTFIQPIMKFWTEEFRTDNKVKIDYQGTGSGDGVKGVTDKLCDFGCSDFPLNEEQIKQAGGPTVHIPLVIGAVVPMYRLDGVDKLVFSGPVLADIFSGKITKWNDAKLKDLNPGANLPDVSISPVCRADKSGTSFIFTDYLSKVSPEFKKTVGVSSEPKWPVGTKQQKTDGVAGHITKNNGAIGYVELTYALDTKAGYGAVVNKAGKTVRADLDSITAAAAATDLTYNLTDAAGDASYPIAALSFAIIYQKQSGP-----KGKAVVEFLKWASSPAAQELAKKRNFAPLPVKLQKQIHEKLGKV......... 374
217 7.000e-92UniRef50_I1XEY6 Phosphate-binding protein PstS n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=I1XEY6_METNJ  ali  28  17SLSLTACDSNNDPAEISEIDDNRSAIIIAGSTFASPFFEKVLQTYEQ--GKKFSYHSIGSGAGIEQFITGDADIGTTDAPINEKEAARLNENYEEIVVISGMISIAYNVEGTDTLKLPRDVYTDIFLGEITRWNDPRIVAANSDINLPDRVIQVIARSDSSGTTFAFTNHMSTVSPAWKTTFGATKKLDWPRTTEAKGNEGVSQRLAITNNSIGYVEFGFAQRLGLKVASLENKSGKFVLPNNETGDIGLEAEQLVSSIADPEGESAYPIVAYTWALIRKKYETPGI----GSEIRDFIKWTL-NEGQSLAAPLHYLPLSPEIIEAEQEKLEQ.......... 350
218 8.000e-92UniRef50_E8R0V2 Phosphate-binding protein n=1 Tax=Isosphaera pallida (strain ATCC 43644 / DSM 9630 / IS1B) TaxID=575540 RepID=E8R0V2_ISOPI  ali  31  29........AALSLLVAGCADREVVTLQGAGATFPEPLYKRWFREYYDNPKVRISYQGIGSGAGIKQFLNGLTDFAASDAAMTPDEIASAPGGVKLLPMTAGCVVLAYNLPGVEPIRLPRAVYARMMLNEIERWNDPAIVAANPGVDLPNLPITVVQRSDSSGTTYLFTQHLVEVLRQIQPDLKAGKSVDWLAGIAAKGNPGVAFTIDQTPGAIGFLEYGYTRVSGTPTAILENRAGSFVAASPQSAALGLAEAEFDAWIPDPAVEGAYPIVGYTWILVRGRYD----DPKVGSALKAILRYGI-DQGQTYAADLGYVPLPPATVEQVRQAIDSIEVANAA... 373
219 1.000e-91UniRef50_UPI000D3EAEC8 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Polynucleobacter rarus TaxID=556055 RepID=UPI000D3EAEC8  ali  30  13......AAVLFFSMMICQYTYAATEISGAGATFPLPILKQWISGYEENHSVKVSYLGLGSAEGIKRVTARTVDFAVTDIGLTKSELSQ--DDLLQFPLVAGGITPVINLPNVGEFKLTGKVLADIYLGKITFWDDSRIQSLNPSLLLTHLPIHVIHRKDGSGTTFTFSGYLSKVSDDWQKSLGMGSYLRWPVGEGQIGNEGIAKKVFELEGAIGYVEYLYAERFKLTTVSLQNKDGDFVIPNIDSFRRAFNQASWYESLTNLPGSNSWPIVAISYVLIHR----TNNDRLEIIKTLDFFDWIFSS---SKSIDGGYISISDTLLRRIKSSWKVLTSKGNPVLK 349
220 2.000e-91UniRef50_A3DN12 Phosphate-binding protein n=2 Tax=Staphylothermus TaxID=2279 RepID=A3DN12_STAMF  ali  29  35.........SSLSTTTVQEEKSKVYLRGSGATFPLPLYEEWIEEFMEQNNIIVDYEGIGSGAGQEQFFKGLTDFCGSDPPLSHEKWLEYKGKVLQLPTILGAVVVTYNVPEISHLNISGEILALIYKGEIEYWDDPHIKSLNPAIRLPHQKIIVVHRSDASGTTQIFTTFLHKSAPDIWPEELVGKTIDWPRGIGGKGNPGVTAVVVNTKYSIGYIEYQYALKNNLPIAAVMNKEGVFVLPSKTTIQSAAKYALTTGLIPDAPGKDSYPITAFSHIFVWKHYD----DKEKADAIKTFIKWIYT-EGSKHVIE-GYVAVPDEIKGIALKSINMI......... 379
221 2.000e-91UniRef50_UPI000A19F1EB phosphate ABC transporter substrate-binding protein PstS n=1 Tax=unicellular cyanobacterium SU2 TaxID=1981054 RepID=UPI000A19F  ali  29  11..VLTLSTTALVMALGATGEAIAQSLNGAGASFPAPLYQRYFSEYKKATGVTVNYNSVGSGAGIRQFVGETVDFGASDVAPSSSEKGKMKRGVLLVPTAGGAVAVVHNLKGAGNVQIPRQVLPKIFSGEITNWKQV-------DSKLPNKAIKVVVRADGSGTTAIFTSHLSAVSSSFKQKVGASKEPNWGTVLKGPKNDGVAALVKQTDGAIGYVQDTYARKNNLSTAKIQNKAGRYVEPSLAEANKAMAGISFNSDFTANDPSDGYPIVGITWLLLYKDY----KDNATAAQVKRLANWILSS-GQSINGQLEYTRIPASVAQKVKAEVNKIK........ 334
222 2.000e-91UniRef50_A0A1Q3SVN4 Phosphate-binding protein n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SVN4_9CHLR  ali  31  2.................TAASLNANLNGSGSTLVNPALKVWQTEFGKAPNVKVNYPAGGSGQGRSDFLTGKTDFGVSDVQITSAELQQNNKDVIMIPATLAAVVLTYNVPGVSDLQLSPEVIGGIYTGKITKWDDAKIKADNPNATLPSLDIKFAVRSDSSGTSDVFTSYLVAISPDFSAAMGGKSSGQPKNVTTASGNDGVAGLVKQTPGTLGYNEVAYALQNNLTYASIKNAAGKFVKPTLDNISAAAGSANLKVVLVNQPGDNTWPISTTTYFLLNKDYS----DAAKGQAIVALV-WFATHQGGTDAKSANYAPLPSSLVSLVEAKLKTITAGGQPVIK 336
223 3.000e-91UniRef50_A0A223Q6K5 Phosphate-binding protein PstS n=35 Tax=Actinobacteria TaxID=201174 RepID=A0A223Q6K5_NOCDA  ali  30  39.....................LSASLTGAGASFPDPLFQDWIYTYSNQPGVSVNYQSVGSGAGVEQFLEQTVDFGSSEEPLGEEDLAAAGCEAVQFPVVFGAVVIAFNNPELDGLVLDAETIAAIYDGQITTFDDPAIAELNPDMELPGDEIIPVHRSDSSGTTYVFSHYLSTEVDSWAEKYGEGKEIEWADGVGGQQNDGVAQGITQNPGGIGYVNQSFAQEAGLSVAHIVNEDGNPIEPTLESTIAASEEAEIPDNFIDNIGGEGYPIAGSNWIFTYT----CGYEQASADAIIDFWTWALTDEGADLAGELGYAPLGQELTDRVVAELEK.......... 357
224 5.000e-91UniRef50_A0A011QU68 Phosphate-binding protein PstS n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A011QU68_9PROT  ali  31  15....LTLLLPGVQAQTPAASEAPNVLTGAGATFPAPLYKKWIAAYRKDPAVVLDYKAVGSGEGVKRFLADSVDFGASDAALSDEQIAAAPRGAVLVPATAGMIALVYNLPGNGPLQLRRDTCAALLMGRIPRWNDARIQATNPGLNLPDREIVLVARLDSSGTTYALTNHLSAASTQWRDRPGTGKTVSWAAGTMVRGNEGVAARVKMTVGSIGYVEFGFAKHLGLPVAHLENKEGRYVAPAAGAANLARIPANLRVFIPDPDGAGAYPIVSLTWLLLKERYT----DQAKAQALKRFVNWGL-QEGQNMSSEMGFIRLPGDLIVRSQAALGMV......... 349
225 6.000e-91UniRef50_A0A1L4D0U1 Phosphate-binding protein PstS n=1 Tax=Silvanigrella aquatica TaxID=1915309 RepID=A0A1L4D0U1_9PROT  ali  29  12.......LGASLALTASYSSFASDLITGAGSSFIAPVLYKWSAAYNADKGIKINYQSIGSGAGLKQIEAKIVDFGASDMPLKSEELEQ--KGLMQFPAIIGGIVPVVNIEGVGQLILNAKLIAEIYTGEIKNWNDKRIAELNPTLKLPSKNITVVYRSDSSGTTFNFTHYLEKAGSQVW-KAGTGTAVAWPKGIGGKGNEGVTSMVKRASGSIGYVEYAYALQNKLAWTRLQNADGKVVEAFRKSFQAASLNAEWYVLLANQKGADTWPITASTFILVHKNQSK----PEIGSEVLKFFNYAFT-KGAESAQSLDYIPIPEKTYKLIESKWK........... 354
226 7.000e-91UniRef50_A0A2H1EJ01 Phosphate-binding protein n=2 Tax=Candidatus Nitrosotalea TaxID=1078904 RepID=A0A2H1EJ01_9ARCH  ali  31  55..........ADSTPAAPGDSDKYKFNGAGSTFAYPIIDKWRVEYTKQPGISLNYQAIGSGAGIKLYTTKKVDFAGTDAPLQSSDIAKAPKGTLHIPESMGAIVVVYNLQGVQQLKLTGDVIAKIFSGEIIYWHDNAIVKLQTDPNIAKAKIITVHRSDGSGTTFAFTSYLSQVSTDWNGKIGKGTSVPWPTGMGGSGNAGVAAIVKKVPESIGYVELAYAKTNKLAYAYIQNHDTAAAASGVISSLPTADGIWSNVSINDAPGPNAYPIATFTYLLVNPNLEQKGMDAQKAHDFVHMLYWFVT-DGQKYAEKLLYVPLPSAVQELDKKGISEIKYNGQQIW. 412
227 1.000e-90UniRef50_A0A0A0D3F0 Phosphate-binding protein PstS n=5 Tax=Bacteria TaxID=2 RepID=A0A0A0D3F0_9PROT  ali  29  18....................SQAADITGAGATFPAPVYAKWADTYKKESGVGLNYQAIGSGGGINQIKAKTVTFGASDMPLKAEDLDAAG--LVQFPMVMGGVVPVVNIPGVGKLVLDGDTIAEIYLGEITKWDDAKIKKLNPELSLPSTDIAPAYRADGSGTTFLFTNYLSSVNAKFKDSIGASTSVQWPTGIGGKGNAGVAGAVQQTEGGIGYVEYAYVKQNKLTYTKMVNKDGKTLEPTLKTFQAAAANANYFVILTNQPGAESWPITGASFILMYKQP----QDPAAAATALQFFAWAY-AKGVSDAEGLDYVPMPKAVVDMVEKTWDNIKADGKPIW. 342
228 1.000e-90UniRef50_A0A2G9MWK9 Phosphate-binding protein n=4 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2G9MWK9_9ARCH  ali  37  2..........................................................GSGGGVKQHIEKTVNFAASDAPLTVKEKGLAPST-IHIPETIGGVTVTYNVPEIPKLKLTGKAISGIFMGTITKWNDPLIKELNPGLNLPNKNIVAAHRSDGSGTTFVFTDYLSKVDPDWDKQIGKGKSVPWPMGLAAAGNEGVAGIIRSTQYSIGYVELAYAFQTGMTLAHVQNGDSKFVEPSIATITAAGDADWSAVSTVNAPGSDSYPISSFSYLLVYKDLKETSKNKEEAKAMLHMIHWMIT-DGQALAPTLLYSPLPENVVELGKKSLSQITYDGEVLWK 297
229 1.000e-90UniRef50_A0A2N9BBY5 Phosphate-binding protein PstS n=16 Tax=Actinobacteria TaxID=201174 RepID=A0A2N9BBY5_STRCX  ali  24  37.....GGSSNAAAPSNIKCDDASGQVLADGSSAQKNAVDAWVKQFSAACKVEINYKAGGSGAGVTAFTQGQVPWAGSDSALKPEEVEASGGQGIDLPMVGGPIAVGYNVPGVDKLVLDSSTIAKIFDSKITNWNDPAIAKLNPDAKLPNLKIQAFHRSDESGTTDNFTKYLIATAKKDFPYEG-GKAWQAKGGQSAPQSSGVAAQVKQTAGAIGYFELSYAKD-GIKTVAIDTGAAKPVEATVENATKAIAEAKVVGTGKDTKADGAYPMVLVTYEIVCDKGNK----AETLPAVKAFLRYAASEDGQKILAENDYAPMPEEIIGKVRTTVESLS........ 373
230 1.000e-90UniRef50_A0A2R7Y2S7 Phosphate-binding protein n=1 Tax=Desulfurococcaceae archaeon NZ3(B) TaxID=1973259 RepID=A0A2R7Y2S7_9CREN  ali  30  13.....................GKVAISGAGATFLAPQMFEWARIYTQTKGVVVEYQSVGSGAGRDMFFRNVTHFGASDVPLSKELYEKYRGRVLQIPVVIGSIAIVYNIPEIPNLCLSGDVIALIYKGEIKRWDDERILSDNPSLKLLGKEIVAVHRSDSSGTTGAFTIYLNKVAPNIWTKDLVGLTVDWPAGVGGKGNEGVTQVVQTTPYSIGYVELNYALLNKLRMAAVKNADGYCVVPNETTIVNAVDWSDVPQKLMNAPGRDSYPIVSFSFLLFWREYP-----KELAGAIKDFINW-LNTEGQGKTI-VGYLPIPEEVREINLKALQII......... 344
231 2.000e-90UniRef50_UPI0006788511 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Silvibacterium bohemicum TaxID=1577686 RepID=UPI0006788511 :_  ali  34  161.LAALKAGVSTAATAPGATGSTTVSLRAAGATFPAPLYQKWFQSFAAEPGFPIGYGAIGSVDGLQQLAASKIDMAASDIP---AQQDSAQPGLLYFPTIVGGVVPIYNLPGSGSLNLTPRLLADIYSGKIRKWNDSLIREANSGVRLPDTEIAVVHRSDGSGTTYAWTAFLATASPEWKTKVDA--SVTWPVGEDASGNEGVADKVAHTPNAIGYVELIYAIQHRLSYAAVQNPAGRFIKADLDSIIAAAANAHTPASILNAAGRNAYPIATFTSLVVPT----TGGNIERRAAVGKFLRWMLTT-GQKQGSALGYAPLPREVVADELRAVDALK........ 487
232 3.000e-90UniRef50_A0A1H4FJX5 Phosphate-binding protein PstS n=1 Tax=Rubrimonas cliftonensis TaxID=89524 RepID=A0A1H4FJX5_9RHOB  ali  33  26..........................QGAGATFPANLYRAWIDRFNDHPDIVVSYDSVGSSEGIRRFSAGLVDFGGTEQPMTDEAIAALGHRVLHVPTTAGMVVVAYNVPGVGALRLSREALARIFAGEITAWNDPAIQAANPDLALPDRTIALVTRRDGSGTTYIFSTFLNSASPAWSTAFRPGTLVDFPRAMLAPGNEGVSARLAITEYAIGYVEYSFARALGLPAALIENREGDFVAPTEATGRAALAGAASLLPLIVADAPTGYPIIGYTWALVNPD----REAGEGTAALRRFLEWSLT-EGQPMADTLGYLSLPEPAAERARDILAAL......... 335
233 3.000e-90UniRef50_E8RU36 Phosphate-binding protein PstS n=9 Tax=root TaxID=1 RepID=E8RU36_ASTEC  ali  29  11ALFLLAACSSGDAPKSEAPA--TGGLTGAGSTFFAPLASKWAETYKTSASISVNYQSIGSGGGIKQIKAKTVDFGATDKPLSVEDLNAAGLYQFPVVMGGVVPVVNVPGIEAGKLNLNGQLLADIFMGKIKRWDDPALKAANPGLTLPALPVTVVHRADGSGTTYLFTNYLAAVSPEWKSKVGASDALEWPTGLGGKGNEGVSAFVSQTTGSIGYVEFAYAIKTGAAYANLTNHDGQTVAPSAESFAAAAAGADWKNLLLNQPGAKSWPITGAVFILVYKDQA----DAAKAKSVLNFFDWAYTN-GDAASGELHYVPLPADVKALMRAQWASITSGGKPVF. 352
