current user: public

If you have questions about the server, please let us know.

Query: ACL93471.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MLILGLTGSIGMGKSTTSKMFQDEGVPVYDADAAVHALYASGGAAVAPVETAFPGVVVDGAIDRAKLSAQVVGNSEALAKLEAIVHPLVGAHRIGFFEQAKAEGHEIVVLDIPLLFETGGEKRVDKVVVVSAPAEVQRERVLARPEMTPEKFEAILARQTPDADKRARADFVIDTGQGLDHARRQVRDLLTLLRTARSALast
1 -81.300sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1  ali follow..  30  1MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVMARHVVQPGYPAHRRIVEVFGTEVLNGDINRKVLGDLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKLLKYMKHTVVVYCDRDTQLARLMRRNSLNRKDAEARINAQLPLTDKARMARHVLDNSGEWSVTKRQVILLHTELERSLE. 201
2 -67.100sp|Q13057|COASY_HUMAN(removed signalp:1-23) Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4  ali follow..  28  335LYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILDGIINRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPK 535
3 -33.300sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens GN=PMVK PE=1 SV=3  ali follow..  14  10.LVLLFSGKRKSGKDFVTEALQSLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIR--WGEEKRQADPGFFCRKIVEG----------ISQPIWLVSDTRRVSDREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESEC--------DNFGDFDWVIENHGVEQRLEEQLENLIEFIRSR... 191
4 -18.700sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  16  24.FLIGVSGGTASGKSTVCEKIMELKVVILSQDRFYKVLTAEQKAKALKGQYNFDHDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTH-------SRLPETTVVYPADVVLFEILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPKKYADVIIPRGVDNMVAINLIVQHIQDILNGDIC 236
5 -18.600sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  14  21.FLIGVSGGTASGKSSVCAKIVQLQVVILSQDSFYRVLTSEQKAKALKGQFNFDHDAFDNELILKTLKEITEGKTVQIPVYDFVSH-------SRKEETVTVYPADVVLFEILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKKKYADVIIPRGADNLVAINLIVQHIQDILNGGPS 234
6 -17.300sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=ITGB1BP3 PE=1 SV=1  ali follow..  17  3.LIVGIGGMTNGGKTTLTNSLLRANCCVIHQD----DFFKPQDQIAVGEDGFKQWDVLE-SLDMEAMLDTV----------AWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKEANGVEVVYLDGM-KSREELFREVLEDIQNS... 190
7 -16.800sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2  ali follow..  16  99.FAIGLGGGSASGKTTVARMIIEAWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWK-------TLYGANVIIFEIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKMRLADIVVPRGSGNTVAIDLIVQHVHSQLEEREL 305
8 -15.900sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  16  3TFIIGISGVTNSGKTTLAKNLQKHNCSVISQDDFFKP---------------------ESEIETDKNGFLQYDVLEALEKMMSAISCWMESARHSSTDQESAEEIPILIIEFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKQDITWEVVYLDGT-KSEEDLFLQVYEDLIQE... 188
9 -15.800sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  15  3LPNILLTGTPGVGKTTLGKELASSGLKYINVGDLARE---------EQLYDGYDEEYDCPILDEDRV-----------------------------VDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGKLTDNIQCEIFQVLYEEATASYKEEIVHQPSNKPEELENNVDQILKWIEQ.... 165
10 -15.400sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  10  51.SVICVEGNIASGKTTCLEFFSNA----TDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLT-----QTYVQLTMLDRHTRPQVSSVRLMERSIHSAR---------YIFVENLYRSGKMPEVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGVIEADHHMERMLELFEQNRDRILTPENR 261
11 -13.700sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  17  7LLVMGVSG---SGKSTVGALLASLGWKFYDADDY-------PEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVAS-SALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLV-----------VHLSGSFEVISGRLLKREG------PELLQSQFETLEPAPENFIQISVDKNVSEIIATIMETLKM....... 186
