current user: public

If you have questions about the server, please let us know.

Query: ACL93469.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MSLTPVTLASQSSARQMILKNAGVAFEAVSPGVDEDAAKAGLLAEDVTPRDIADALAEMKAVKVSTKRPGLVIGADQTLDLKGRLIDKAGSLDEARARLLELRGTTHKLHSAVVVARDGRPIWRIVESAKLSVRPFSDAWLDRYIERRGEALLWSVGCYELESEGVQLFDKIEGDYFTILGLPLVGLLDFLRLHGALTVLast
1 -76.100sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3  ali   27  10LLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKA----SFATPYGYAMETAKQKALEVANRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCDTRVSEFYEETKVKFSELSEELLWEYVHSG--EPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYY... 213
2 -27.000sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3  ali   21  1...................................................................................................................................KFSELSEELLWEYVHSG--EPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKL..... 61
3 -8.320sp|Q9BY32|ITPA_HUMAN Inosine triphosphate pyrophosphatase OS=Homo sapiens GN=ITPA PE=1 SV=2  ali follow..  5LVGKKIVFVTGNAKKLEEVVQI-CTLVAQKIDLPEY-------------QGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNA-LGGLPGKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTS----------RIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAV-FRALLELQEYFGSL..... 192
4 -6.730sp|Q9BY07|S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens GN=SLC4A5 PE=2 SV=2  ali   12  157...................................................MTLTLKKFKFSRYFPTKVRALVASILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPALLVTILIFMDQQITAVIVNRKENKLKKAAGYHLD----LFWVGILMALCSFMGLP................ 290
5 -6.710sp|Q2M3G4|SHRM1_HUMAN Protein Shroom1 OS=Homo sapiens GN=SHROOM1 PE=1 SV=1  ali   12  2......VLRETSFQRKEL-----------MSLPARLRPTVPARPPATHPRSASLSHPGGEGEPARSRAPAPGTAGRGPLANQQR-FSEPGKLDRVGRGGGPARECLGEACSSSGLPGPE-------------PLEFQHPALAKFEDH.................................................... 121
6 -6.460sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3  ali   13  28....RVLIFSQMTKMLDLLEDFGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGLGIN----LATADTVIIFDSD---NPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIARLL................... 214
7 -6.380sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2  ali   12  62.SSDKVVLVSNYTQTLDLFEKLRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLN----LIGANRLVMFDPD---NPANDEQAMARVWRD-GQKKTCYI--------RLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKEL................................... 214
8 -6.130sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2  ali   14  18....RVLIFSQMTKMLDLLEDFGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGIN----LATADTVIIYDSD---NPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLGSMSKQELDDILKFGTEELF.............................................. 177
9 -6.080sp|Q9H4Y5|GSTO2_HUMAN Glutathione S-transferase omega-2 OS=Homo sapiens GN=GSTO2 PE=2 SV=1  ali follow..  13  24IRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP--------TKHPFGHIPVLETSQCQLIYE---SVIA-LDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEI---------------------LEYQNTTFF----GTCISMIDYLLWPWFERLDVYGIL.. 191
10 -6.020sp|Q9ULL4|PLXB3_HUMAN(removed signalp:1-41) Plexin-B3 OS=Homo sapiens GN=PLXNB3 PE=1 SV=2  ali   14  164.................................GEHCPEGERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVVGWESHLALRVRNLQHFRGLPASFHCWLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHALYVI-------------YDCAMG.................. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 1 9 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.