234 4.000e-90UniRef50_A0A225DUA5 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS n=2 Tax=Fimbriiglobus ruber TaxID=1908690 RepID=A0A225DUA5_  ali  34  523...........TEGPPPPVAQTGPALPAGGSSFIKPLMNEWAKSYEKQYGTKISYEGTGSGAGVQKMIYGNYLFGCTDAPMDNAQTRQAGGHVVHIPLVMGAVAPTYNLPDIKVLKFTGPVLAKIYLGTIRKWNDKAIEACNAGIALPDQEIVVVRRVGESGTTFIWTEYLSKVSAEWKTKVGAKTNPDWPAGPDAKNSDGVAREVNKTTGAIGYVEMTFALSNGLPVGLVKNAEGEYMAPTPASVTAAAAPSDLKFSLTDAPGKDSYPIAGTTWLYLKQPEPHPGEPGGKMAEMIKFLRWA-TTEGQKDAAKLHYAPLPAELKPMIDESLKKVTQG...... 866
235 4.000e-90UniRef50_A0A2G1DKT8 Phosphate-binding protein PstS n=4 Tax=root TaxID=1 RepID=A0A2G1DKT8_9PROT  ali  29  4.......VLLFTALALGTTFASAADIKGSGASFPYSVYQSWIKAYHSATQTQVDYVKKGSSSGIKDIKARAVDFAGSDAPLNPNQLEKA--KLYQFPAVVGAVVISYNVPNAKDLKISREALAEIALGKVKYWDNELIKKTNPNVDLPHKKLTFVHRADGSGTTFNFTYYLSKISKEWRKSFGAKKSLNWPGDIGGKTNTGVAALVKQTPYSIGYIDYADAKNNNLHMAVVENKEGHYIKPELKAFQAAAAKADLDPVIADPAGKNAYPIVAATFILLPKE------KAQTNKEVTAFYNYSFKNSA-KLATELGFVPLPDSLTDKIRKYWSE.......... 328
236 4.000e-90UniRef50_A0A1G0XYU1 Phosphate-binding protein n=1 Tax=Lentisphaerae bacterium GWF2_45_14 TaxID=1798572 RepID=A0A1G0XYU1_9BACT  ali  31  23..................CASDLERINGAGASFPALIYRIWTYNYSKASGTEIEYHSIGSEAGLSQLASGTVDFAASDTPLNSAFLEK--EDLVQFPMLIGGVVAAVNLSESGPLKLSPELLSRVFMGEIKEWNHPEIVSLNPDVPLPNRKITVVHRAEGSGTTWVFSKYLSSVSREWRERMGSGKILNWPGGIAASNNSGVANYIKKISGSIGYVEYNYALGAGLKCVMFKNQSGNFVAPSLAAFKSAASSLDWYSDLFNSPKPDAWPLIGATYIIMKKKQS----NPATTAEILLFFKSCFE---QESDEKLNYVPLPPNCVKKIEDSW............ 333
237 6.000e-90UniRef50_A0A2W5YY25 Phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Solirubrobacterales bacterium TaxID=1909295 RepID=A0A2W5YY25_9AC  ali  35  100........................TVNGAGSTLAAPVYQTWGSNLSSQ-GVTLNYAAVGSGAGIQQWTSGTVDFGATDPALKPAEIAAAKGTPVLIPTVLGGITVSYNLSTVKTLKLDGATIANIYLGKIKTWNDPAITALNAGTKLPPTPITVVHRSDSSGTTQGFTTFLSGYSPTWKSTVGANKSVKWPTGTGAQGNPGVAGAVKQTPGSIGYVEQAYALKNGFTYADVKNKAGNFVAPTLASTSAAASGAKVSPDLIDSPNSAAYPIASQTFIVVHQDLCKAGTSQAAAKALVSFLNYGLG-QGQQVAQQISYAPLPAPLLAKAKAAVSKLTCNGAPA.. 421
238 7.000e-90UniRef50_A0A1Q3TBC7 Phosphate-binding protein n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3TBC7_9CHLR  ali  30  83.......SSDGVFPGGLTGANLNANLNGSGSTLVNPALKVWQTEFGKAPNVKVNYPGGGSGQGRTDFLTDKTDFGASDVQITADEATKTNKDFIQIPVTLAGVVFTYNVPGVSELNFSPEVVGAIYTGKITKWNDPKIKTDNPNVNLPDLNISFAVRADSSGTSQVFTTYLAAINADLKTLFGASTQPKWEGATTAQGNDGVAGLVKQTPGTLGYNEVAYAIQNNLNFANLKNKAGKFVKPTLENLSAAAEGANLKINLIDQPGDNSYPITTTSYIILSKNYTEKG----KGEAVVAFVWYAL-HKGGTDAKSVNYAPLPASLVSLAEAKLKLVTAEGAPILK 427
239 8.000e-90UniRef50_G0EE68 Phosphate-binding protein n=1 Tax=Pyrolobus fumarii (strain DSM 11204 / 1A) TaxID=694429 RepID=G0EE68_PYRF1  ali  29  36.....ITGTSSPATATPSVSVQGVKLYGSGATFPAAQYDVWFSEFQKETGIVVEYRAVGSGKGVQDFMEGLVDFAGSDPPLSRGIWQKAYGGVLQAPTVAGIIVVVYNLPGNGRLNLTGDVLARIYMGEIKYWDDPAIKALNPGAELPHEPITPVYRSDSSGTTQYFTYYLAKSCPRWAEKYGYGKVWKVGVGIGARGNQGVASTVKNTPYSIGYVEYAYALQYGLQVAALAPPGRDDITPSAEAVEKTLSKLADELPAPDASETGGYPLVAYTHIIVRKHYD----DPAKCQAIKMLLEWLYNANVEKKDIVEGYAPLPEPMAKKLLEA-ASMVCSG..... 383
240 2.000e-89UniRef50_UPI0009E9963D phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Terracidiphilus gabretensis TaxID=1577687 RepID=UPI0009E9963D  ali  34  18.......SGSLRADLPAAGATKHVALRAAGATLPQVIYLKWF----KSAGMAVSYYAVGSDGGIEQLAAGKVDFAASDMPVTP-ETASASVAVTNFPTLAGGVVPIYNLAGVGSLRFTPQVLAGIYSGAIHCWNDSRIRAANGGQHLPDAEITVVHRSDGSGTTFVWTSYLSLVSPGWKAGAGSGTHVIWPVGTGAQGSDGIAAMVQKTPNSIGYVELIYAIQHELNYAAVENPAGQFIKADLASITAAAQFASFRFSILNAPGKSAYPISTLTWLLVPSQ----GLDGQKKEAVSSLLRWMLT-AGQKDCGSLGYAPLPREVAVRALREVDGLK........ 342
241 2.000e-89UniRef50_A0A2W6DW61 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6DW61_9PSEU  ali  28  16SLIALSACGSDNGSTTKTTACAKGQIAGAGSTFQQNIEQQWITDYGAQCGAQINYQGTGSGAGIQQFGAGTIDFAGSDVTMKPDEQTKCGSKALHIPVTAGGIAIMYNVKGVSTLNLSAKTLSGIFQGTITKWNDPAIAADNPG-SLPATPIAAYHRSDGSGTTSVFSGFLDANSGGDW-KLGVGKQLNFKGGQAAKGSDGVTAGVKQTDGAITYVEVSFAKANNLPTAKVKGAGSDFVDLTGDNVGKFLA-ASFSVTGTGNDLSGGYPISTVSYVIVCEK----GKNAAKATLVKDYVDYAV-NDGQVAADKLGFAPLPAAIGDKVKATAKTLS........ 360
242 3.000e-89UniRef50_A0A1E7KQ75 Phosphate-binding protein PstS n=6 Tax=Streptomyces TaxID=1883 RepID=A0A1E7KQ75_9ACTN  ali  24  22ALVLTACGSDDNTGNGGAACDGQGNLLASGSSAQKNAMDVWVRNYQAACETQINYKPTGSGAGVQEFLQGKTAFAGTDSALEPGEVKQSKGQGIDLPMVGGPIAVGYNLPGVEDLALDAETLAKIFDSKIKTWDDPAIKKLNPDADLPSTKIQAFHRSDDSGTTDNFTKYLNSAAPDAW-KYEPAKKWAAKGGQSASGSSGVATNVKQNEGAIGYFELSYASGNNIPAVALDTGAGEPVEATTANASKAIAEAEIVGLNYQTKAEGAYPMVLVTYEVVC----DTGNAKETLPATKSFLKYAASEDGQKALAEIDYAPMPDEIISKVRKTIDGL......... 372
243 4.000e-89UniRef50_C1F4B6 Phosphate-binding protein n=1 Tax=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 16  ali  28  16.........TGLTACNSKVSQPPLPVVGAGSMFVFPVMQRWTKDFSQHTNVAMSYASTGDAAGLSLLESGKAAFAAVDEPLPPAELAA--KHLLELPETAGPVCIIYHLPGIQTLRLSGETLASIFLGKTTKWNDPAIQKDNPGLPLPDHAIAVFHRTDGSGSTALLTQYLAAASPAWQQKAGAGSTVSWPAGTGSEGSEDLASEVRDSPYSLGYVELTYAQENYLHTAALENAAGRFITPTGTSATAALDAANVNTAVVNPPAASAYPIVGLNYLILPRD----GATPAKQRALRQFAEFVL-HNGQDISAELHFARLTPSLLQYDEQQLATMTANGHPLKR 352
244 7.000e-89UniRef50_A0A2N7T5P5 Phosphate-binding protein PstS n=23 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2N7T5P5_9ACTN  ali  28  35..........SNSGGDSAYANLSGELKASGASFPDAYYQEVIEAFKGEAGVTVTYNATGSGTGKKQFGEGLVDFAGTDSLVKDTDGVAAGS-FLYVPTVAAPITISYNLQGVDKLQLSPETLAKIFQTDIKTWDDAAIKADNPGVTLPSTPIVVAHRSDGSGTTSNFTKYLDAAAAGTWKLGSGDTVNWPASTQGGEKNTGVAQIVQQTNGAVGYVDLSDAKATGLKFAAIKNKDGQFVEPTIEGTTAGLEGAEIAADLLNAAGATSYPITAPTFIIVKTSY----GDAAKADLVKGFLTYLL-NDGQDLAKEIDFAPLPASLKEKALAQVDKIQ........ 358
245 7.000e-89UniRef50_A0A239P087 Phosphate-binding protein PstS n=1 Tax=Tardiphaga sp. OK246 TaxID=1855307 RepID=A0A239P087_9BRAD  ali  32  5.....IALVPLLLQLLSPGTSPAAEASGAGSTFAAPIIEKWSAAYKAVSGDRVSYQPVGSSIGVDMIKKAAVDFGTTDRPLSPAELKKL--NMLQFPLAIGGVVPVVNVQGIGQMRFTGPVLADIFLGKIRRWDHPGIRSINAELVLPNLPITVVHRLDGSGTTFNWTNYLSKISTDWNTKVGQGNSVDWPLGLGGKGNNGVASLVAMVPGAIGYLEYSYALQDRISFGSVQNGSGHFAMPTVASFRAAAENADWAVILADAPGADAYPIAATTYVLMPRKPAWSKSETS----ALAFLRWALEH-GQAHAEALNYVPLPSKLVKQIEAYLDA.......... 335
246 8.000e-89UniRef50_A0A1F9LGH3 Phosphate-binding protein PstS n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_58_15 TaxID=1797895 RepID=A0A1F9LGH3_9DELT :_  ali  26  32.......GALGEAPPEAATFSTRSKLKGAGATFPHPIYSKWAFHYGRDTGVRLSYNQVGSGAGVLAAATGEVDFGATDIPLTDRQLEQ--DGLVQFPMVIGGVVPVVNLPGVGALVLSPTTLAGIFLGDISRWNSPEIRLENPTIDLPDQEITPIYRADASGSTWIFTSFLSQCCPEWQTRVGAGSNVAWPVGVGARGNQQVARFVGQFEFTIAYVEFAHANLSNLVWVALQ-VGGQTVTPSLLNFEKAAAASTWRTWPPEIADPSVWPIVGASYVLVKRQPT----SAVRMRKLFGFLHWALT-GGAPLARELGYAAVPEEHIATIEQLWDQVRENGRAVW. 367
247 1.000e-88UniRef50_A0A1I4D6N0 Phosphate-binding protein PstS n=2 Tax=Methylocapsa TaxID=184923 RepID=A0A1I4D6N0_9RHIZ  ali  28  17.....TALIALSLSQFGAVAEESLSIHGAGSTFSAPLYKKWIEVFQRHDQVSLSYDVVGSGEGVARFVHGSVDFGATDVLPGEATFDGVERGVIAVPVTAGMIVLAYNLPGTGALKLSREAYSAIFTGAIRKWDDPRILETNTDLDLPDTDIAVVVRQDSSGTTAAFTSHLVAIGSSWQAAAGEGFSIEWPAAAMQKGNEGVASKIKISEGSIGFVEYGFAKRLGLKMAILENAAGEYVTPNEAAGMAALLASR-SGSTANPPGDASYPIVTMSWLLLYKKYD----SPRKASALKDWIRWGLT-KGQTFAADLGYIPLPPETAGLAQRALDSLS........ 344
248 1.000e-88UniRef50_A0A1J5QDJ7 Phosphate-binding protein PstS 3 n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5QDJ7_9ZZZZ  ali  27  17ALSLAACGTNNNSTTGGAADCATGSLTASGSTAQSNAMSQWVKAYQQNSGSTINYQGGGSGKGVTDFTAGTTDFAGSDFPLSATEMTAAGNQAIDLPMVPGPIAVGYNLPGVTALNLSADTIAKIFSGTIKTWDDAAIKADNPGVTLPSLGIQTFHRSDGSGTTFNFTRYLENDAPTAW-TYKHDKTWTAPGGQGSKGTAGIAQGVKSTPGGIGYMELSFATQSSIPYAKVGNAQGKFVALTTANVVNFLSKATITGTDYTNPDTNAYPAVLVTYEIVCQAGNKS----TALPLIKSFMNYLAGS-GQALLEPNDYVALPDNIKAKVQSAIAAL......... 374
249 1.000e-88UniRef50_A0A240TVK1 Phosphate-binding protein PstS n=5 Tax=Comamonadaceae TaxID=80864 RepID=A0A240TVK1_9BURK  ali  28  4....IVFALVFVFSTFGPVGAMAQSITGAGSSAAAPIYRSWAKAYARATGATVEYDPVGSSGGIKKIRQNEVGFGASDVAPSSKDLT--EGGLVNFPVAITGISPVFNVASDGQLRLSGELLSRIYMGEIIRWNAPEITALNPGVALPDEAIKVIVRSDGSGTTYNFTDYLSKVSSKWKTTYGAKTSIKWADGIGAKGSDGVAKALKDTPGSIAYIDHGYVKEYGLASAQMKNADGEFVRPSVSAFRAALVNSEWATSLTQKPGKGAWPITMGTFVVVPK----VANNPEQTLAALKFFAWAFLN-GDTLVQENNFVRLPDRVQAAAFKIITSVK........ 336
250 2.000e-88UniRef50_UPI000BA97C7C phosphate ABC transporter substrate-binding protein PstS n=3 Tax=Paraferrimonas TaxID=375673 RepID=UPI000BA97C7C  ali  27  8SAILLVSCLLV----SCSKSEAPQRVVGAGSSMPNPIIQTWIKEFNRHPDVSLEYQSVGSGEGIRRFLAGEVDFASSSAALTDQEIAQVERGADLIPISAGLIVLAYHLPGFGDIKLPRSVYPEVFLGKPVKWNDPRIQAVNPELDLPNADIQPVVRRGTSGTTYAFTNHLSAISQQWRSGLGVARLIDWPNAMAVHYNPGSAQRVKVSENALGYMEYSIARYANLNVAALENQAGEYVLPSRASGEASLASTPMRIFIADPTGSDNYPIIAFSWLLTYHQY----HDPVKLDAISDLIHWGLG-EGQQQAEQIGFIPLPKPMIKKSKQVLDKL......... 341
251 2.000e-88UniRef50_A0A1Q7LNV4 Phosphate-binding protein n=3 Tax=Archaea TaxID=2157 RepID=A0A1Q7LNV4_9CREN  ali  33  44..................PSQSTIILNGAGATFPYPFLSAASINYSRNPSVQVNYQSIGSGGGVKALITKTVDFAASDRPLTDDQRNSTNANSLHIPETVGSVVFAYNLPKTPNLNLTGDIIAGIFLGSITNWSNATIQNINPGFALPNHVISVVHRSDGSGTTFVWTSYLSSVSTVWNQTIGSNTAVSWPNSYGSSGNEGVAGAIRGNSHWAGYVELAYALQNSMSYSYIKNPYGKYIEPTLASTKAALDQSWKSITLLNSPDQAAYPIASLTYLLVYKELNVVGMTQAKAKALADFLWFIVSPGGQDLAPALGYVPLPSSVTTINETTIKSITFNGTIV.. 389
