current user: public

If you have questions about the server, please let us know.

Query: ACL93485.1, from C.crescentus

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MTPYDDSPAQAVSTAPRTTGPSLIDGFGRAVTYLRVSVTDRCDLRCVYCMAEHMTFLPKAEVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLSRHLSSGALDELTLTTNGSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRVIAGIDAAQAAGMTVKINAVALKHDNAGEIPALIQWAHGRGCDITLIETMPLGEVDQDRTDQFLSLQDVRRDLSSFWTLTDIPDSTGGPARYVHVAETGGRLGLITPLSNHFCDTCNRVRLTCTGTLHTCLGRDDASDLRAEIRRGASDAELVDAIHLAIGAKPKGHDFQIAAAQPAVARHMSTTGGLast
1 -115.000[H] COG2896 Molybdenum cofactor biosynthesis enzyme  ali follow..  66  2........RNVQAQPLVSPTEPMIDPFGRAVTYLRVSVTDRCDFRCTYCMAEHMTFLPKKDLLTLEELDRLCSVFIEKGVRKLRLTGGEPLVRKNIMHLIGNLSRHLKSGALDELTLTTNGSQLARFAGELADCGVRRINVSLDTLNPEKFRTITRWGDLSRVLEGIDAAQKAGIHVKINAVALKDFNDAEIPELIRWAHGRGMDVTLIETMPMGEIEFDRTDQYLPLSQVRADLASQFTLADIPYRTGGPARYVTISETGGRLGFITPMTYNFCESCNRVRLTCTGMLYMCLGQNDDADLRKALRESESDEHLSQAIDEAISRKPKGHDFIIDREHPSVARHMSLTGG 344
2 -109.000[H] KOG2876 Molybdenum cofactor biosynthesis pathway protein  ali follow..  34  40.SQEVSRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQL---QRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFS-ISQMKNRPMILIGG 385
3 -70.200[R] COG2100 Predicted Fe-S oxidoreductase  ali follow..  17  108........................GLIDRGTNLIQVRGSTGCNMRCIFCSVDEGPYSRTRDIDYLLKWFDWVAKEKGKGLEAHLDAQGEPLLYPFIVELVQAL---REHPHVSVISMQSNGVLLDKLVEELAEAGLDRVNLSIHSLDPEKAKMLMGIKDLNHVLEMAEALVNAGIDVLIAPVIMFGVNDDEAEAFIEFARRIGAGKRFQNYIPYKFGRNPVIAKPVPFKEFYRWLRELEEKT--------GMKPLILKPHHFGMYPRPFIPLAFKGEVVKAEVILPGRIEGEMIAKARNRLIQVINSNAKVGDR---IKVKIVRTRHGI.................... 413
4 -54.100[R] COG1964 Predicted Fe-S oxidoreductases  ali follow..  13  70.ADGHGISTPITQNTTCPFSCGLCNNHKSHTALLNIVLTNRCDLACWYCFFYAAGYVYEPTIEQIREMVRKAKNMKPIGCNAVQLTGGEPTLRDDLIDIIRMIKEE----GYDHIQLNTNGIRLAEFALRVRVAGVNTVYLSFDGVDEKTNPKN-----HHEIPKILENCRRAQLGLVLVPTVIKGVNDHQLGDIIRFAAENIDIVRGVNFQPVSPRKEREQFRITIPDCIKAIEEQTNGEIGREDPVPSVVPISRFVEALTGQPQYELTTHFACG-MATYIFKDNGRLIPITRFVDVEGLFEFLNEKAEEIAKSRMKTIRAIKDIIDLRKFVDTSKAPKGFNIAKI.. 417
5 -43.900[R] COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme  ali follow..  15  34............................VRGEKLVLFVTGVCPRNCFYCPPWRRKDVVYANERPVRSEKDIIEEAKIQDARGAGITGGDPLARLSTVEYIRLLKEEFGKK---HIHLYTTGILAEEALEKLYDAGLDEIRFHPDLFQPNS-------KFFEREIENMKKAFDFGWDVGGEVPAVPG-FEDRIKWFASLLDKLGAKLNINELEFSETNLRALLDR-------YKPVSDESSAIKGSLEMGLKVLEWGEKNTSLNYHLCTAKLKDAVQLRNRLKRMAKNVARPYMEITEDGTLRFGIAEYDDLEELYEFLVEEAEVPREWLYINW................ 327
6 -39.600[R] COG5014 Predicted Fe-S oxidoreductase  ali follow..  14  44FNPVQRAMEMESLVMKGERRKYYRFRYSLYYGGIVTADTVGCKFLCAYCWNYFRNLRRAGDFLSPEEVARLLEISKKRKCDLFRISGAEPILGRRSAEHVRKVIELVNN----TFILETNGLMFGFDPSLVDLNLNVLIRVSVKGWDEESFEKITGASG-EYFRYQLKALEHLHGKVHFWVAVVYDLREKGLKELEKLPIPCRIEKEYLEMYP........................................................................................................................................ 258
