current user: public

If you have questions about the server, please let us know.

Query: gi|29345423|ref|NP_808926.1| hypothetical protein BT_0013 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# E-value Template Links and tools%idFirst MIQYNGITLLRDEDGTPMQVNIDLRVHGTELDAFMRAHGLTAQEQSEMLRSVTGEDISPTYVAGGKVQQHVRYLPEMKRQIQTETDRLFVSPRTRPVSVIRKEFPDLLLHRIVRVLTPIPRTKAATPKAFERYCGRDTFWVRFKMQGMMNVTWCVFFTIHDEGIVLVRHLAGAGENDEDLLast
1 0.000e+00UniRef50_A0A0J9FRY7 Uncharacterized protein n=10 Tax=Bacteroides TaxID=816 RepID=A0A0J9FRY7_9BACE  ali  78  1MIQYNGITLLRDEDGNPLQVNIDLRIHGTEMDSFMRAHGLASLEQNEMARSVTGEDVSPTYAESGKAQPHVHYLPAVKKKIQVEIDRLFASRKTKPAGVTRKEFLDLLLHRIDRALTPIPRTKAATPKAFERHCGRDTFWTRFNMQSMMNVTWCVFFTIHDEGIVLVRHLAGTGENDEDL 180
2 2.000e-77UniRef50_A0A1H7PQJ0 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1H7PQJ0_BACT4  ali  35  1MICHAGITLLTDETGPPVQVNIDLVRHGAELAAFLRAHGLVGGGSGELSGTVGGERLTCRYVSADRRLIPVVYRSQVRPLLRAAVDKALLSLHGRKSAPAAEEYAATLLTAAERHLHGARLRHKPAPEGYERY-GRDMFGLRFRLRCSSDTLWIICYTLH-HGTVVVRYIG......... 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.