252 2.000e-88UniRef50_A0A2W4U3E3 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2W4U3E3_9PR  ali  31  27......TATSTVKAGGADGGADTADITGAGATFPAPLYGKWGSAYAAATGASLNYQAIGSGGGQTQIKARTVDFGATDDPMKPEDVAANG--LVQFPAVIGSEVMIVNIPGVADLRLTPALIADIYMGKISRWNDPAIAAVNPGLQLRPIPVAPVYRSDSSGTTAIFTNYMKKTAPNW--TLGAGKALSWPAGQGGKGNDGVAANVKNTVGGIGYVEYNYAAANKLTMTQLANADGAYVQASPATFAAAAAQANGVADMLALPGPNTWPIVSATYILVPAKPA----DLAKTRAALAFFDWAF-NKGDDVASQLGYIPLPDVAVAQARASWTGIQ........ 354
253 3.000e-88UniRef50_A0A1Q8C5S4 Phosphate-binding protein PstS n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q8C5S4_9PSEU  ali  28  11SAAVLAGCGAAPAPVGGGADSASGSVTAEGSTAQANAINTWITTFQAAPDATVEYRSSGSGAGLRAFIAGTSDFAGSDAELAAADQRCATGPAIHLPMVVGPIALAYTVAGVEDLRLSPPTIAGIFSGRVTRWNDPAIAGDNPDAALPPTAIRTIHRADGSGTTDSFTRYLTATAAGDWP-FGSGTAWPAPGGTAEKGNGGVAAAVAETNGSIGYLEGSYAQALNLRTARIGNQAGEFVELSAEAGALAVADADVAGTGNDSEAAGVYPIVLVTYEVVCERGTRS----ESLDLVKAFLRYAAGEDGQRAASRLGYSPLPERIRTRVVAAVDAL......... 357
254 3.000e-88UniRef50_U3TDR7 Phosphate-binding protein n=3 Tax=TACK group TaxID=1783275 RepID=U3TDR7_9CREN  ali  30  42.....................SKVVLQGEGSTFIYPQIQAWSEEIRKYPWMTINYNPTGSGAGQSAFIKGVVDFAGSDTPLPLEVWASLEGNVIQMPVIIGMLAIVYNIPGLEDLKLNAEVIALIYKGEIEFWDDPRIASLNPGASLPHEKIVAVHRSDSSGTTHVFTIFLHKAAPNVWTADLVGKAINWPVGVGGKGNQGVMEVVKNTPYSIGYVEYAYVAKAGVQVAMIENREGVFLKPTPEGASPDADWSEGFDSIIYAPGENSYPITSWSFLLFYKQYD----DKEKAEAIKKLIEWI-NTEGQEKVVE-GYIPIPNEIRQINMKAVDMIYYRG..... 373
255 4.000e-88UniRef50_E3SKK5 Phosphate transporter subunit n=5 Tax=unclassified Myoviridae TaxID=196896 RepID=E3SKK5_9CAUD  ali  29  15.........LMVACGSTEKANEPFRLNGAGASFPAMLYSNWFTSFSKDTGNKVNYQAVGSGAGVRQFKAKTVDFGASDGAVKDS--KQPAEGMVHIPMTGGAIVPAYNNPGCD-LKMTQTELADVFLGKIDQWSHFGCEG---------GVIKTVHRSDGSGTTKGFTNSLSAFSPEWKKTVGTGKSVQWPVGVGGKGNSGVAAGIKLTPGSIGYVNYGYVQNDALEQPALQNKAGNFVKANAETSAAGLGDDQLRGADANPAGANAYPIVSLTWILAYPEY-------EKNEAVKEVLRYALTPTQQGKADSLGYVPLPESLRQKALAAVESLK........ 326
256 4.000e-88UniRef50_A0A1Z2L2R7 Phosphate-binding protein PstS n=40 Tax=Actinobacteria TaxID=201174 RepID=A0A1Z2L2R7_9ACTN  ali  25  22ALVLTACGSDDNSAAGNIKCEGKGQLLASGSSAQKNAMDLWVKNFMAACDIQINYKPTGSGAGIQEFLQGKTAFAGSDSALKPEEVTKSGGQGINLPLVGGPIAVGYKVPGVKDLVLDADTLAKIFDNKIDKWNDPAIAKLNKDAKLPDLKIQAFHRSDESGTTDNFTKYLKAAADKSWP-YEPAKAWKPKGGQSADGSAGVSSQVKQTDGAISYFELSYATANKIDTVKLNTGASAPVEATSDNASKAIAEAKITGTGKDTKAEGAYPITLVTYEVV----GDKGNKAETLPATKSFLTYIASEDGQSVLKDLGYAPLPAEIATKVREAVASL......... 375
257 5.000e-88UniRef50_A0A0Q6WAF2 Phosphate-binding protein PstS n=6 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q6WAF2_9BURK  ali  30  28.......................QPVQGQGATFPSKVYETWARAFEKAGGGAVAYKGTGSGDGIKQIGARKVDFGGTDAPLPPSELAK--QKLVQIPMLIGGVVPVVHLPLAAPLQLDGEVLADIFQGRIKVWNDARIAALNPGVGLPGLAIKRVVRAEKSGTTEGFSRYLAGASAAFKTDVGIGQLPAWPDPLKAEGNDGMVQTLRATPGAIAYVSYDRVLRDKLAAVKLRNAAGRFVLPTEQGFRAAVLESDMLATLLDRPGNDAWPITLTSFVLLDAEPA----TAARTQGALKFLYWCFMH-GDDLTRGTGFAPLPISVQSRLAARFTQVRPDGQPAYQ 349
258 6.000e-88UniRef50_Q82G26 Phosphate-binding protein PstS n=143 Tax=Actinobacteria TaxID=201174 RepID=Q82G26_STRAW  ali  27  16ALALTACGATTSSNSAIKCDNAKGQLQASGSSAQKNAIDAWVKAYTASCGVQINYNPTGSGAGVTAFTQGQTAFAGSDSPLKPEEKACGGSQAIDLPMVGGPIAIGFHLSGVDSLTLDAATLAKIFDGKITKWDDEAIAKLNPSAKLPSTKIQAFHRSDESGTTDNFTKYLKAVAPSDW-KYSGGKAWQAKGGQSAQGSSGLAQQVKQTEGAISYFELSYAAD-GISTVDLKTGAATPVKASVENATKAISTAKVAGTGKDPTEEGAYPLTLVTYEIVCEKGNK----ADTLPATKSFLTYIASEDGQKLLTDAKYAPIPDEIISKVRTTISSLS........ 368
259 1.000e-87UniRef50_H5UN36 Phosphate-binding protein PstS n=39 Tax=Actinobacteria TaxID=201174 RepID=H5UN36_9MICO  ali  31  39........STASSSQAGGDCPQGASLSAQGSSAQKNAIEEAISSYQEKCDAKIDYNPTGSGAGIKALIAGQADWAGSDSALKTEEKEACGSDAWNIPMVTGPIAIAYNLEGVDKLVLTPKVVSDIFTGKITTWNDPAIAAVNSGVTLPDTAIKPFFRSDESGTTENFTKYLKAASDGAWTAEPAK--QWTGKGEGKTKSDGVAQAVKGTPGGITYVEWSYAKDNELGMAQMDNGAG-PVELTGESVGKAVEAAEQDGEGNDTKEAGAYPILLVTYEVVCSK----NKDAAKGAQIKSFLEHFASTETQQSLQEVGYAPLPESVRSKVDTAIDALQ........ 377
260 1.000e-87UniRef50_A0A268U361 Phosphate-binding protein PstS n=6 Tax=Helicobacter TaxID=209 RepID=A0A268U361_9HELI  ali  32  26....................ANARDLQGAGASFPADVYYAWVANYRKIEHKNVNYQSIGSGGGIRQVKAHVIDFGASDEALSSANLAKA--NLYQFPTVIGAIVVAYNLEGDGELKLSNEIVSDIFLKKITKWDDPRILALNPSLKLPDAKIFVVHRSDGSGTTYNFSRWLGDISKEWKDVVGVGKSLPWPTGVGAKGNEGVSQILKQTKNTIGYVELSYKVALNLSAARLQDGNKDYVYPDAKSIALAASGADFQTSLIAIKKDGAYPITSSTFILLPKH-------SKRSPKVKEFFKFSFEHSA-ALTSDMGFLVIPKSVQDKVMDYLK........... 336
261 2.000e-87UniRef50_A0A1V0AAG8 Phosphate-binding protein PstS n=5 Tax=Streptosporangiales TaxID=85012 RepID=A0A1V0AAG8_9ACTN  ali  24  31..................APPVTDTAHGSGSTAQKGAMDAWRAEFERHPGLRVSYEANGSGAGIADFITGRSAFAGSDVPMNAQEQARCGGRAVHLPMVIGPVALAYNVPSVPDLKLSPATLTGIFSGRITHWDDPRIAADNHGSRLPHTEIRAFHRADDSGTTHNFLSYLRTT--GHWPHEPSRKWN--GAGEGVTGSSGMTQAVEHSQDSIGYVEYGFASSARLKVAKLRNASGHFAALNPMNASEALQGARSAGRTNDTKKPGAYPLVLVTYEIICSHGTDPP--------ALAFLGYAASDAGQSYLSLYGYAPLPDSLLAQVRTRLGTTT........ 348
262 2.000e-87UniRef50_A0A142XJM3 Phosphate-binding protein n=3 Tax=Gemmataceae TaxID=1914233 RepID=A0A142XJM3_9BACT  ali  31  8.AVLVFALPFFSGCGGCGGGQPAQRVSGGGATFVNPIMQKWSGEYKTAKNVEIDYVSKGSGYGVEQMTAKTKDFGCSDAPLTKEQLATAGGDVVHIPLTMGAVAVVYNVPEIKELKLTGDVLADIYDPSVQKWNAKRIADLNPGLSLPDKDIVVVARAEKSGTSNIFSEYLSKTSGG--KIKASTKPDWVQGVVGQEGNDGVAGFVKGNAGTIGYVELLFARKNELPTAKLKNKAGEWVGAEADGVTAAAAEADLTYSLTDTAGAKSYPISGISYAILFAKLP-----KDTGPTIVDFLKWA-TTDGQKFAKDMDYAPLPEELSKKIQEKLGQVTF....... 354
263 2.000e-87UniRef50_A0A0K2AUD3 Phosphate-binding protein PstS n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A0K2AUD3_STRAM  ali  25  21ALALTACGSDDTSGGDGGASAAKGQLQASGSSAQKNAIDAWVKAYTTACDVQVNYRPDGSGAGITAFNQGQTAFAGSDSALKPEEVEASKGQGINLPMVGGPIAVGFNVPGVDTLVLDASTLAKIFDSQITNWNDEAIAKLNPDAKLPDLKIQAFHRSDESGTTDNFTKYLKAAAPKDW-KYEPAKAWAAKGGQSAPQSSGVAQQVKQTSGAISYFELSYAKD-GIKTVDIKTEAAEPVKATVENATAAIGAAKVVGTDYTPSADGAYPMVLVTYEIACDKGNK----ADTLPATKSFLNYMASEDGQGLLADAGYAPMPTEIITKVRETISGLS........ 373
264 2.000e-87UniRef50_A0A1D7U5C0 Phosphate-binding protein PstS n=7 Tax=Rhizobiales TaxID=356 RepID=A0A1D7U5C0_9BRAD  ali  30  3..LLATVVLAGALVASSVSPGRAEPLTGAGSTFAFPIIGKWAQNYRIAKDIGVDYEPVGSLGGEVRVTQRATDFGTSDRPLSPEELTRTA--LIQFPIVMGGIVPVVNIDGVGPIRFTGALLADIYLGKVKRWSDPAIAAVNPGLKLPDAAINVIYRSDGSGTTFNWTDYLAKVSPEWRDRIGANTQVAWPTGAGAERTQGVAGAIARIRNSIGYIELGQVLRASLAYGLVQNKSGNFIKADAASLQAAAASAEWGSTLTDAPGAQAYPIVATTFALVPKPQTP------RTREVLNFFRLSL-DTGGADATALGYVPLPDALVKQVKDYWAA.......... 341
265 4.000e-87UniRef50_K0C3V7 Phosphate-binding protein PstS n=6 Tax=Piscirickettsiaceae TaxID=135616 RepID=K0C3V7_CYCSP  ali  28  7.......VALGLLSLTIGTAAHAAKIEGTGSSFAYPAYTTWSKVYYGETKNQVNYTPTGSGSGIKEVSARHVDFGGSDKPLKSSSLAKAS--LIQFPTAIGAVTFAYNVEGVSGMKLSEAAISGIMLGKITKWNDPIIAADNSGIALPNEDILFVHRSDKSGTTFAFTYYLSKMNQEWRETMGAKKVVSWPNRIAGKGNFGVATAIKNNGFSIGYVDYADAKKNGLDMAIIENREGIFVKPEPATFEAAAVYADLDPYANIAYPPKGYPVVTATFALVPQN-------GENAKEVIKFFDYALTKKN-KLIESVGYVSLPDAVIKKIQGYW............ 326
266 5.000e-87UniRef50_A0A0D6P6N9 Phosphate-binding protein PstS n=1 Tax=Acidisphaera rubrifaciens HS-AP3 TaxID=1231350 RepID=A0A0D6P6N9_9PROT  ali  34  24..................PSAGVRPITGAGSTFAAPLYREWAAAAKPAIHLDLDYQAVGSGAGQRRILARAVDFGATDAPMSPARLAS--GDLLQFPTALGALVIVVNLPGVGALRLSGAVLADIFAGTIGRWDDPRIAALNPGLALPGLPVAPVHRDDGAGATYLFTAYLSAVSARWKSDIGANTSVAWPAGAGARGNDGVAAAVRGTPGAIGYVGSPYAARAHLATVRLRNHDGRYVPPDTTTGADWAHAVDYAVDLIDQPGPRAWPIVAATFV----ELPRDRRDRARASAVVAFFDWAIKN-GDDIAERLDYIPLPAAVKARVRRDWAA.......... 339
267 7.000e-87UniRef50_A0A0E9M7U1 Phosphate-binding protein PstS n=3 Tax=Ferriphaselus TaxID=1443590 RepID=A0A0E9M7U1_9PROT  ali  27  4......SILLGLLAFAVGGQAMAADIHGAGSSFAAPLYEAWI--FGSHNTERIDYKAVGSGEGIKQVTAKTVDFGASDAPLTAAELES--KGLLQFPSAAAALVPVVNIPGIGQLKLSGEVLAGIYSGAITKWSDSRIADLNPLLKLPSKSIIVLHREDESGSTYVFTNYLSKISADWKSSVGQGLTVKWPTGVAVKGGKALAEAVKSKEGAIGYIEYSSSVNSHLVYASLKNAEGQFVKPLPENIEAALVSAQWNASATNAPGSKSWPLTTATFVLVPK----VVKSAGNTQQVLRMMDWGF-RYGHVTGGGLGFVAVPKTVVEQVHTNWQSLDALGLPVY. 340
268 1.000e-86UniRef50_A0A1A9MXA8 Phosphate-binding protein PstS n=2 Tax=Paraburkholderia ginsengiterrae TaxID=1462993 RepID=A0A1A9MXA8_9BURK  ali  28  6..AIATACLGASHALAAQTVQAVGGITGAGSSFFDPLAQKWAASYYGKTHQQVSFHPVGSGNGIDQLKAATVTFSASDMPLKPDELRT--SGLIQFPVAAGGLVPVVHLDGIGQLHLTGPLLADIYLGKITDWNDPAIKAINPGLALPDLKIVVVHRGDRSGSTFNWTNYLSAVSPQWREQVGSGLTVKWPVGFSATNSQLVATYVKRIAGAIGYVELAYTGLAPLAYASVQNKSGAFVEPSAASFKAAVETVDWYQLVTDPPGDRAWPIPGVVFILMKAENNVGSS------VALAFFRWAL-NEGREEAAVENYGTPPPELVGKIEAYWAQ.......... 335
269 1.000e-86UniRef50_A0A1J5SV48 Phosphate-binding protein PstS n=3 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5SV48_9ZZZZ  ali  28  30...AWISLSTIFLLALMLNQAQAGVIFGVGATFPKQVYQEWGKQYKAETGSSLAYFAQGSGKGIEAISSGKADFGASDKPLTPEELER--DRLIQFPVLIGGIVPVVNIKGDGQLQLDGTTLADIYLGKIRHWNDPAIVALNPGLVLPDDAINVLYRSDKSGSTFVLTDYLSKVSGEWKAALGAATAVAWKVGEGAEGGDNLAKKIGNTPNSIGYLDPAVVQQRHLAIVKMRNRDGKYVSPNQASFAAAAKSAEWNPSLTDQTGSESWPLATATYIVISRSPAE----AAGTEEALKYFDWTF-RKGNVIAQNLGFVLIPAETMQSVRDFWKAQIRDGRPLWK 372
270 1.000e-86UniRef50_B1XVD7 Phosphate ABC transporter, periplasmic phosphate-binding protein n=3 Tax=Proteobacteria TaxID=1224 RepID=B1XVD7_POLNS  ali  31  7..........................TGAGATFPYPVYAKWAEAYKAKTSSNLNYQSIGSSGGIKQIKAKIVDFGATDNPVKFDDLEK--DGLVQFPAIIGGVVPVINVDGVKPIKLDGPTLADIFQGVISDWGDKRIAIMNPGVKIPSGPITVVVRADGSGTTAIFTDYLAKTSSIFKDAVGSGASVKWPAAVGGKGNEGVAANVSRVKNSVGYVEYAYAKKNKMTFISLKNKDGQFVAPDDLTFAAAAAGTDWAKIITNASGAKSWPITGASFILMHKDP----ESKSNAAEVLKVFDFAFKDS-KKMAEDLDYVPMPDSTTDYIRKNWSKIKVK...... 321