7 -36.800[R] COG2516 Biotin synthase-related enzyme  ali follow..  12  23...........................RPTTAYLMTYYEGRCINDCKFCAQARSSRANLEMLWPAFELETVLKNFSKGNFKRICLTIDYPNMLSDVFSLLEELSKLNVP------ISLSITPVPRSELEEFSTLGVDYIGVGLDAASERVYKDVISRYSWDDMWKFFDDVLSVFGKGRAHLIVGLGETDKEIVETIGEVYKKGGIVSLFAFTPIKGTQMENFSPPPLERYRKIQVAHY-KTGEAELEDFEFDEFGNLIGLPKTEVPPIAYVTQGCPWCNRPYYNE................................................................ 283
8 -35.300[R] COG0535 Predicted Fe-S oxidoreductases  ali follow..  14  10................................HVDFNLTNGCNLACSHCHSASGPKLDNE--LKTEEILQTIDALHIIGALKIAFAGGEPFIRRDIFNILSHACSLPGW----GISVITNGFYLSLTVEKLKACPNLSINISVDGSTPAGYSTLRKQPLFERVLSGIDNVVRSGMSNSVNFTITK-ATLHDIEATYELVVDR--NMVAIKFFPGGYGKEHLDLYEIPYDMWDEHFVALTRAKNAGIPIEEAEEVWGYRSPLREDMYARMREVGDVAGISELCISSDGEVYPSVLLVGEKTMS----GNLREHSLQRIWQESSCLMALRELKLFDLNGNCTKCGVREVGG 354
9 -25.700[R] COG0641 Arylsulfatase regulator (Fe-S oxidoreductase)  ali follow..  14  1..............................MHITAKPTSYQCNLKCDYCYLSKENIFQHKGWMTEETLETFIERYISASGHDVYFTGGEPTMAEKAIQYQNRYKGTKKI----HNALQTNGILLDDAWCLFLRENHFLVGVSIDELHDRYRVTRSGKGSFDKVMAGIEQLKKHQVEFNTLTVINRI-NVKYPLEVYRTLKSIGAKIQFIELLETTEPNIDFSNQKSTFELIEFTVPAHFMAEVFKEWVRHDVGTLFIRQFESFVSRFIGNGHTSCVFQNNFVMESNGDIYEC-FVYPEYKIGNIYHDKLDSLASDKLSAQKEVLSES...................... 313
10 -23.900[C] COG0731 Fe-S oxidoreductases  ali follow..  14  87.................................LQMTPTLICNQRCLFCWRPTEVPVPAPGEWDSPEKIVEESIACQRKLITAISLSGEPTFYPYLPELIEEYEKRG------TTFLVTNGTV----PSMLAKVNPSQLYMSLDAPDLKTYLRVCQPALWDRINESLDIMKDKCSRTVIRTTLVKGENIFNPKGYAELIKRASVEIKAYMHLGFSRLRLDRSAMPTHEEEFSKELAKHLGYEIADESEISRVVLLSKDGKKSPVKKISCQD.............................................................................. 345
11 -22.100[O] COG1180 Pyruvate-formate lyase-activating enzyme  ali follow..  14  79......................................TYGCNWMCMYCQNYDISQRRKAEGVELSP-EEIVELAMGYDVDGMTYTYNEPAIF---SEFAHDVGIVAKRYGLF-NTMVSNGYWTPNLVDYVKDF-LDAVTIDFKGNGEQKFLRRYTATSAEPIIETASELSKKGIHVEITDLIIPQIGDDQLLTKLYDQLGADIPIHFLRFHPDYKLNYIPWTPVETLERHYKLAKELGFKFVYVGNVPG-----------------HPYENTYCPNCGNLHLTEDMRCKFC......................................................... 327
12 -19.000[H] COG0502 Biotin synthase and related enzymes  ali follow..  17  58.................................LMSIKTGGCPEDCSYCSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAARGPKPKDIEKVTEIIKAVKSLG----ETCGTFGLLQDGMAEDLKEAGLDYYNHNLDT-APEHYAEVIGTRRFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVQLVKVEGTPLADAEELDWTEFVRTI................................................................................................................... 260
13 -17.800[S] COG1856 Uncharacterized homolog of biotin synthetase  ali follow..  14  59...............................KFVDISVTGRCELMCDHC--ASKILWHMIPATTPEELVKVGEDLKKKGIEGVLISGGSDKNFVPLWDFFDAMKYLKEELGFL--LTCHVGLVDEDYVEKLKEANVDAVLLDIIGDNETIAQVYKLPHSVEDYDRSLRLLKEAGLRIVPHVIILHYGKIKGEYNAIDMIAKYEPDLVLVVVMPYYGKAKFQLLPPPSSEESAQVIL................................................................................................................. 264
