current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -27.300[H] COG1977 Molybdopterin converting factor, small subunit  ali follow..  26  20TVKVLIPTPLQKFTSQATIDCEAANVGQLIEALEANCPGIKARLCDEELNFYVNEEDIRFDTALSAGDEVSIVPAVAGG 109
4 -13.800[S] COG4723 Phage-related protein, tail component  ali follow..  17  14LARICLHGDLQR----RRLSLYVNTAAEAIRALSLQVPGFRRQMNEGWYQIRIAGDDTAPEEQLGEGTVIHIVPRLAGA 97
5 -12.300[H] COG2104 Sulfur transfer protein involved in thiamine biosynthesis  ali follow..  17  6................NEQQVEVDEQTTIAALLDSLG------FGDRGIAVALNFSVLPRSCELRKPVRLEVVTAVQGG 68
6 -11.300[S] COG2914 Uncharacterized protein conserved in bacteria  ali follow..  13.VEVAYALPKKQYL----QRVTLQEGATVEEAIRASG-ELRTDIDLTENKVGIYSRPAKLSDSVHDGDRVEIYRPLI.. 85
7 -7.140[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  46................NEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVRIRPDQTPAELDMEDGDQIEAVLEQLGG 111
8 -7.030[O] KOG1769 Ubiquitin-like proteins  ali follow..  27................SVVQFKIKRHTSLSKLMKAYCERQGLSMRQIRFRFPINETDTPAQLRMEDEDTIDVFQQQTGG 92
9 -5.620[R] KOG2615 Permease of the major facilitator superfamily  ali follow..  12  66AFTSVAWGLVADRYGRKPVILIGTASVVVFNTLFGLSLNFWMAIITRFCLGSFNGLLGPIKAYAMEIFR-LIIGPAIGG 161
10 -5.580[R] KOG3135 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein  ali follow..  12  4.VAIIIYTLYGHVAATAEAEKKGIEAAGGSADIYQVEETLSPEVVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFG 81

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.