271 2.000e-86UniRef50_A0A132HEK5 Phosphate-binding protein PstS n=6 Tax=Burkholderiaceae TaxID=119060 RepID=A0A132HEK5_9BURK  ali  32  5......TALAILGSALIMSTAVAADIQGAGSTAAAPVYRVWSTGYAAATGTRLNYAAVGSGEGIRRIREGQVDFGASDVPLSPQE--ASKSGLVCVPTVVTAAVPVINLPSVPQLKLTGDLLAKIFLGKVDSWDAPEIRAVNPGLALPNLKIHPVVRADGSGTTYHFSAYLSEVSAEWKSTYGTKSAFSWPAGTGAKGSGEVVKAVQSNRGAIGYVDYNYVLDEGLNPVQLRNADGNFVSATVGGFRDAVVHSNWTASLVNQAGADAWPITMGTFVVVP----AVSRAGERTLEAMKFVTWGYLH-GDQLAREAKFVPLPGQVQANAYRELARVTASGKAI.. 342
272 2.000e-86UniRef50_A0A094RZI3 Phosphate-binding protein PstS n=1 Tax=actinobacterium acAMD-2 TaxID=1504318 RepID=A0A094RZI3_9ACTN  ali  28  20ALTLSACGGSSNTASSDSTDCSTGTIKASGSTAQKNAIAEWVNAYQSAPGATVNYQAVGSSAGVTDFINKQTAFAGSDSVLKPEDQIKADSEAIHIPMVGGAITLAYNVAGVDSLTLTPDVIAGIFNNSITKWNDPKIKAINEGVTLPNATIAQFHRSDGSGTTDNFTKYLTAAAPKVW-KLSNAKEWKAEGGQGAKGNDGVAAAIKSTDNAIGYVELSFAQDAELKVAKVDNGGG-AVEPNADTAAAAIGKAVGEIVDNENNDANTYPIVLLTYEITCQK----GLTGTDLALTKSFLTYSASDAAQAQLVEIGYVPITGDLLTSVRKSVSSI......... 364
273 3.000e-86UniRef50_M5UJ25 Phosphate-binding protein n=3 Tax=Planctomycetaceae TaxID=126 RepID=M5UJ25_9PLAN  ali  27  3....LAVCSLVILGGMTGCDEPSVTIRGAGSTFAAPIIKQWAEAYRSHPDVVIKYEATGSGDGEKRFRDFDVDFAGTDAGLNQDELSAIEGGALQVPMTAGIIVLAYNREGLPDLKLPREVYVDAFLGKETRWDDARIIEANPGKTLPSEPINIVTRLDSSGTTFAFTNHLAAISDEWADRFGSNNADWPGKAMKAAGNSGVAGRIKQTLYSLGYVQYGAARAVDLAMASIENRAGNYISPSGASGLEALMNVELQENVVDPSGERSYPIITYTWMLVRKSYPG----ATKTDEVKSFAKWCLS-QGQAFAEEAGNVRLAPKVIEKSEATLDAMQFAGDAA.. 356
274 4.000e-86UniRef50_A0A2R7Y590 Phosphate-binding protein n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y590_9ARCH  ali  30  47.......................EKLLGGGATFVNPLMQKWAYEFKQERGLGVDYQSIGSGQGIAKLKEQAVDFATSDSPLKRSDWENIRGGVIQIPITVGSVVAVFNVPGVEELRLPQEAVLKIFDGSIKKWNDPRLVELNPQLRSVDMNIIVVYRADRSGTTSIWTDFLEKVSGGKFPRDFSFKLPEEESFIGAKGNEGVTEAVRKTQYSIGYVELSYAVLSGLSHAAIQNKAGNFVKASAESVADAVDWSEVSLIKLEPPDPNAYPVVSFSYVLLYVENP-----PERAAALREFLTWIY-QEGQKQVADVGYVPLPENALQIGLMGVSYIKA....... 376
275 5.000e-86UniRef50_A0A128A1Q9 Phosphate-binding protein n=2 Tax=Candidatus Nitrosotalea TaxID=1078904 RepID=A0A128A1Q9_9ARCH  ali  29  26.........ADSAPPTAPSDTDKYNFNAGGSTFAFPIVDKWRVEYNKLPGITLNYQAVGSGAGIKLFTTKKVEFAGTDAPLQSADIAKAPKGILTIPESMGAIVVTYNLPGVQQLKLTGDVIAKIFSGQIIYWHDQSIVKLQTDPNIAKAKIIVVHRSDGSGTTFAFTGYLSQVSSDWSAKVGHSTSVPWPTGMGGSGNAGVAAIVKKVPESVGYVELAYAKTNKLAYAFVQNHDTAAAAVGAISSLPAADGVWSSVSINNAPGSNSYPIVTFTYLLVNPNLEQKGMDKQKAQDLVHMLYWFVT-DGQKYATKLLYVPLPSAVQELDKMGISEIKFNGQQLW. 384
276 5.000e-86UniRef50_A0A2H5VF88 Phosphate-binding protein n=1 Tax=archaeon HR06 TaxID=2035442 RepID=A0A2H5VF88_9ARCH  ali  26  46........................KLLGGGSTFVNPLMQRWAYEFKRQKGFGVDYQSIGSGQGIAKLKDQAVDFAASDGPLRKEDWENLKGGVIHIPITIGAVVLAFNLP-IKELKLSQELVLKIFDGRIKRWNDKEIVNLNPELKDRNDDILVAYRADRSGTTFVWTDFLGQISKNEFPTDFSFKVPERERFIGARGNEGVTEAIKSTENCIGYVELSYAEFNKLYHAHIQNKRGNFVKASLESISEAIDWSKVSLIRMEPPSEKAYPVVSFVYILTYRE-----HSTEKALALKEFFSWVL-KDGQKYASELGYIPLPPRAIEFSLKAISYIRT....... 373
277 6.000e-86UniRef50_Q58421 Phosphate-binding protein PstS n=39 Tax=Euryarchaeota TaxID=28890 RepID=PSTS_METJA  ali  29  37........GGGNSQPSNNEKPSTIIIRTTGATFPKYQIQKWIEDYQKHPNVKIEYEGGGSGYGQEAFAKGLTDIGRTDPPVKESMWKKFGDQPLQFPEIVGAVVVTYNIPGDKTLKLSRDVLADIFLGKIEYWDDERIKKINPEIKLPHEKIIVVHRSDASGTTAIFTTYLSLISKEWAEKVGAGKTVNWPTGVAGKGNPGVVAIVKSTPYTVAYTELSYAIEQKLPVAALENKNGKFVKPTDETIKAAVSAVKASIPMLDAPGDNAYPIVAFTHLLVWENKNGKHYSPEKAKAIKDFLTWVLT-EGQKLAP--GYVGLPEDVAKIGLNAVNMIK........ 388
278 7.000e-86UniRef50_A0A292YF10 Phosphate-binding protein PstS n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A292YF10_9PROT  ali  24  5..........LAFGALISVSTFAWTINGTGSSFQYPVNKTWIKGFYSETGNRVNYTATGSGTGIKEIIARHVDFGGTDKPLSPKELRKNH--LAQFPIIIGGITLAYNIPGVHKLKLSEVAIEGIALGTIQYWDNPVIVKYNPNEKLPHKKIIFVHRSDKSGTTFNFTYYLAKMSTVWRHHYGVKKALNWPTGVAGKGNAGVSAAIKTNAYSIGYVDYADAVTNGLNLAVVQGRDGAFYEPNPANFAKGAASAKNDFFKLIAYPKKGYPILAPSFDLVHT-------DDRNAKKVTAFFNYAFDHD--EMASKLGYIPLPSNVKAMVRKYWEE.......... 325
279 9.000e-86UniRef50_A0A2G2MSS4 Phosphate-binding protein PstS n=4 Tax=root TaxID=1 RepID=A0A2G2MSS4_9PROT  ali  26  2..TLRTILTATVAASVAFTAVNAADLKGRGASFPGPVYKAWTSEYFAATGHKVNYTPTGSGDGIKSIKKRMVDFAGSDKPLKADKLVKA--KLYMFPSVIGSIVLSYNIEGVKDLKLSRAAVDAIFTGKATHWDDALITKNNAGLKLPHEPITTVVRADKSGTTFNFTYFLNKINPDFK--VSKKPTWKASKVIAGKSNSGVSANIQQIKNSIGYIEYSYKIKLGLPAAQIENKEGLFINPTVASFQDAAKYATWTADIGDPAGATSYPIVAATFILLPTEKT------EMNKKVTAFIDWAYTH-GDKAATELGYVPLPASTKDEIRKYWEAKK........ 331
280 1.000e-85UniRef50_A0A254N617 Phosphate-binding protein PstS n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A254N617_9BURK  ali  28  23...................GATAQTVQGQGATFPSKVYETWAKAFAKAGGVAVLYKGTGSGDGIKQITARKVDFGGTDSPLPPAELAK--QHLVQIPMLVGGVVPVVNLPGLGAVQLDGPALADIFLGRIKFWNDGRIAALNPGLSLPAQPIKRIVRAEKSGTSDGFSRYLSGVSPAFKAEVGASQAPAWPGPLKAEGNDGMVQTLRATSGGIAYVSYDRVLRDKLAAVKLRNAAGRFVLPSERGFAVAVLESDMLATLLDRPGPEAWPITLTSFVLVDAEPAQ----GAQVQGALKFLYWCFMH-GDDLTRGTGFAPLPVSVQSRLAGRFTQVKPDGAPVYQ 349
281 1.000e-85UniRef50_B8D3C6 Phosphate-binding protein n=4 Tax=Desulfurococcus TaxID=2273 RepID=B8D3C6_DESA1  ali  31  42.........................INGAGSTLIAPQILEWSKEFTEKTGIVIEYSPTGSGAGRAMFFNKTVVFAVSDPPLDRETYLEYRGRVLQLPIVLSAIVITYNIPGIPQLNLTGRILALIYKGEITRWNDERIKEVNPAIALPNKEIVVVHRSDSSGTTRVFAAYLNKAAPDIWGNELVGFSIEWPVGLGGKGNEGVANLVTSTPYSIGYIEASYALYVGMPVARLENKEGYFVTASRENVLSAVDFSMVLDALLNTPGPDSYPIVSFSYMFIYSDY----KDVYVTEALSRLIEYIL-IEGQDRLLP-GYYQLPDEVIEIGLKALEIISYNG..... 374
282 1.000e-85UniRef50_UPI000DDA2969 phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DDA2969  ali  30  32..LLSGVIAATLVAALLGSAAQAEPIRGAGSTLAAPVIAKWASAYKDARDWTVDYEPIGSLAGLMRLKQPELDFAATDVPVPPADLARNGQK--QFPIVMGGIAVVTNLDGLPDLRLSGPVLADIYLGAIKTWSDPAIQTLNPGVALPDLAISVFHRQDGSGSTHVFTEFLSASSEPWKTRFGADTLIEWPLGAGAKGTQALIRAVAETKGAIAYAEYGQALRAGLPVAAVRNRSGNFIKPGPEGVQAAAAGPDFFASLTDRDGDAAYPISTAVFAVV----QVSGRSERRYRRVHDLFRLAFAERGASDAAALGYVPLPDALVDQVEQYWA........... 370
283 1.000e-85UniRef50_W9GZ28 Phosphate-binding protein PstS n=2 Tax=Skermanella TaxID=204447 RepID=W9GZ28_9PROT  ali  29  2..........................SGAGSTFAFPLLSQWGAKFQAESGMDIDYEPVGSLGGIMRVIAGAVDFGASERPLPAEEVDRH--KLMQFPIVTGGVAVVFNLPGVGALRLSGAVLADIYLGKVTSWSDPALKALNPDVTLPDAPIDVVHRGDGSGTTYNFAAYLADASGDWRERVGVDTELKWPVGRGVKGSGGIVRSVAADRNSIGYVEVGQARRDGLPAALVENRAGEFRAPSPDSIAAAAAGADWAGSLTGATDPRAYPIAATVHVLMPRE------TGPTSARTLRFFDDALTHW-RRDAVDLGYVPLPDEVVGQIRSYWKS.......... 334
284 1.000e-85UniRef50_L8AJ28 Phosphate-binding protein n=100 Tax=Terrabacteria group TaxID=1783272 RepID=L8AJ28_BACIU  ali  27  8..VATFSVVSVIVGFGGIGQAIAGTLNGAGASFPAPLYQRYFAEYKKATGNTVNYNSVGSGAGIRQFIGETVDFGATDAVPTSAQRQQMKRGVVMVPTAGGAVAVVYNLPGKKV-QLSRIALGKIFTGELKTWNQV-------DSKLPNTPIRVVVRADGSGTTDIFTSHLSAISSTFRSKIGASQDPNWGQVLKGPKNDGVAATVKQTPGAIGYVQDTFARRNNLQTAKVQNKAGQYVEPSLAEANKAISGAKFDANFVASDPASGYPIVGLTWLLVYQN----NKNANVAKDVKALVRWILTT-GQNHNTQLEYTKIPPAVAQRVIAAVNKIK........ 333
285 2.000e-85UniRef50_UPI0009DC3EDB phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Conexibacter woesei TaxID=191495 RepID=UPI0009DC3EDB  ali  31  101.ALSVAAVXXXXXXXXXXXXNTNGALTGAGSTLVAPLMANWASDFEARHSISVTYGAVGSGAGITQITNRTVDFGASDAPLTAAQASACN-NCAQIPWGLTATGIAFHLDGVKHLNLTGKILARIYLGQVHNWNDKAIAKVNPGVKLPNLGITPVYRSDGSGDTYAFTDYLSRVNAQFKSQVGNATAVQFPKGVGGRGNDGVTAVVGSTNGTIAYISASYIIAHGLSVAKLQNNAGKFVYPNLKNIAAAASPANNELHIVNPPVPLAYPLSTFTYAIVP-------HNGAKASSVRLFVLYAMGI-GQKFGAALDFAPIPGVVYQAGLKTVNTL......... 431
286 2.000e-85UniRef50_A0A1V6EPC4 Phosphate-binding protein PstS n=1 Tax=Bacteroidetes bacterium ADurb.Bin090 TaxID=1852803 RepID=A0A1V6EPC4_9BACT  ali  50  2.......................................................................VDFAGSDAYLSDEEMAEMKAT-IHVPTCLGAVVLSYNLPDVSSLNLTGDIIAGIYLGKITRWNDAAIQAINPAVSLPDKAITPVYRSDGSGTTFVFSDYMTKINKDWENTLGTGKSLNFAHGIAAKGNPGVAGTISQTEGAIGYIGSEYAFALNSPIAYMQNAAGEFILPSSLSISAAAQADDTRSMITNSSAKGSYPISCLTWIIVYKDQAYANRSEDQARATLSLLNFILSPAAQAQTTMVHYAPLPKEVIDKAQKALSEITYNGKSL.. 273
287 2.000e-85UniRef50_A8AB53 Phosphate-binding protein n=2 Tax=Ignicoccus TaxID=54258 RepID=A8AB53_IGNH4  ali  33  3........TALVASLLLSHAVIAASLYGSGSTFVYPFVSLAAYYYKAAH---VTYQGVGSGAGIANLLNHLTDFAGSDVPIPKERYAPLGKQVVHVPVVAGSVVVIYNVPGNKVLKLDGEVLAEIYMGKIKYWDDPRIKALQVAAKLPHKPIIAVHRSDASGTTAVFTKYLAKSSAEWNAKIGSHLVINWPVGIGAPKNQGVAATVSKTSYSIGYVEYAYAVQAKLPTAALKNAEGNFVLPTPETISAATAGAAKRDSLVLAPGKDSYPIVATPYIIF-------FRDSPKLKQIVDFVKYLLSDELQKASIKMGYAPLSKSFRQQLLAELDQL......... 343
288 2.000e-85UniRef50_A0A149UBA2 Phosphate-binding protein PstS n=14 Tax=Gluconobacter TaxID=441 RepID=A0A149UBA2_GLUOY  ali  28  8....IARGLAVALAIMAFGTAHSAALTGGGSSFAAPLYRAWSAELHRQTGFSLTYRSVGSGEGQRLVMAGAVDFGASDLPLSGDVLD--ERGLYQFPTAIGAIVVVINVPGINQMKLDGPTLAALSDGRITSWADPRIRALNPGLRLPDLDVLPIHREEASGTSQVFSDYLHAVAPDWKAGM-------WGDGSEARGNDGVAASVRQSIGGIGFVEYAFARRDRLNTVRLKNHAGQFVAPGKAAFTGAASSADWAVHFLDAPAPQAWPIMSATFVLVPAHPA----DRTATTAVKTLFRYGL-KQGDDIARDLDYVPLPAPVKDRVLSGW............ 328