14 -17.300[R] COG1313 Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins  ali follow..  13  129.........................................CNFRCVFCQNWDISQFRIGVEYLPEYMAIKIEKAFQLGARNVNFVGGEPTP-----NLPFILETLRYVRVPIPIVWNSNMYMSEEAMKLLDGV-VDIYLGDFKYGNDRCAMKYSKVPRYWEVVTRLLAKEHFRAEFLIRHLVMPNHLDCCTKPILRWIAENEIRVNVMQYRP........................................................................................................................................ 300
15 -17.300[HR] COG1060 Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes  ali follow..  16  45..........................CGDLVTFTNINYTNICLSKCRFC---AFYAREKGYVLSHEEILRKVGYAVKMGATQIMLQGGMDLGLEWFEELFRKIKARFSSVHIHSLSPPEIRSSIREVLDRLKAAGLDSLPGGGAEIDSVRRKISPNKCSSDEWLRVMETAHSLNMPTTATMMFGHVESDGDIVEHLIKIRELQEKTGGFTAF......................................................................................................................................... 241
16 -17.100[H] KOG2900 Biotin synthase  ali follow..  16  61.................................LLSIKTGGCTEDCKYCSSRYNTGVKATKLMKIDEVLEKAKIAKAKGSTRFCMGSAWRDLNGRNRTFKNILEIIKEVRSMDMEVCVTLGMLNEQQAKELKDAGLTAYNHNLDT-SREYYSKIISTRTYDERLNTIDNLRKAGLKVCSGGILGLGEKKHDRVGLIHSLATMPTHPESVPFNLL....................................................................................................................................... 242
17 -16.900[H] KOG2672 Lipoate synthase  ali follow..  12  127.....................................MGDTCTRGCRFC---SVKTSRRPGPLDPNEPENTAEAIKQWNLGYIVLTDRDDLTDLGANHIAKTIQKIKEKAPHILVEATPDFSGRMDLVEIVAKSGLDVFAHNVETVEELTPFVRDRRATYRQSLSVLKHVKKTCPHLITKTSIMLGLGEAEILTTLKDLLEHN-----VDVVTFGQYMRPTKRHLKVQEYV------------------HPKKFEYWKEVAEKLGFLYVASGPL------VRSSY................................................................ 347
18 -16.300[E] COG1509 Lysine 2,3-aminomutase  ali follow..  15  114............................RYKDKVLLLATDRCPVYCRFCTLDTQSVLKKKVSPFQSRWDTILAYLRV-VIADVVVSGGDCFRLKP-SRLLAIGMGLLSIPSIRRIRFATKGLALVNISDAGRDQG-VEISFHTHFNHPREIT--------DYTIAAAELLFKRGIRMRNQSVLMAGVNDDVMKQLVKKLSDLHIQPYYVTCDLVDGIEHMRCSVRLACQIEKAVRGITAGYNT-------PLFVVDTPGGGGKRDVHS................................................................................. 361
19 -16.200[R] COG1242 Predicted Fe-S oxidoreductase  ali follow..  12  1MKQTNPFVYSNDNKRYHTWNYCLREEFGQKTYKVALDGGFDCPNRCTFCSAAGSGDFAGNRALDLKVQFQQVRDKMQTKWKDGKCIQAFTNTHAPVAELREKFETVLNEPGVVGLSIATRPDCLPEYLAELNERTYLWLELGLQSAHDETGRLINRAHDYDCYLEGVRKLQKHNIRICTHIINLPKETPEMMMETAQKVVE--SGVDGIKIHLL---------HLLKGTPMVEDYKK----------------DLEFLTRDGYVNLVADQLEILPPEMVIHRITGDGGVDDLIGPVWSLNKFEVLNA.......................................... 297
20 -16.100[O] COG0602 Organic radical activating enzymes  ali follow..  15  20...........................GVPAIFIRLQ----CPVGCAWCILAKTKESDKWGAASSEDLLAVINRQ-GYTARHVVITGGEPCIHDLM-PLTDLLEKSG------SCQIETSGTH----EVRCTPNTWVTVSPKVNMRGGYDVLSQALERA-VRDIEALDELLATLSDDKPRVIALQPISQDATRLCIETCIARNWRL............................................................................................................................................... 212
