current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALAGPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGGLast
1 -56.600IDP04099 molybdenum cofactor biosynthesis protein D [Vibrio cholerae O1 biovar El Tor str. N16961] VC1027 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  1MIKVLFFAQTRELVECDSLVVDHATVEALRQHLAQQPGKWDMALEPGKLLAAVNQSIVPFDTELQDGDEVAFFPPVTGG 81
2 -12.000IDP05736 gene: thiS; putative thiamine biosynthesis protein [Clostridium difficile 630] CD1702A [Peptoclostridium difficile 630]  ali follow..  22  4................NGKEIEFEKDLTVIDLLNKYN------LKSDRVVVEVNLEIIENTYVLKDEDIVELISFIGGG 64
3 -7.380IDP06386 gene: ORF26; ORF26 [Human herpesvirus 8] YP_001129379 [Human herpesvirus 8]  ali follow..  14  29..SVLPLGDCHRLQNIQALGLGSPDYIQIMQYLSKCTLAVLEEVRPDSLRLTRMDPSDNLQIKNVSNTQLAVLPPFFS. 119
4 -6.540IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  10  61......AENMDNLEKDAPIIIKATKKSEKTTVTKETKENVFPTDFYTMSDVQINSIEKDTTGKLSENMTIKVLEY.... 129
5 -6.090IDP00950 gene: wraB; TrpR binding protein WrbA STM1119 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  4.ILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVATPQELADYDAIIFGTPTRFG 81
6 -5.790IDP06529 gene: acm; collagen-binding MSCRAMM Acm (Fms8) [Enterococcus faecium DO] AFK59905 [Enterococcus faecium DO]  ali follow..  9LSMLFIITNITSLIPVHVYADAGRDISSNVTSLTVDPTNIT-----DGGNIKVKFSFDEKKQNIQPGDYLWIWPS.... 79
7 -5.070IDP92757 hypothetical protein [Vibrio cholerae O1 biovar El Tor] AGG09404 [Vibrio cholerae O1 biovar El Tor]  ali follow..  20  11....KLAGELADLTGLSPTQLTIQLMQELQTKISKTSAQEEAKENNNNVKVLPN......................... 60
8 -4.890IDP01031 gene: yrfH; ribosome-associated heat shock protein Hsp15 STM3497 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  35.................................................KVHYNGQRSKPSKIVELNATLTL....... 57
9 -4.770IDP91404 ribosome-associated heat shock protein implicated in the recycling of the 50S subunit [Vibrio vulnificus CMCP6] VV1_0879 [Vibrio vulnificus CMCP6]  ali follow..  34.................................................KVHYNGQRAKPSKIVEVGAVLKL....... 56
10 -4.700IDP02034 hypothetical protein lmo0059 [Listeria monocytogenes EGD-e] lmo0059 [Listeria monocytogenes EGD-e]  ali follow..  14...........TNWGASKYDLRIPPIKALIINLAETLKIDYKDLSKCTIKTLLSDDDKLTNFQIADGDILEIL...... 83

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.