289 3.000e-85UniRef50_A0A2P5NRJ8 Phosphate-binding protein PstS n=5 Tax=Rhizobiales TaxID=356 RepID=A0A2P5NRJ8_9RHIZ  ali  27  12........LVLAMAIGGSQAASALELSGAGSTFAAPLARGWIESFEKHPGTKIRYDSVGSGEGVVRFKANEVDFACTDAPMPSLSSERFQSEGPQFPVAVGMISIAYNVPGVDELRLSRQAYANIFLGALHFWDDPQIVAANPHLHLPHLPIRPIARLDSSGTTFAFTSHLAAIDARWSETPGVGKKVAWSVVTLANGNEGVAAAVGSTVGAVGYAEFGVARRAGLRAASIENKQGKFVAPSFESGLAAIKEDRLKAAILDPSYNGAYPVVTFTWLVLHWDYPE-----DRWRALAPFLDFIM-DRGQNIAPVLGYIPLPQSIIYRGKAVVARISSDGGAV.. 349
290 4.000e-85UniRef50_A0A1H7IP37 Phosphate-binding protein PstS n=6 Tax=Nonomuraea TaxID=83681 RepID=A0A1H7IP37_9ACTN  ali  22  25....LTATALLTHEQTPQAPPVTATVSGSGSSAQQGAMDAWRAEFRRHPELRVDYRPTASGAGIAEFVAGGTAFAGSDVVMDPHQQARCRGRAVNLPMVIGPVALAYNLPSVPRLRLSPATLTGIFSGRVTRWDAPQIAAENPGVLLPHRPIRHFHRSDDSGTSHNLTSYLRAAGGW----PYRPSSRWTGSGAGVKGSGGIAAAVAQTEGSIGYMEYGFAGDARLRTASLRNPAGEFVALSPESAGRALDGARVSGYDQRARTRGAYPLVLITYEIFC--------SGRAGAPARAFLDYTASDAGQSYLALCGYAPLPQDLLTRVRARL............ 352
291 5.000e-85UniRef50_A0A2P4RG15 Phosphate-binding protein PstS n=15 Tax=Bacteria TaxID=2 RepID=A0A2P4RG15_RALPI  ali  30  6.......VLALAVAVSGLPVLARAEVRGAGSTAAAPVYRVWSAGYAASSGVTLSYDAVGSGEGLKRIRAGAVDFGASDVPLSSAEAAKAG--LVCVPSVVTGAVPFVNLPGVPQLKLTGELLAQIFLGKVESWDAPELRALNPGVTLPKLKIHPVVRADGSGTTYHFTDYLSAVSADWKSAYGTNSTINWPAGTAAKGSGDVVKAVQATPGAIGYVDYNYILDNDLSGVQLRNVAGRFVSAQVSGFREAVMQSDFTAPLVNLPGAETWPITMGTFIVVP----AVSASGPRTLAALKFLTWGYFH-GDELAARAKFVPLPERVQAIAYRELARVT........ 335
292 5.000e-85UniRef50_A0A177R9I1 Phosphate-binding protein PstS n=5 Tax=Bacteria TaxID=2 RepID=A0A177R9I1_9ACTN  ali  30  35....................PSAGSLTGAGSSFVAPLVSAWIPKVDAAFGVKVTYGPIGSGGGINAITNRTVDFGASDAPLTPDQFAACK-GCAQIPWALSATSLAYRGDGIPDVKLDGSAVAGIFMGRIKKWNDPALKKLNKGKSLPDLDITVIHRSDNSGTTYNLTEYLNSVSRQWKSGVGKGVAVNWPTGVGARGSSGVAATLSQTNGGITYVDVAYALKSHFKVAAVKNRAGVFQLPGLRAIAAAVAPNNGGISIVNPAQPLAYPICTFTYVIVPT-------STPKARELKQFIRWAVT-KGQASGPKLLFSPLPKVVLNASIKTLNSV......... 348
293 5.000e-85UniRef50_I6X2G4 Phosphate-binding protein PstS n=5 Tax=Propionibacteriaceae TaxID=31957 RepID=I6X2G4_PSEPQ  ali  25  8STLLLAGCWSGGVAVHPVATGETGTLRGEGASSQRTAMEKLIQDYTAAPGTVIDYTTSGSGAGVKAFFGGAVDLAGSDSPLSRKERDCRGNTALNLPMVLGPIAVAHNVEGVPDLNLTAELIARIFTGDITRWNDPAIAAANPGVSLPDAGIAVFHRADESGTTENFTKYLAKTAGDTWGHDASKKWP-APRGEGKEKTAGVADAVAGTRNSITYLEWGAALERDLKLARIDGLSGETAGRAVAAAGAETDGDDIRLDIDYTPGGGAYPLVMATYEVVCSTGGSNP------ELLRDFLGLFASETAQASLEELGYAPLPGELRKKVSRSVSGI......... 357
294 5.000e-85UniRef50_A0A0S3UA10 Phosphate-binding protein n=1 Tax=Leptolyngbya sp. NIES-3755 TaxID=1752064 RepID=A0A0S3UA10_9CYAN  ali  32  29......................QIKITGGGSSFQALLYESWFEQYSRNPTVDLSYQVIGSVAGIDRFLNQAIDFAGSDRLINVKERQRSPREVIQIPIVGRMMVLAYNLPGIENLRLSRSSYCAIVTGQIRNWSARRIAQDNPNIRLPNLPITFVFRADGSLTTLVMSQHLEKACPNWSS--GVGLTVRWIRGIGARGGEGTSAAIEQKPGAIGYFDYNIARVFNLPSATLQNQAGQFVAPSVAAAAIALQSVDLSATTIDPPETGAYPIVVPTYFMLYERYD----DPAKAEALKQFVQWAL-QDGRTIAEKLNYVPLPDKVVEQVLKTL............ 335
295 8.000e-85UniRef50_S6A5N5 Phosphate-binding protein n=2 Tax=Thermofilum TaxID=2268 RepID=S6A5N5_9CREN  ali  32  50...................ASQPVLLKGSGATFPEAQLRKWIQVFSTNTDIKIEYSAVGSGQGVSDFINGLTTFGCSDVPLTIEQLNQAKNKYYQVPYLLGGIAVVYNVPELKDLKLTPEVLVDILLGKINYWDDPKIKELNPEVALPHKEIYFIHRSDGSGTTAVFTSYLSFVSSEWKTKVGTGKTVQWPRGQGAQGNTGVASMVQQTPYSMGYVELAYMK--GMGVVALRNNAGKFVQPSPERVSLAVKSLDVDFTIFGTTDPDAYPISSPTYMFLK---SPDNYDLNTRKALARWLQFIAT-DGQKIAE--GYAPIPQSISQKILQ.............. 379
296 9.000e-85UniRef50_A0A1V2MZ00 Phosphate-binding protein PstS n=376 Tax=Actinobacteria TaxID=201174 RepID=A0A1V2MZ00_9ACTN  ali  26  46..........TTAASSIDCGKAKGQLRASGSSAQKNAMDLWVKNYMAASGVEINYNSSSSGEGIVAFNQGTVGFAGSDSALKPEEVAESKGQGINLPMVGGPVAVGYHLEGVDKLTLDAPTLAKIFDTKIKKWNDPAIAALNKGVDLPDKAIQAFHRSEDSGTTQNLGKYLGAAAPKDW-KYEAEKKWPAPGGQAASGSSGIAAQVKQVDGAIGYFELSYAKSQSISTVAIDTGGSAPADATSENASKAIAAAKVVGTDYTTKAEGAYPLVLVTYEVVC----DTGNKAETLDTVKSFLSYAASEDGQKILTEAGYAPIPAEINAKVRETVNGLS........ 379
297 1.000e-84UniRef50_A0A1M3B9J2 Phosphate ABC transporter substrate-binding protein PstS (Fragment) n=1 Tax=Solirubrobacterales bacterium 70-9 TaxID=1895833 RepI  ali  36  1.................................................................................TDEEVEAAEKNGVHVPIELGAVTVSYNLPGVETLKLEGATVAEIFLGNITKWNDPAIAKLNPEVELPETAITVYHRSDSSGTTALFTEFLADYSPEWKSKLGNGDTIKWPVGTGANGNEGVAGGVSQTEGAIGYVELAYALQNQFTFADVQNKAGEFIEPSLESTSAAGEDVKFPPDLRASSSAKAYPIASTTFVLVYEDLCKAGKSEETAKNVVGFLDYALSPEGQGAGEELDYAPLATELREASQAKVDGLKCNGKPIK. 269
298 2.000e-84UniRef50_A0A1G0VMS9 Phosphate ABC transporter substrate-binding protein PstS (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A1G0VMS9_9BACT  ali  40  1...MISALFLALSFSSVAHAQL--QLNGAGATFPYVIYSKWFDEYRNLTGVQFNYQSIGSGGGIKQVIEGTVDFGASDGPMTDKQLAKQGTEILHIPTVMGADVVCYNLSGNAVLNLDAETLANIFLGNITKWNDARIRKINPKLNLPNKAIIVAHRSDGSGTTYIFTDYLTKVSKAWESKVGRGTSVNWPVGLGGKGNEGVTGLVKQTEGAIGYVELAYAVKNKIPFATMKNKAGNFVVATFKSVSAA.............................................................................................. 249
299 3.000e-84UniRef50_Q6N3F8 Phosphate-binding protein PstS n=15 Tax=Rhizobiales TaxID=356 RepID=Q6N3F8_RHOPA  ali  27  3..VLRTALMALAIGSSGVTAGHAETVMGTGSAFAAPIYIKWAEQLKATKGVAINYQPSGSSVGQLQVLKGLTDFGASDVPMEDSKLK--EGDIMQFPTVVGGYAVVVNIPGVGKLRLTAPVLADIFMGGIRSWDDQQIVQLNPGLALPNLPISLLYHAGGSGGTYAISRYLSKNSAAWRDKMGIGMTLSWPVGAGVKGSYGSASTVPMTSGGIGYAELSYVTANNLATVQLQNRSGRFVLPNGSSFAAAAENGDWSVDLTDMPGEHAWPIVTATFALVPRGPAKR----ATSAAVLDFFRWAFAH-GDGIARSLQFVPLPGKVKADIVKHL............ 332
300 4.000e-84UniRef50_A0A1I3GV02 Phosphate-binding protein PstS n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1I3GV02_9BURK  ali  25  22.VAAPLCVAALTLMTSSLTHAQDLTLRETGSTLLYPLFTTWVDAYTKHPGVHITVGATGSGNGIEQVLAGKVEIGASDAYMSDVEMRQHPQ-VINVPLAIAAQTVNYNVANATHLKLDGTVLAAIYSGAIRNWDAPQIAALNPGVKLPHQAIVPIHRAEGSGDTFVFTQFLSFATSDWENAHGYGTTIAWPSVPGSAGNDGMVKALQATPGSIGYVGVSFTDKAQLGTAALKNGAGEFVLPSKETITAGAAPADERLSLVFAPAPGTYPLVNYEYAIVSTKQA----DATTAAALRRFLLWSISETNEAYLDTVHFIPLPPHTWELSQAQIQSIK........ 367
301 5.000e-84UniRef50_A0A1Z8W166 Phosphate-binding protein PstS n=8 Tax=root TaxID=1 RepID=A0A1Z8W166_9PROT  ali  31  17.................PSVSSAETLNAAGASFPAPLYQAWFQSYAEKTGNQVNYQAVGSGAGVRQYVAGTTDFGASDKALSDKKIAKGGVPVVQIPMTGGAIAVAYNKPGCD-LRITQTELVRVFYGDIDNWSYFGCAA---------GPISPAVRSDGSGTTAGFTNSLSAFSRKWNLMVGRGKSINWPATLAGKGNSGVAGIIKNTEGALGYVNYGYVVDGSMQVAAVQNRYGNFIQPNGATSAAGLSDSKLRGTDPNPAGATAYPIVSLTWILARPEYSKNND-------VKAALRYMLSSEAQGISDSLGYVPLPEDLRQKSLAAVETL......... 322
302 7.000e-84UniRef50_A0A2W6CI12 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A2W6CI12_9ACTN  ali  31  62....SGLALIVPSHLRPGSTCGIGTISGAGSTFVQTILQEWISGYQRAPRATINYQGAGSGAGIQQLTAQTVGFAASDVVMTPTELQAHGGPVLEIPWAAGGVAVEYHLEGVHHLRLRPRTLAGIFAGTITKWSEPAVQADNPGTALPAEGIQVVHRSDGSGTTAAFTRYLAAAAPSLW-KAGSGKEVAWPTGQGAKGSDQVTAAVEQSEGAIGYAEVAYAKATGLGITQIENPAGHFVGPSANAVSAALSGAGTTQLSPLPGGPAAYPISTLTWVMVYTRQP----DARQAALLSSFLTYALGP-GQVATRPLFYAPLPPS..................... 399
303 9.000e-84UniRef50_A0A1W7CZC7 Phosphate-binding protein PstS n=1 Tax=Streptomyces sp. SCSIO 03032 TaxID=1109743 RepID=A0A1W7CZC7_9ACTN  ali  28  38...................GSLSGRVEGSGATFPGPLFDRWTAHYRVETAARVDYRAVGSGGGIEQFLAGTVDFGSSERPLGPGELDIAADAAVQFPVVFGAVALVLNDDELDGMVLTAEVIAGIYDGRITRYDDPAVAALNPGLDLPAEPIVPVRRGDGSGTTYVFSHYLTTEVPFWAERYAEGTDLDWESTLDGEGNEGVAATVRERPGGLGYVNQSFALADELATARVVNEDGTPVAPTLEATTAASEEAEIPDDFIDDIGGEGYPITGANWIFAYT----CGYDDATAALLRDFWTWTLTDAADRHAAELGYAPMGRELKARVVEEIGRV......... 359
304 9.000e-84UniRef50_A0A2S0N8D6 Phosphate-binding protein PstS n=1 Tax=Phreatobacter sp. S-12 TaxID=1868589 RepID=A0A2S0N8D6_9PROT  ali  32  16................TPAPAAAQTFTGAGSTFAYQLLIRWSQAYQRSQGALFDYEPSGSEAGIQRLQQRAVDFGATEAPLSDEELHRY--NAVQFPVVAGGIAMVTNIDGIGPLRLTSDTIAAIYAGRITRWSDPAIRADNPGLALPDTAIVPVRRADGSGTTAAFTTYLSKVNADWRGTIGSGQTVRWPVGVPARGNLGVATTVRTTPNAIGYVDLATARAMNLPPAAVRNAAGAFVTPDLASLRAAVQVADLRTVLVDPPGAGAYPLVATVFVAVPREAANTGRS----RAMMAFFAWGV-ENGAADAEALGYVALPATAAGVVSDSLRR.......... 339
305 9.000e-84UniRef50_Q7M9G4 PHOSPHATE-BINDING PERIPLASMIC PROTEIN n=1 Tax=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W  ali  30  19....................QAGETLLGSGATFPANAYAEWIKEYEKSTQNRVSYLSIGSGGGIKQIKSGVVDFGASEEPLKESELA---VGFHQFPSLRGSIALVYNLPSDGDLRLTPELISDIYLGLITHWQDPKIRALNPNIPLPNLPITPLHRNDGSGTTLAFTSYMDHQSKTWSESIGKGKALAWPKGMGAKGNAGMSQLVSQKEGSLGYVELSYKLQEKLSAALL------------------PLSSDLKEWLSPVDVEKGYPLITTSYIIFPLK-------SKKAREVVHFFDYSF-KQGDATLRRLGFIPLNKEEKGLIQKRWQEL......... 305
306 1.000e-83UniRef50_A0A235ER51 Phosphate-binding protein PstS n=32 Tax=Burkholderiales TaxID=80840 RepID=A0A235ER51_9BURK  ali  30  6......ALLTLSWALLTAGAAGAQTVTGAGSSAAAPIYRSWAKAYTKATSSGVAYDPVGSSAGMKKIQQQAVGFGATDVHPSDKDL--IEHGLIALPVAITGISPIVNLPKNAQLRLTGEVLSRIFMGEITRWNAPDINALNPDTPLPDLPIKVVVRADGSGTTYNFADYLAKVSAPWKASFGVKTSIKWPDGLAFKGSEGVAKGVRDTVGAIGYVDFGYVAEYGLASVQMRNAEGVFVKPSIDAFKAALANSEWSATLTQKPGKSAWPITMGTFVVFPK----VTSNPEQTTQALKFIIWSFVN-GDTLVSENNFVRLPDRVQATAFKVITSI......... 335