21 -15.600[H] COG0320 Lipoate synthase  ali follow..  14  90.....................................LGAICTRRCPFCDVA----HGRPVTPDANEPEKLAQTIQDMGLRYVVITDRDDLRDGGAQHFADCISAIRAKNPTIKIETLV-RGRMDRALDILTATPPDVFNHNLENV-PRVYRQVRPGANYDWSLKLLERFKEPDIPTKSGLMVGLGETNAEIVEVMHDLRRHGVTLTLGQYLQPSRHHLPVQRYVSPAE........................................................................................................................ 283
22 -15.300[H] COG0635 Coproporphyrinogen III oxidase and related Fe-S oxidoreductases  ali follow..  12  12................................YIHIPW---CVQKCPYCQKGHIPEQDYIAHLLQDDRQRFQDSIQDRSLHSIFIGGGTPSL-EGIHTLLSGVAQCLPFQPDIEITLEANGTAEAERFKGYVQAGVTRISMGIQSFNDDKLVRLGRIHNAQEAKSAVGFAKLSGLK-SFNLDLMHGLPNQTLEEALSLQQAIALEPPHLSWPVLPDDDALWDIFEQGHQLLTEAGYVQYETSAYAKPAFQCRHNLNYWRFGDYLAICGAHGKITQPNGEIKRYSKTKHPKGYMRGDYLYEEKTVATEDLAFEFFMNRFR.............................. 323
23 -15.000[R] COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif  ali follow..  12  17...........................GRCISLLKILLTNFCIYDCAYCINRSSSNVERAR-FTAEEVVWLTLEFYRRNIEGLFLSSGII-TMEEMVRVARELRVTHGFRGYIHLKSIPEA---SPRLIEEAGLYADRLSINIELPTDSGVSRFAPEKQPANIRRSMADIRLKPAGQSTQMIVADGADDSTILSSARLYGSYGLRRVYYAFSPIPDS.................................................................................................................................... 228
24 -13.700[R] COG0820 Predicted Fe-S-cluster redox enzyme  ali follow..  16  106.................................LCVSSQVGCALECKFCSTAQQGFNRNGQVWRAAREIGLEKETGRRPITNVVMMGGEPLL--NMKNLIPALEIMLDDLGFRRVTVSTSG--VVSGLEQMIGQIDVALAISLHAPNDKEIMPINDRWNIEAFLEVVRSSNANRGKVTVEYVLLDHVNDEHAHELAELLKGTPCKINLIPFNPYPGSPYKKPSNSRIDRFQKTLMQYEHTVT-----------------------IRKTRGDDIDAACGQLV................................................................... 348
25 -11.800[KB] COG1243 Histone acetyltransferase  ali follow..  15  3......................VIRKPTRMLSGVTVSI---CHGKCVFCLMRAIENDYDPFHQVQSRLRQYVENGHTPSKVELIIMGGTFLSPSFVYLEDAQVKNEKAEVRCVGMTIETKDWAKEWHADQMLRLGATKVELGVQTVYDDILKFTNRGHTVKDSIESTRILKDSGFKVVYHVMLLPKSDDKDLEAFKTIFSDPNFRPDMLKIYPT....................................................................................................................................... 245
26 -11.700[BK] KOG2535 RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase  ali follow..  12  75...................LPKLRAKPIRTASGIAVVAINMTGNICVYCPGGPDSDFEYSTLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLPSANVAEAVRYSEKSRTKCIGITIETRPDYCKRHISDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPLPNVDERDIEQFIEYFENPAFRSDGLKIYPT---------LVIRGTGLYELWKT----------------RYKSYPPSMLVDLVAKILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALA.......................................... 391