307 1.000e-83UniRef50_A0A2I2IRP5 Phosphate-binding protein PstS n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A2I2IRP5_9ACTO  ali  22  10AVTSLAACGSDNATTSQQSESVSGSLKGAGASSQESAMTTWTQTFMENPDAQITYGAVGSGAGIEQFIGKQVAWAGSDAYLEGDEVKKCGADAFDLPTYISPVAVVFNIKGVKKLNLDPDVVAKIFKGEIKNWNDPAIAKANPDAKLPDLAITPVHRSDKSGTTENFTSYLHEAAGDVWTDEADKTWPIA-GGETGDKTSGLIQAVQSTEGTIGYADFSKAGD-DLGIASLKSGDG-YTAPSQETAAKAADIAEPAKDRADPKEEGAYPLIMISYEIVCSKYE-----KEEGDLVKAFMEYVSSKEGQKAAAEAGSAPISDEMRQKVQKSLDKIKIG...... 363
308 1.000e-83UniRef50_A0A0U3LJU2 Phosphate-binding protein PstS n=7 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A0U3LJU2_9BURK  ali  26  39.....LLLGALMTLTVTLSGSAFAQVKGAGASFPSLVYGRWAVAYEKSSGGQVTYKATGSGDGVKRITAREVQFGGSDSPLSAEELAK--RHLVQIPMLVGGIVPVVQLPSVPELQLSGEVLADLMAGRIRQWNDPRIAALNPGLPLPALAVRRVVRADKSGTSEGFTRYLSEVSPEFAAEIGVNAQPKWPGVERAEGNDGMVKALKAAPGSIAYVSYDRVQAERLNAVKLRNAAGQWVSATEAGFRAAIAESDLSASLMNRPGANSWPITMTSFILIDATPPK----GEEASPVMRFLYWCFMH-GDDLTRGTGFAPLPLTLQSKLAARFGAVKADGKPVYQ 381
309 2.000e-83UniRef50_A0A1Q3TA13 Phosphate-binding protein n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3TA13_9CHLR  ali  27  48................................FAAPAFDTWRLQFSHNPESTVTYQSLGSGQGRSDFLAGKTDFGASDVQITAQEAQASSKNFVQIPVVLGSIVLAFNLPGITGLNMSQETVCGIYTGKITRWNDPKVQADNPNTALPDKAIQQMVRSDSSGTTQVFTQYLSAICPDFKNSVGVSGLPDWKKALAAGQNDGVAHNISLAIGGFGYIEQDYAVQYSLPTVSLKNGAGKFVKATKESIVSAVSSNELNLSLLNQGGDNTYPIVTTSYLLLNRTYA----DRAKGQAVVKFAQYIL-QDGQQDIRTYTYIPLPPQILNLAQAKLKQVVAGGEAVL. 362
310 2.000e-83UniRef50_A0A0M8QYA0 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A0M8QYA0_STRRM  ali  35  6........................NIDGAGATLPALLYAKWADNYQKQTGNRVNYQGLGSSGGVSQIVAKAVDFACTDVPLSLDKL--HSDGLEQFPAVIGAVTPVVNIPGIGPLRLTPEVLADIYLSRIRKWNDPAIAELNPGLSLPATDICVVRRADGSGTTWLFTQYLAARSKEWVQKLGSGATVIWPSGLGGKSNEGVAAFVRELAGAIGYVAVPYAATNHLADVLLENRSGAFVAPTTAALTAATQGGELTPSLLDRDAADAWPIAGASLVLT---------SSDRAAGVHAFFDWAFHHGAQDCA-DLGYVPLPTAVATALTDGWN........... 309
311 4.000e-83UniRef50_A0A1Q7B6Q7 Phosphate-binding protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Q7B6Q7_9ARCH  ali  30  49........................QLSGAGSSLVYPLLSQWTSNYYGHPNVQINYQSVGSGAGVTDFQNKVVDFAGTDAAPVPS---TNPNVTLTIPETIGAVTLAYNIPNVPTLHLNENVTAEIFNGTITQWNDPAIMALNNGLNLPSNTITTVHRSDSSGTTFIFEGYLLKSAFWFASQSKSWPSKAGGNSITGLQNTGVANQVSNTPNSIGYVEVAYALQNSMNVAYVQNKDSSFVKPTLANITAAVSSAWSTVSLLLEPGANSYPIVSFTYIIVYQQLNRPLMTLDKAKALVGFLWYIV-HDGQAAGASLNYATLPGSIVTIDETSIKSITYNGQNL.. 377
312 4.000e-83UniRef50_UPI000A1D1639 uncharacterized protein LOC110180851 n=1 Tax=Drosophila serrata TaxID=7274 RepID=UPI000A1D1639  ali  30  25....FLTALLLTAAPVMAHQAHAADITGAGSSFAAPIYQAWVTNL---------------------VTARTVDFGASDAPMADDKLTS--SALYQFPTVIGGIVPIVNIPGINQLKLNGSVLADIYLGKISNWNDPKIAALNPGVSLPDVAIAPVHRADGSGTTFVFTSYLTKMSADWKDQVGAATSVQWAGGAGARGNDGVGSSVRATEGGIGYVEYAYARRNSIPTVQLQDKDGEFVSPDLGSFSAAAASADWAVDLLNGAGKNVWPIVSATFVLVPTNP----KDAARADAVYKFFDHSFRT-GDATAQKLDYVALPESVKQKIEA.............. 329
313 5.000e-83UniRef50_A0A2R4ZRD4 Phosphate-binding protein n=2 Tax=unclassified Desulfurococcaceae TaxID=132567 RepID=A0A2R4ZRD4_9CREN  ali  33  85.........................ITGGGSTFVNPQMQAWAQKFRSVSGVTVNYQSIGSGAGEAKWFDKALDFGASDVPISKTTYDRLKASFIQIPLIAGAVGIIYNIPECGPLRLSGDVIADIYLGKILYWDDDRIKMQQVRSLLPHEIIRGIHRSDGSGTTALFTLYLSTVSSEWKTRVGTGYTVEWPRGEGARGNEGVSAKVKGTKYSIGYVEYSYAVANKIPMAALKNKDGFYIVPSAEAVMEALKWGDVPATLINREGEKTYPIVGMVYAFIYTDVSDIVSNKDLAAALSAFFKWVLT-EGQKIVT--GYVPLPKELAAKAIKYIE........... 422
314 5.000e-83UniRef50_A2BKI0 Phosphate-binding protein n=1 Tax=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) TaxID=415426 RepID=A2BKI0_HYPBU  ali  32  32.........................VTGGGATFPYPQYYMWMLKFMEHPRVRMTYEYLGSGAGQARFFQGTLDFAGSDPPLGHEVWEQYRGKVMQVPVLLGAVVVTYNLPGDKTINLTGRVLALIYRGDIEYWDDPRIQELNPGVKLPHKPIIVVYRADASGTQEVFTLFLHKAAPDIWPRELVGKAPEYPVALGGLGNAGVADIVVQRPYTIGFIEWSFAIENNMPVAAIMNREGRFVKPSIESLQAVARAADFSGDLVYAEGEDAYPITAWTHLILWTSYS----DPEKARAVAEFLRWIAL-KGDEYMVP-GYAPPPEPLKQLLLRA............. 351
315 6.000e-83UniRef50_A0A1W6ZQR3 Phosphate-binding protein PstS n=1 Tax=Pseudorhodoplanes sinuspersici TaxID=1235591 RepID=A0A1W6ZQR3_9RHIZ  ali  31  12.AGAAALLSTSPTLVRAQDVLGGNAMTGAGSTFAYPVMSRWAQSYRRAPTAQIDYEPVGSMAGIMR--AKDLDFGASDMPLPPKELGKLG--LAQFPIVIGGVTVVANLAGIGPLKLDGPVLAGIFLGKIATWSDEAIKALNPGLNLPDAKITIVTRADGSGTTFNFTDYLCKVSRQFYDTVGSDLYVRWPGSVAAKGNEGVAQVVRATPNAIGYVELAQALRSNLSFALIENSAKTFIKPEPAASADWAAAGDFGLVLANAPGKQSYPITATVFVLMNKELPQG-----RARATLNFFRWAL-DKGANDAEQLGYVPLPEQLVKQVKAYWRE.......... 359
316 7.000e-83UniRef50_A0A2E8UZZ7 Phosphate-binding protein PstS n=2 Tax=Micrococcales bacterium TaxID=2026762 RepID=A0A2E8UZZ7_9MICO  ali  29  43....................CVDGSIQAAGSSAQANAITEWVTAYQACPESTIDYQPVGSGAGVESFVSGQVSFAGTDAAVVEEDMAAAGNDALNIPMVGGAIAVAYNLEGVDNLVLSPEAIAGIFASEITSWNDPAIAATNSGVSLPDATIAQFHRSDSSGTTANFSAYLATVAPDIWA-YDTGKEWTAPGGQGAKGSDQVTASVEQTPNSIGYVELSYVMDAINAKAASVDQGAGPVEPTAQNASNALSAAEIVGEGNDTTAEGAYPITLVTYEVGC---TGGLADDQNSELVKAFLDFAASDDGQGMLENIGYVPITGELLDKVRTSVDALQ........ 367
317 9.000e-83UniRef50_A0A1Q7FW92 Phosphate-binding protein n=1 Tax=Armatimonadetes bacterium 13_1_40CM_64_14 TaxID=1805026 RepID=A0A1Q7FW92_9BACT  ali  29  2........ALVVHFGVGASTAQSVALTGAGGSFPGPLYAKWIQVYAAERGVRLVYHQVGSGEGLRLLVDRAVDFGGIDAIPTRDQLAHXXXXXXXXXXXXXXXXXXXXXQDLSHLAFTGPVLADIFLGKITQWDDKRLVDLNPQAKLPAKPIEVIHRSDDSGATAIWTNYLSKVSTEWRERVGEGSTVQWPVGREARGDQGVADLARRTENSIGYVELAYAFGNRMTFGSVRNKAGQLLAPSLSSTMKALEAADYLTLMTNPDAGFAYPIAGLTYLVVYADQ----LDPDKGRALTQFLWWA-THEGQKHALNFLYAPLPRQLVDRVERTLKTMTVNGQPAF. 337
318 1.000e-82UniRef50_I0A0Y5 Phosphate-binding protein n=1 Tax=Fervidicoccus fontis (strain DSM 19380 / JCM 18336 / VKM B-2539 / Kam940) TaxID=1163730 RepID=I0A0Y  ali  27  62............PPATTTTSQLSVTLKAGGATFPLPQYIAWINEFMKNPNIKISYEGVGSGAGQSNFFAGVFDFAGSDPPLSKSQWSNYTGRVMQIPIVAGAIVIVYNVPNNGQLKVTPEILAMIYNGTIEYWDDPAIRQVNPNLNLPHQKIFVVFRSDASGTQEIFTTYLNVAAPQYWPTSLVGKAPDYPVAAGGQGNPGVAAILNQTPYSIGFVEWNYAIQQNMTMALLRNANGNYVLPTTQGIIEALNSAGGSIPLLNLPGNDSYPIIAATHLLVWGKY----QNKDIAKGIATFLEWIL-KYGDNYIVP-GYAPVGSTLKQIGYKAVD........... 395
319 1.000e-82UniRef50_A0A2A2WLI3 Phosphate-binding protein PstS n=19 Tax=Actinobacteria TaxID=201174 RepID=A0A2A2WLI3_9ACTN  ali  27  17AVGLAACSDDNTGSGDTAAQSVSGTLTASGSSAQNNAMTIFANSYASCEGQTLNYNSNGSGAGVSEFTGGITDFGGSDSPLKEADYAACGSEAWNIPAVFGPIAVAYNLDGV-ELKLSGPTLAKIFNGEITTWNDPAIAEENEGVDLPDESITVIFRSDESGTTDNFQKYLDAASEGAWTQ-GAGKTFTGGVGEGARGNEGVSGAIGQTPGTITYTEWSYAKNQNLSMVKVITPADEGVELNAETSGVTIDSARLENEGTNPESAGAYPIILPTYEIVCSSY----EDPETAAAVRSFLNIAVAEDVQAQLEDEGYIPVPDAFREQLLTAISEIS........ 369
320 1.000e-82UniRef50_A0A271LIA0 Phosphate-binding protein PstS n=12 Tax=Rhizobiales TaxID=356 RepID=A0A271LIA0_9RHIZ  ali  32  19....STGALTLAVALMIGAAAQAEPIRGAGSTLAAPIIGKWATAYENAPDWKVDYEIVGSLAGVLRLDQPDIDFATTDAPINAAELRKAGRQ--QFPIVMGAIAVVVNLDGIGPLRLTGPLLADIYLGKIQSWSDPAIKAVNPDLALPDLRISVVHRKDGSGSTFVFTEYLSAVSGEWKTKYGANTLISWPLGTDAEGTQNLIRAVHDTKGAIAYAESGQAQRASLAYALIENKSGRFVKPGPEGVQAAATSIDWAASLTDRDGDAAYPISTAVFAVV----QVSGRSEHRYRRVRDLFRLAF-AQGAGDAAALGYVPLPKALIDQIEQCWAR.......... 357
321 1.000e-82UniRef50_E0SST7 Phosphate-binding protein n=2 Tax=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) TaxID=583356 RepID=E0SST7_IGNAA  ali  32  62........ASSQVATQTASATYSVTIVGGGATFVNPQMQAWIQRFMKDYSIVINYQSIGSGAGEAKLIDGALDFAVTDVPISREKLKSRNIPFVQIPIVAGAVSIVYNLPECGPLRLSGEVIADIYLGKIIKWNEPAIAQLQKDILLPDKEIIGIHRADGSGTTYLFTAFLSIVNSDWNNKVGYGYTVEWPRGIGAKGNEGVSATVKNTPYSIGYVEYGYAIQLGLKMAAIRNRDGNYVLPNTTTVLSALYWGEYIFHILYREGSETYPIVG-----TPIMTLRLDVDPNKLQLIKGFLLWILT-EGQKE-ENLGFLPLPKEFTERFIPIVESIT........ 423
322 1.000e-82UniRef50_A0A257CDT5 Phosphate-binding protein PstS n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257CDT5_9BURK  ali  27  18SLVALTSVALGGTWAPSAQAAES-QVQGAGASFPSKVYGRWMKQYAEGQSVSLSYKATGSGDGVKQAIARTAQLAGTDAPLNEADLAKH--KLVQLPMLVGGVVPVVNLPGNKRLRLTGEVLALVQQGEITRWDDARIAELNRGLTLPAKRIVRVVRADKSGTTEGYTRYLSEVSATFKTAVGVNGLPKWPGVERAEGNDGVAALVKSTSGSIGYVSHDRIETDGLASVTLRNRDGQWVSSSEAGFRSAILNSDLTASLMNRAGSESWPITLTSFLLI----DATPANAAAAESTMKFLYWCFM-RGDALTRGTGFAPLPTSVQARLTSRLTAVKPGSVPVYQ 363
323 1.000e-82UniRef50_A0A2N6SYB2 Phosphate-binding protein PstS n=7 Tax=Bacteria TaxID=2 RepID=A0A2N6SYB2_9CORY  ali  25  19GLTLSACGGSNAESEVEGLTETTGELQGEGATSQQRAMDLFATLFESNPGSTLSYNATGSGSGQSQFIANTVDFAGSDSPLKDDQIEDAGNDAWHLPMVIGPVAIAYNLEGVDV-ALSPAVTAQIFDGKITKWNDPAIAEVNEGVELPDTDISVVYRSEESGTTDNFMKFLTSAAPEDWEHE-ASKSFPTGTGSGANGSAGVVDQVAQIPGAITYVEAGFAKDKDLGIAKMDFGHG-PVELNADTVGAALDKVEYKGEGNDMDEEGAYPLVLTTYQIVCS----AGYDETTRDLVKNFFKIVL-EEGQQELEDLGYIPVQGDFKQKLVDAVDAIQ........ 364
324 1.000e-82UniRef50_Q47PE8 Phosphate-binding protein PstS n=261 Tax=Actinobacteria TaxID=201174 RepID=Q47PE8_THEFY  ali  26  17ALTLVAGCGSDNAVRGGAQECFDGAIRGAGSSAQELAMQVWISALQTADDARIYYDAIGSGGGRNQFIDGAVDFAGSDAAMDEGEQERCDSDVIHLPAYVVPIAVAFNLEGIDSLNLTPDTLARLFSGDITRWNDPAIAETNPDVDLPDLPVVPVSRSDESGTTENFTAYLAAAAPDAWPHDPDGQWPFPPV-EAGQGNSGVAQAIRGGQGTIGYLEASHAEG----MATVRVGSGDFVAPSPESAARIVSVSPRRDSDYSATEADAYPIVLVSYEIACLSYA----DAATAEGVRTFLSYLLSAEGQEAAQESGSAPLDAELRAELLESVAAI......... 365