27 -11.400[C] COG1032 Fe-S oxidoreductase  ali follow..  13  246...................................VEVMRGCGVGCDFCEVTLRPLRYM----PLNMIVDEIKINVAGGVDNAWLHKHGHFFEPNEEALSELFSTVMSVPGVKTSNPTHGRISIPAGYPEMMERNWIGIQTGLETGSEELAKKHMPNKTLDIVWQGVFVETRNYWRSAFTIQVQEGETPEDLWETIALINKVDGRPFEFTVTPLVNV.................................................................................................................................... 457
28 -11.400[J] COG0621 2-methylthioadenine synthetase  ali follow..  11  151...................................VSIMEGCSKYCSFCVVPYTRGEEFSR--PLNDVLTEIANLAQQGVKEINLLGRGEMDDGEICDFATLLRIVHEIPGIERMRFTTS--FTDSIIECYRDLPVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDLCLSSDFIVGFTEREFEQTLKLVKDIAFDLSFVIYSPRPGTPAANLPDDTPHEEKVRRLEALNEVIE.......................................................................................................... 370
29 -10.800[R] COG1244 Predicted Fe-S oxidoreductase  ali follow..  11  10..........................AGEPGKVLYVILPTICYRYCYMCSYPAQAPKKTSQERILSHFLEAVHKIKGKDDRFS-FTSGSFFDSAEVRRRIRIFREISKLDNVYEVVVETRSEIIRRELAEMVEDKWFEVAIGLESANDDIADVINKGSTFNDFVRASEIIHNAGAKVKTYLLLPIFLSERDIEDVKFSIEKAEPYTDTFSINLT....................................................................................................................................... 214
30 -10.600[R] KOG4355 Predicted Fe-S oxidoreductase  ali follow..  13  208...................................ISISTGCLNACTYCKTKHAR--GNLASYPIDELVDRAKQSFQEGVCEIWLTSED--IGTNLPTLLWKL--VEVIPEGAMLRLMTNPPYILEHLEEMAKI-YAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDIICGFTDQDFQETVKLVEEYKFPSLFIEQVPAQVKKQRTKDLSRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYE................................................................ 481
31 -10.200[C] COG1031 Uncharacterized Fe-S oxidoreductase  ali follow..  11  178...................................IEVSRGCERRCSFCTEPLLHGRLKSR--DVQAILKEIESLYRAGCRAFRFGRAANILGKPSPEILEELYSGTRAPHLEVLHTDNNPSYLVTYEKECRKI--DVFSFGVESFDENVLKKNNVQGSPEEFLKAIAVVNEIGLLPGVNLIFLPGETEETLKKNYSYLKRILDEINIRKLLAYPGTPVYEYLKNKKHRIKSYLHDQWKRRIR.......................................................................................................... 421
32 -9.490[L] COG1533 DNA repair photolyase  ali follow..  17  69...................................INPYRGCEHGCVYCFARPTAFMGLSPGLDFETKLFAKPDAARLLDKELS-TNTDPYIMREILEVLEARG---------PVGIVTKSALVTRDIDILSRMAERGVALSVTTLDRMLARTMERASTPTKRLEAIRQLSDAGIPTSVMVAIIPGLTDQEMERILDSAYAAGAREAGYVVLRLPLE.................................................................................................................................... 267
33 -9.350[T] KOG2492 CDK5 activator-binding protein  ali follow..  10  226...................................ISIMRGCDNMCTYCVVPFTRGRERSR--PIESIVEEVQRLRDQGYKQVTLLGRDMT-KSGGLTFTTLLEKVADAAPDIRFRFTSP--FPMQLIELIASR-CKQLHLPAQSGDDETLERMERGYTRDLYLRLVDDIRHVLPSVSLTSDFIAGFTEQAHQNTLSLIRAVRYSFCFV............................................................................................................................................ 434

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.