325 2.000e-82UniRef50_A0A2D2DPI3 Phosphate-binding protein PstS n=9 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A2D2DPI3_9BURK  ali  28  10..........AALVVLSPATYAQNQLAGAGSSAAEILYTSMAAAYSKYAQVGVSYQSSSSTDGLQQVKSRKVDFGATDVFLSADERKS--GKLLCFPTAVSGIVPIINVPGVGQLKLTGELLADIFSRKITKWNDPKLQALNPGLTLPALPITVVTRQDSSGTTFNFTDYLSKSSPDWKAAYGSNYSIAWVAGTTVKGSSSVVAALKQTAGAIGYVDYQYVSKNKLNFAMLKNRDGKFVTPTGAGFSSAMNNSGWAEMLTDKPGAGSWPITASTFAIVP----LVSSKPDNTVAAIKFFTWGFVH-GDDAVGNTAFVRLPDNVQGRIFGELTTITTAGAPLK. 344
326 2.000e-82UniRef50_A0A077LUK3 Phosphate-binding protein PstS n=50 Tax=Actinobacteria TaxID=201174 RepID=A0A077LUK3_9MICO  ali  27  48....................CTPGNLTGAGSTAQQNAMAQATAGYKARCGSDVSYNGTGSGAGITSFITKQVDFAGSDSALNPDEVAKCGSPAWDLPMVTGPIAVAYHVKGVDTLVLTPSVTAQIFSGKITKWNDPAIAKLNPGVTLPAEAISVFFRSDSSGTTDNFTNYLNTAAPSDWTAKHA-KDWSGKVGQGKAKSAGVSQAISSTEGGIGYVEWSFAITDKLKMAQIDNGSG-PVALTAESAGKAVEAATIAGTGNDTKAEGAYPIVLVTYEIVCSK----NADPAKGKAVKSFMSYLVSDDFQNTLTSIGSAPLPTSIKDKVTAAVAALS........ 373
327 2.000e-82UniRef50_A0A1H0R0V9 Phosphate-binding protein PstS n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1H0R0V9_9ACTN  ali  25  55...............ASSISCAKGQILSSGSTAQQNAIEAWVKNYQQACGATINYKPSSSGQGVIDFNQGTDAFAGSDSPLAADEITCSGGEGIDLPMVGGPIAIGYNLPGVSNLVLDAPTLAKIFNSKITTWNDPAIKKLNPGASLPSTKIQTVHRQDDSGTTDNLTKYLGGAAKADWP-YPHAKAWAGKGGQAVAQSSGVASLVKQTEGSIGYFELSYATADSIPTVKIATGAPQPVEATTANASNGIAQAKVVGTGSDTKAPNAYPIVLTTYEIVCDKGNK----ADTLPLTKSFLNYIASADGQSALTSAGYAPIPDAIISKVRSTISALS........ 385
328 2.000e-82UniRef50_A0A0J0YK92 Phosphate-binding protein PstS n=1 Tax=Actinobacteria bacterium IMCC26207 TaxID=1641811 RepID=A0A0J0YK92_9ACTN  ali  27  45..STTTVAAAGEAPTDASIKALTASVSGGGASFPDSFYQAVNTDFNGVAGTRVTYAKSGSSDGRSQLSAGTVDFAGSDSLPKDGEV--FPSTVLYFPTVAAPITVSFNLDGVTELQLSPDVIAGIFQAEITTWNDPKIAADNPDAELPATAITVVHRSDGSGTTNNFTKYLTAASPSVWTLGSGDEVNWPESTQGAEKNSGVAELIKQTSGAIGYVDLADAGKAGLSLASIQNSSGNYIAPSVEGVQAALEDATIEANLTYNPLNGSYPITAPTFLLVLDKQA----DAAKATTIKTYLQYVLTT-GQAQASETGYVALPSSLAEKAIAQIDKI......... 374
329 2.000e-82UniRef50_A0A1Z1WDL1 Phosphate-binding protein PstS n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A1Z1WDL1_9ACTN  ali  25  21ALALTACGSDDDGSSNGGCDGAKGQLMASGSSAQKGAIDAWVKQYRAACDVQLQYKPDGSGAGITSFLQGQTAFAGSDSALKPEEIAESGSQAIDLPMVGGPIAVAFNVPGVDSLTLDAKTVADIFNDKIKTWDDKAIEKLNPDAKLPGTKIQAFHRSDESGTTDNFTKYLKGAAPSAWPHEPA-KVWAAKGGQSASGSSGVAQQVKQTEGAISYMELSYATE-GIKTVDIKTGAKEPVKATVDNASKAISEAKVVGKGKDPTAEGAYPIILVTYEIVCEKNNK----KDTLETTKSFLNYIASEDGQSVLKDEAYAPMPTEIITKVRETVKGLS........ 373
330 3.000e-82UniRef50_A0A2R7SBN0 Phosphate-binding protein PstS n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A2R7SBN0_9BURK  ali  29  16......LALGLSALVLAAAPAWAQSVQGVGATFPAKVYDTWARAYAKAGGGAVAYKGTGSGDGIKQISARQVDFGGTDAPLPPAELAKL--KLVQIPMLVGGVVPVVNLPGLGPLQLDGEMLAELYLGRIKFWNDRRLAALNPSVELPALPVKRVVRAEKSGTSDGFSRYLAGASAPFKAEVGASQLPAWPGPLKAEGNDGMVQALRATPGAIAYVSYDRVLRDRLAAVKLRNAAGRFVSPTEAGFRAAIVESDMYATLLNRNGAEAWPITLTSFVLVDAEPA----NGAQATAALKYLYWCFMH-GDDLTRGTGFAALPINVQTRLAARFAHVRPDGQPVYQ 355
331 4.000e-82UniRef50_UPI000A02204E phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Desulfosarcina sp. BuS5 TaxID=933262 RepID=UPI000A02204E  ali  30  27..............SGCQVHEASNRITGAGASFPAPVYRAWSAEYSSRNPVIVRYKSVGSSEGIRFVKSGKVDFGASDITLSAEELEQEDXXXXXXXXXXXXXXXXXXXXXNKEMVFSGPVLVNIFMGRITKWDDPEIKKLNPNLRLPERSIAVVFRSDGSGTAWLFTQYLNSVSSTWKTGPGSGDRIIWPTGTGASKNEGVLRKVIETQGAIGFVEYTYAKKAGIACASLINRSGRSVNPSIQTFYAAAVKSAENQSETDTKGEECWPITGYTYILLHK----TLKSEKKAKALIDFLTWCYGEKGKKITRQLHYLPIEGNISNQFIQKIKS.......... 347
332 5.000e-82UniRef50_E1VM11 Phosphate-binding protein PstS n=1 Tax=gamma proteobacterium HdN1 TaxID=83406 RepID=E1VM11_9GAMM  ali  30  5......TLLIAAVMGLGAQAASAEQINGAGSSFIYPVLSKWASTYYQETQEKINYQSIGSGGGIQQIIQGTVHFAATDAPLTGKELAEH--KLIQFPVIVGGVIPTHNISGIKELRLDGETLALVFAGKVAHWDDPRIKALNPTLNLPHQAVTVVHRADGSGSTWMFTNYLSKVSPEWAKTIGSDKSVNWPKGVGGKGNEGVANYVKRLQGAIGYVELAYVLHNNMNSIRLKNQAGNFIEPTLDSLKAAAANADWAVVLTEQPGEQSWPITGATFGLMP-----ITSPGTLRKDIQAFFSWGWRKGAQQ-ASDLAYVPLPMNVVEKIEINWQ........... 330
333 8.000e-82UniRef50_UPI000697834F phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Nitriliruptor alkaliphilus TaxID=427918 RepID=UPI000697834F :  ali  30  60.................GVASDQADLLGAGATFITPLMLEWIRD--NEPGINVNYQSIGSGGGIAQFLEETVDFGSSERYLTEEEVTDAGCDAIHIPDAFGAVVPVYNDPGQDSLVLDADTIAGIYLTEIETWADPAIAELNPDVDLPDTRLIPVHRSDGSGTTYIFTTYLDDENDAWSEQIGNGSEVDWPAGIGGNGNEGVAAETQQQPGAVGYLSIAYAIENDIPMASVVNADGNAVYPTVESVAAGPEPEDFRYDILGVGGDG-FPIVGTHWILA----WECGYDDATAQSLKDFLTWAVT-DGDALAVDLLYSPVSGSFQERVLGEIERI......... 388
334 8.000e-82UniRef50_I0HCQ6 Phosphate-binding protein PstS n=6 Tax=Actinoplanes TaxID=1865 RepID=I0HCQ6_ACTM4  ali  24  16......GCTAAPEPAPEPVACGAGTTAGQGSSAQTSVLQAWMKAYQACPAASIDYASTGSGAGVRAFADGTGDFAGTDAPLDAAGRQRCRGPVVHLPLVAGPIALAFNVAGVDRLRLTPATIAKIFSGAVTVWNDPAIAKDNPVAALPSTPIGTIHRSDDSGTTDNFTRYLAAAAGPVWPH-GSGSAWRAPGGTGERGSHRVVAAVARTNGAIGYVEGSYATVHDLPVVEVGDADGPFTAPSNSAAGLAIADARIGDDLYDGTADYAYPIVMVSYEIVCRTGTP--------ALTRDFLAYAAGSGGQRVAEAAGYAALPDALRLRVESAVLALT........ 345
335 8.000e-82UniRef50_Q7VAD1 Phosphate-binding protein n=23 Tax=root TaxID=1 RepID=Q7VAD1_PROMA  ali  26  11..VSIAALAAGIVACGSNNSATNIRLSGAGASFPSKIYTRWFADLNNEGGPRVNYQAVGSGSGRKAFIDETVDFGASDDPMKAQDIAKVKRGLVQIPMVGGTVAFGYNNPDC-ELKLTQRQAVRIAIGKINNWSELG---------CPAQKITWIHRSDGSGTTKAFTNSMEAFSKEW--TLGTGKSVAWPVGIGGKGNAGVAGVIKNTPGAIGYVNQSYIKGN-VRAAALQNLSGEFLKPNINSGAKALNGPNLAGSNPNPTAKGAYPIATLTWVLAYETGNGS-----KTEAIIASLGYLLSDKAQAKAPSLGFVPLTGDILMKARKAVTRI......... 328
336 1.000e-81UniRef50_UPI000688E5E8 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Solirubrobacter sp. URHD0082 TaxID=1298857 RepID=UPI000688E5E  ali  32  2....................AQDAQLVGAGSTLVAPLMAKWSLDFQGKNNIKVTYGAVGSGAGIAQITARTVDFGASDAPLSAAQAAAC-HGCVQIPWALTATGIAFHIDGVKKLQLNSSVLSQIFQGQISMWNDRRIKAINKGVSLPALKITPVFRSDGSGDTYAFTDFLSRTSPSWKGKVGFGTQVSFPTGVGGKGNDGVTAVVSSTNGAISYISAAYIIAHGLKAAALQNAAGKFEYPNLKNIQAAADPASNEMHIVAPPAKTAYPLSTFTYAIVPKATP-------KASGLSKLVLYAMT-DGQKYGPALDFARIPPVVLKAAKNTLKQVKQG...... 316
337 2.000e-81UniRef50_A7I0G6 Phosphate-binding protein PstS n=42 Tax=Campylobacterales TaxID=213849 RepID=A7I0G6_CAMHC  ali  31  15.................SGAFASDKIMGQGATFPLPVYKDWAKIYYKQTGNQVTYSGGGSGKGISAITDRNGNFGGSDSALKKDEL--NEKKLLQFPAVIGSIVLAYNIDGVKDLKLDAEAVAGIFSGKITKWNDPAIAKINENIKLPDADIVPVVRSESSGTTFNFTSYLSKANEDWAKNYGAAKTINWGAVTPAQGNPLVAKTIKQTPNSIGYIEYAYKVTENLNAATLKTANGDWAEPTEENFAKAALNSNFSIDLAYGKGEKSYPIAAATFILLPSD------NAEDGKKVTKFFKWAFNDEAKKAAANLGYLPLPKDTVDMIEEYWKK.......... 332
338 3.000e-81UniRef50_A0A285V5C6 Phosphate-binding protein PstS n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A285V5C6_9ACTN  ali  26  18AGLSVTGCAAVNELAIGSGEQYAGTLVGAGSSAQQAAMQGWTAGFASQPEVTVNYDPIGSGGGREQFLAGGTDFAGSDAFLDEDELRCGPDGVFELPNYIAPIAVIYNVDGVDELNLSPTTLAGIFAQRITRWDDPAIAGDNPDTDLPDVPITPVNRSDESGTTENFVDYLHQAAGAAWPHEVDGNWPV-PGGEAAQGNSGVVGAVNAGNGTIGYADLSQAGELGVARIRV---GEEFVAPTAEPIEGRGPFDFAIEVNRDTSGSGEYPIVLISYHIGCLTYD----DPQVAELVRAFLTYVVSEEGQEAAAVAGSAPISAGLRDQALTALDAVAA....... 364
339 3.000e-81UniRef50_B1X4G6 ABC transporter, substrate binding protein, phosphate n=1 Tax=Paulinella chromatophora TaxID=39717 RepID=B1X4G6_PAUCH  ali  27  31....LTALTSLAGILISCCPQTTISISGAGASFPALIYDRWFYNLRTQ-GFKVNYQSTGSGTGIRQFIIGTVDFAASDTLIDKKKIKKITQGLIQVPMTSSAIGVAYNLPGCK-LELTQIQLVKIFQGSIKNFKE---------LNCKEQPITIVYRAESSGTTFNFTKNLSRISKSWKKSPGTGKTISWPIGIGSKGSEGVASTIEQMKGALGYSEMSHIRG-KLQAASLENGSGKFIQPNSETVIQAIESVTSTKNLLGHEASPTYPIVAFTWIFLAKRNEDNKIDI-----LKRVFSYMLSPKAQKQAVELGYVSLPIPILKQATQIVNSI......... 345
340 4.000e-81UniRef50_A0A1Q7CJV3 Phosphate-binding protein n=8 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7CJV3_9BACT  ali  29  10....AVFLGWAIFLATDAGGQEKTVLVETGSSMPEPLYKSWIDEFQQQPSTDIRYMAVGTGESARNILAGSGDFGGGDAPIPEAQLRASGKSILELPVVLIGIVIIYELPDVKELKLTGPVLANIFLGKIKAWNDPAIAKLNPEMKLPELSVQVLHRNEGKGSNYILSDYLAKVSPEFLATAGRSESPKWPVGQAFQRSQDLVAKLRGTPGAIGYTELNIAAGSGVRIASIKNAAGEFVKPSANSIGAAATASDFRLSLTNATGKASYPISSFTWLYVP----AAAKDSGRGSVVASYLKWVYTS-GQKVAQEKGYAILPPEVLEKAVAKAASV......... 342
341 4.000e-81UniRef50_Q478D5 Phosphate-binding protein PstS n=1 Tax=Dechloromonas aromatica (strain RCB) TaxID=159087 RepID=Q478D5_DECAR  ali  27  24.....................AAEPMTGAGSSAAYPIYKLWADQLKREGGFVLNYDPVGSSAGVERARARQADFGATDVALKSEQLAK--DNLILFPTVITGAVPVINLPKEKPLVLDGPTLARIFLGEIEHWDAPEIRALNPGLSLPAKPIVAVVRSDGSGTTYNFADYLAKVSPAWKQKMGVATNLKWPSFTSVKGSKGVAEAVKSTPGSISYVDYNYVLDYKLTGAAMKNADGAIVEAGPYTFREALAQSDFTQTLTNQTGKSSWPITMGTFIVMPR----VSNNPERTIQVTRFFTEAFM-RGDDLAKQANFVRLPSIIQGKAFRVISEIVAKGVPI.. 345
342 5.000e-81UniRef50_A0A2E0KEC5 Phosphate-binding protein n=1 Tax=Synechococcus sp. NAT40 TaxID=2024884 RepID=A0A2E0KEC5_9SYNE  ali  27  11........SSLLALGAGMAASAAPRLNGAGAXFPAKMYQRWFAELAKSGGPKVNYQAVGSGSGRKAFIDQTVNFGASDDPMKVTDMAKVKRGVVQIPMVGGTIAFGYNYPGC-NLKLTQEQAVKVAMGQINNWKQVGCK---------PGKMVWVHRSDGSGTTKAFTNSMQAFSKTW--TLGTGKSVKWPSGVGAKGNSGVAGVIKNTKGAIGYVNQSYIKGNVVA-ASVQNKSGEYVKPSFASGAKALNGIRLDANLPNPTAKGAYPIATLTWVLAYKTGNGSN-----TAAIRKAFNFMLSDQAQAKADDLGFVPLKGAILSKARAAVNKIS........ 323
343 5.000e-81UniRef50_F9VV92 Phosphate-binding protein PstS n=44 Tax=Corynebacteriales TaxID=85007 RepID=F9VV92_9ACTN  ali  26  7GALAAVSTIAALTLVTACGGGDTQTVSGEGSTAQQKAMEHFSQILSDDSDIVLDYTGSGSGDGIKKFIAGDVDFAGSDSALKGDEITQAGNDPWHLPLVVGPVAIAYNLEGVDNLKLDSAVIAKIFNGKITKWNDPAIAALNPGVQLPGGDIVPVYRSDSSGTTDNFQRFLQNSAPNDWPYEHSKEFAPKNVGSGASKSTGVGDTVKKTPGSITYVEWGFATENDLGVADIDFGAG-PVELNAASAGKALDELAFTDALFASKAPGAYPLLLTPYSIVC---SAGYSDDATSTTLKDAFTKILG-DGQTGLEEIGYVPVPQNFKAKLQGSIDALAGSGNA... 357
344 5.000e-81UniRef50_A0A1F8KPU6 Phosphate-binding protein n=1 Tax=Chloroflexi bacterium GWB2_49_20 TaxID=1797612 RepID=A0A1F8KPU6_9CHLR  ali  30  5..........TVAATVEPLPAGSVQINGAGATFPLPVYTEWAYAYQYDPSVVINYQGIGSGGGKKGILDGTIDFAGSDSLLKDEEYTA-GADLQMYPMLAGAVVNVYNIQTLPALVLDRQTLVDIYNAKVTKWNDARIVALNPGLYLPNAPITVVHRSDGSGTTEIFTNALTSFSPDWVAGGASSVEWPAGNGVGGKGNQGVAASVINTPNSIGYVELSFAISNQMPFASMVNKAGKTVIASADSLASAMNDAKLTVTIVDASGDGSWPVSGYTYLILHTQ---NMTDFVKAQKLLEYIQWSLTDSAAKRAGDLGYSVLPGAVRDLVLAKLGQVTVNGQPVL. 354
345 6.000e-81UniRef50_UPI00037060E3 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Neomegalonema perideroedes TaxID=217219 RepID=UPI00037060E3 :  ali  29  1....MLTGALGLVAALAATSLQAAPIQGAGSTFAAPAIQRWSRDYEASPDWRVDYEPVGSLSGVMRLAQPEVDFAATEAPLTAEELEA--RGWIQFPILMGGVVATANLEGVPELRLSGPVLAGIYLGEITRWSDPVLAGMNPGLSLPDAEIEVLHRADGSGSTQVFTSFLSETSPEWAGKAGSDLLIAWPVGRGEKGSGGLAARAAATPNSLAYVEYGQALRQGLPMAALLNQAGEFVAPSPESFRIGLDGVEWSADTTNLAGAGAYPVAVATYAVLPKD-----RGAHRLRRVFDVFHIAFS-QGADEAEALGFIPVPPRLAERIEAYWASV......... 339
346 1.000e-80UniRef50_A0A1Q7X4R8 Phosphate-binding protein PstS n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q7X4R8_9ACTN  ali  37  7.LAMFACGLVVAVAAXXXXXXXXXTITGAGSTLVLPLVSKWESDYNEKAGVAVTYGGIGSGSGIDQVTARSVDFGASDAPLTPDQ-EKAGNGLLQIPWALSATGITYNVSGSDNLKLDGQTVADIYLGNITTWNDPAIAKLNPGVKLPSTKITPVYRSDGSGDTYALTDYLSKISPDWQSQVGTSTLVKFPTGVGAEHNDGVAAALTKTDGTIGYLAASYIQSNSLNQVALQNAAGNFETPDVKTIAAAADPSNNAISITDPPASDAYPLSTFTYVLVPQ-------ASSKADALKKFITYAIGP-GQQFGPDLLFAPLPKPVLAVDKTTIAKI......... 344
347 1.000e-80UniRef50_A0A1Q6ZCG8 Phosphate-binding protein n=5 Tax=Archaea TaxID=2157 RepID=A0A1Q6ZCG8_9ARCH  ali  29  50........................SITGAGSTFAYPIFSAIAGNFSKYPNIQVNYQSVGSGAGIADFQARTVDFGATDAPLSTSQITNTIGTPLHIPATIGSEAIAYNVPGITTLKLNVTITAEIFQGNITKWNDPAIQDLNPTLSLPSNTIQVVHRSDGSGTTFIFTSWLARSS--VWKQGASKSASVFPIGTGAPGNEGVATLIQTTQYAIGYVELNYALSASMTYAAVLNHDLNYVLPSLATTAYAVNGDWSNVNMLNATGPQTYPIASFVYILVYQELSHPNLNLATAEALVSFLYFTVIN-GQLLASGLSYVPLPQSVLTLDIATLSSVTFNSHAL.. 381
348 1.000e-80UniRef50_A0A2E5EW10 Phosphate-binding protein PstS n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E5EW10_9ACTN  ali  29  24.......................AEIVGSGASFPYPFLKSIFKEYSAQTNIPIQYEPHGSKNGYVDLKEQRVDFAGIDLYLSDSLIEQMPEPILHFPITLSGIGIAYSLPNRPEVQLSTQVLANILIGRIQYWDDPAIQGLNPDIALPHMKIIVITRSKGSGSTYVLTQYLSYLNPAWEASFGVSSVLDIPGTLLAKNSDDMAQLLQQIPGSIGYIGTAYQNEYSLQFAAMENSSGAYILPSQDSLQAAARPEDGRISCIFTDVESGYPLTSFSWLIVYQDQFYQDRSKKQAQQMAHFLNWFVRHSA-RISERHGFPVLPENALAINESHLNKLRYKGRRLK. 346
349 1.000e-80UniRef50_A0A2W5Z107 Phosphate ABC transporter substrate-binding protein PstS (Fragment) n=1 Tax=candidate division AD3 bacterium TaxID=2052315 RepID=  ali  33  33...............AAAGAKDSATLSGAGSTFVSTILQEWTKAYRSAPGVTINYQPVGSGAGIQQLTSKTVDFAGSDVTLKPEEQQATGGPVAEVPWVAGAVAVEYNLPEMKNLKLSPATLAGIFAGKITKWNDAAIKADNQGASPPSTGISVVHRSDGSGTTQVFTEFLKATAPEVW-TFGSGKDVPWPTGTGAKGSDGVTAGVKQSPGAIGYSELSFPKQASLGIASIKNKAGQFMAPTASAVTAALAGATVNPDLTTPDDAAAYAMSTPTYLMFYKAGTDPAKS....................................................... 312
350 1.000e-80UniRef50_A0A2I1IQY0 Phosphate-binding protein PstS n=6 Tax=Actinomyces TaxID=1654 RepID=A0A2I1IQY0_9ACTO  ali  23  18AVTSLAACGSDNATGDKSGESVSGSIKGAGASSQEAAMTTWTQNFMSNPDAQITYASVGSGAGIEQFVSKQVAWAGSDAYLEGDEVQKCGADAYDLPTYISPVAVVFNLKETKKLNLDPDVVAKIFKGEIKKWNDPAITKSNPDANLPDLDITPVHRSDKSGTTENFTSYLNEAAPDVWPDKADKTWPIS-GGETGDKTAGMIQAVQGTEGTIGYADASQAGDA-LGVASLKSGDG-YTAPTQESAAKAADGDLALNVVRVPKEEGAYPLILISYEIVCSKYE-----KEEGNVVKAFMEYVTSEEGQKAASEAGSAPISNELREKIQKSLDKIKIG...... 371
351 2.000e-80UniRef50_UPI000D0D5550 phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI000D0D5550  ali  27  175.....................GGGTLSGAGASSQENGMAAWVAAYTGACGTTVNYDAVGSGAGRSQFTDGSVAFAGSDSSLDEDETERCGSEVVNLPAYISPIAVAFNLDGVDKLNLKPDVIAQIFDQKITKWNDEKIAADNPDADLPDTEIVPVNRSDESGTTENFVSYLSEAAGDSWKHEVSGDWPV-KGGEAAQGSSGVVSAIEGGTGTIGYVDASHAKDLGTVAV---GAGEEFVEYSPEAAAKIVDASPARELDYKTDEAGAYPIVLVSYEVACMEYEEQSD----ADLVKSFLGYVISEEGQKVADEAGSAPISDALREKIQGSLDKIKAG...... 498
352 3.000e-80UniRef50_A0A0Q7Q4D2 Phosphate-binding protein PstS n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q7Q4D2_9ACTN  ali  26  21GLSACGAGNEDSPSDGGSSDGVSGTLNGAGASSQEAAVAAWKAKFQANPDATVNYDPSGSGAGREQLIAGGVQFAGSDSYLDEDELDKCASDVVEVPTYVSPIAVIFNLDGVKDLNLSPATVGAIFEGKITTWDDDAIKADNPDADLPSTKITPVHRSDDSGTTKNFTDYLDQASDGAWTG-GAVETWPVKGGEAAEGTSGVVQAVTNGQGTIGYADESQAGE--LSKAAIKVGD-DFVAPTTEAASKVLDSATAVDVDRKSTEAGVYPVVLVSYQIACQTYS----DEKVAELVKSWLSYVTSDEGQTASNEAGNAPLPADFASKVKTAVDTIKA....... 364
353 4.000e-80UniRef50_A0A2J4G9H7 Phosphate-binding protein n=2 Tax=Thermofilum TaxID=2268 RepID=A0A2J4G9H7_9CREN  ali  27  27..........TVTSQTAQPNYPSATLSGSGATFPQAQINVWVSEFKKYPTIKVEYAGGGSGKGQSDFIQGVVDFACSDVPLKTADWEKARSAYYQIPWVAGGVAFVFNIPGNATLRLSQSVLVNVLLGRVEYWDDPSIASLNPGLKLPHQKIIFVHRSDASGTTNVVTAFLSKVSQEWRERVGAGLTVQWPRGVGAQGNQGVAQTVRNTPYSLGYVELAYTK--NLGVVALENALGEYIIPTPESVAKALEGVSVKLDTLNVKASGAYPIVSVSYLIVK---SPSAYPREKAKALSLFLEWVFT-EGQRYIAE-GYAPVAGTFLEAGRSVAKLLS........ 368
354 4.000e-80UniRef50_UPI000DA145ED phosphate ABC transporter substrate-binding protein PstS n=2 Tax=Deinococcus yavapaiensis TaxID=309889 RepID=UPI000DA145ED  ali  31  72.LLMLKFLSVTLLLTLTASTASAVTLKGATTTAATSLFTKMFDEYTKTTDATVNFEPGTSPAAQKAIVSRSVDFAAAIIPLDDNEIGKDTEDVVHIPVALSAVVITYNVPGLEPLNFNGRVLSDIFFGRIKYWNDERISRLNRGVTLPNLLVTPVYRSDPSGYSAIFTNYLTKVSREWNARLSDGVIVDWPTGASTDSEDKSAKAVQAIPGAIGYMGLSRALKDRLTFGNIQNAAGTFVRPTESSIEAAATSADGTANITYAKVSRAYPISNYIYVLLRREQGYEGRTETQAKATRDLIAWMLS-EGQQYHSRLYYGELASEVVNRAKKLLATLTFNGKPL.. 414
355 4.000e-80UniRef50_A0A084IQA3 Phosphate-binding protein PstS n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A084IQA3_9GAMM  ali  27  23..............SSVGTAFAATSLTETGSSLLYPLFNLWVPAYKKHEGVQINTAATGSGTGIAQSTQGIVQMGSSDAYLSGAQMKKHPS-MLNIPVAISSQMINYNVPNSDHLKLSGPVLADIYSGKIRYWDNKKIESMNSGAHLPHKRIVPIHRADGSGDTFLFTQFLTKSANNWKAHYGTTSWPSVQGAIGATGNSGMVTALQNNPYSIAYIGVSYKDQAGLGEAKLKNKSGNYVLPNKQTVPAAAAPKSERISLIYAKGKQSYPIINYEYVLVDSKQP----NKETAKELKQFLTWAVSSDGMEFLKPVHFMPLPAKARQLTMSQIDKI......... 353
356 5.000e-80UniRef50_A0A2R7MME7 Phosphate ABC transporter substrate-binding protein PstS n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A2R7MME7_9MICO  ali  28  11.AAALAVVSLVALTPTPALADGYVPISGSGSTWSQNALDQWRKNVASNYGMTVNYSGTGSSAGRTDFRNNTVDFAISEIPFQKQDGTSLDGRFAYMPIVAGGTSLMYNLKRVTNLRLSGEVIAKIFSGQISKWNDPAIQSDNPALAMPDRSITPVYRSDGSGTSAQFTLWLSKQFGNIWTQGMRSQFPQVASFKGQNGSLGVAGYVSQDEGAITYVEYSYAMKSGFPVVKVLNKAGYFVEPTYQSVAVALMSAAINPDLTNSGDPRAYPMSSYSYMIVPT-QTNKLFTPEKGKTLSRFANYML-CEGQQQASALGYSPLPMNLVQAGSKVLESI......... 367
357 5.000e-80UniRef50_I3TEW3 Phosphate-binding protein n=1 Tax=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633) TaxID=1184251 RepID=I3TEW3_THEC1  ali  28  45............TSPTPTSPPLNVVLNGGGSTLQAPLVQYWARLFQEETGVQVNYQGVGSGAGISMFLAGTTDFAGSDVPLPHDVYKNYEGRVLQLPITVGVVVVVYNLPELPKLNITGCLLAEILGGNVTRWDDPAIKSLNPAVKLPDKDIVVVYRSDKSGTTNILTTYLSRSCPSLWPSNLVGLSMPTSRAIGAKGSDGLTLAVKNNPYTIGYVEVQYALSSGLQYAALQNREGFFVLPTPNGVSAAADWSQSSSEVIYAPGNNSYPLVTFTYQLFWTSYS----DKSKQEAVNLWIRFVLT-KGQEKTIE-GFHPLPQRLVSELLNSLTQ.......... 382
358 5.000e-80UniRef50_A0A0U2W020 Phosphate-binding protein PstS n=11 Tax=Burkholderiales TaxID=80840 RepID=A0A0U2W020_9BURK  ali  31  38......................QAELRGAGATFPAKLYQRWGRQYAQSGGQVVNYKPTGSGDGVRQAIARSVDFACIDTPLSAQELS--ERRLVQIPTCVGGLVPVVQGFENQKLKLTGELLADIMLGAIERWNDPRIAAVNKNLPLPSRRIVRVVRSDKSGSTESVSRYLAQQSPRFAKDVGIGALPKWPGVVAAEGTDGIAQAVKATPGAIGFVSSDRVDADGLAGVQLRNRDGQFVSASEAGFRAAVLNSELTANLLDMPGADAWPLTQTTFVLL----DALPATAASVEPALKFWYWCFS-RGDNLTKGTGFAPLPTSMQTKLAGRFAQV......... 349
359 7.000e-80UniRef50_UPI0003796253 phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Microbulbifer variabilis TaxID=266805 RepID=UPI0003796253  ali  28  13GVTLAVAAVCLLPQINAQTSESTINLRGSGARFPHPVYVDWFRQFHQDNDIFVHYGLSASTDGIRDFLGNTVDFAASDIAIEIDRLEGLKGGAVVLPVTAIQLVLIFNLPGIEALKLSRDAYANIFLGKVQTWDHPSIAASNPEIQLPNTEITVVTHTESSGASYLFSGHLSNINDEFRENIGISQAPNWPGFERAAGSQGVAAKVRATPGSIGFIDHCFAEVTNLPEALLENRSGNYIEANVESGTAALEAPNLIAWVWDPAAEGAYPITSFSWLLLYAEQ-----DDSKAKALRKMLSFILHANSQAKAGELGLVPLPEHVREKVLSAID........... 356
360 8.000e-80UniRef50_A0A2W5IC63 Phosphate ABC transporter substrate-binding protein PstS n=1 Tax=Lawsonella clevelandensis TaxID=1528099 RepID=A0A2W5IC63_9ACTN :  ali  25  22.LLALCAVSTLLTGCAGNPDNTNGTLTGEGATSQQNAINLFADVLIREHGLNLAYNATGSGAGVQKFLESVVVFGGSDSPLDADEAKRSGHPAWHLPLVISPVAIAYNLPGVDGLVLTADALAKVFKGDITKWNDARIKKLNPGKTLPDEHINVIFRSDKSGTTDNVQKFLAYTAPKVWKADAVGK-VWQGVGNGAQGSAGVAGDVMGNEYSITYVEGGYAK--KMQTVHLDFGSG-PVAMTDASAGRALDHIRFRDNLYTLNKPGAYPFLLT