12 -13.000sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  14  40..RLSIEGNIAVGKSTFVKLLTKT----------EWHVATEPVATWQNIQAAGTQKACTAQSLGNLL-DMMYREPARWSYTFQTFLSRLKVQLEPFPEKLLQARKPVQIFEAKNLFENGSLSD-HGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHLVLDVNDDFSEEVTKQEDLMREVNTFVKN 276
13 -12.900sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  23..KISIEGNIAAGKSTFVNILKQLDWEVVPEPVARWCNVQSTQDEFEELTMS--------QKNGGNVLQMMYEKPERWSFTFQTCLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLDVNEDFKDKYESLVEKVKEFLST... 259
14 -12.400sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6  ali   13  50VMMIGLPG---AGKTTWVTKHAAEKYNILGTNTI-----------------------------MDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRN-FILDQTNVSAAAQRRKMCKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKK 225
15 -12.100sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3  ali follow..  16  8TKIIFVVGGPGSGKGTQCEKIQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI----MEKGQL---------------------VPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEGQPTLLLYVDAGPETMTQRLLKRGETSVDDNEETIKKRLETYYKATEP-RKVNAEGSVDSVFSQVCTHLDALK..... 194
16 -11.700sp|O95299|NDUAA_HUMAN(removed signalp:1-20) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens GN=NDUFA10 PE=1 SV=1  ali follow..  11  38.RVITVDGNICTGKGKLAKEIAEK----LGFKHFPEAGIHYPD------STTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALETTGQGVVLESDFVFLEAMYNQ-HLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEVLQYSAREAQDSKKVVEDIEYLKF.... 258
17 -11.400sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   10  62.IRIIIVGPPKSGKTTVAKKISEYGLKHLSIGGALRYVLNNHPE--TELALMLNWHLHKGMT---------------------APDELAIQALELSLMESVCNTAGVVIDGYPVTKHEARSIIPMVIFELSVPSKEIFKRLLLEKENEQRLPYPLHNSAQIVAVNNVKYRYVIDGFHSKWWVWNEVIKNVQMVNKYMQT 259
18 -11.200sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1  ali   14  5ILMVGLPG---SGKTQWALKYAKKRYNVLGAETVLNQMRMKGL-----------------------------EEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRN-FILDQCNVYNSGQRRKLLKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKEEARK 181
19 -11.100sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3  ali follow..  14  4.LVVFVLGGPGAGKGTQCARIEKYGYTHLSAGELLRDERKNPDSQYGELIEKYEGKIVPVEITISLLKREMDQTMAANAQKNKFLFPRNQDNLQGWNKTMDGKAD------------------VSFVLFFDCNNEICIERCLERGKSSSDDNRESLEKRIQTYLQSTKP-KKIDASKSVDEVFDEVVQIFDK....... 194
20 -10.500sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2  ali   13  58...IILMGPPGAGKTTVGRIIGQLGCCVIDVDDDILE--KTWNMSVSEKLQDVGNEQF--EEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKN----------------------------GIIVYLDVPLLDLICRLKLMKT-SGTSMKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAIKRYQDVDSE 229
21 -10.100sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens GN=DTYMK PE=1 SV=4  ali follow..  13  7.ALIVLEGVDRAGKSTQSRKLVEA---LCAAGHRAELLRFPER----------------STEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVAFSGVAFTGAKENF-DLVLFLQLQLADAAKRGFGHERYENGAFQERALRCFHQLMKDTTLNWMVDASKSIEAVHEDIRVLSEDAIRTATE 204
22 -10.100sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2  ali follow..  20  5.RPVVLSGPSGAGKSTLLKRLLQFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDIEHAEFSGNLYGTS--KVAVQAVQ-----------------AMNRICVLDVDLQGVRNIKATDLRPIYISVSLHVLEQRLRQRNTETEESLVKRLAADMESSKEPGLFDVVIIND-SLDQAYAELKEALSE....... 187
23 -9.970sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   94...ICLVGPQGSGKTMCGRQLAELNIFHIQFEEVLQEKLLLKTELAIQANVKVEEENTKKQLPEVQLTEEEEVIKSSLMENEPLPPEILEVILSEWWLKEPIRSTGFILDGFPFLGDRGF--FPDAAVFIQVDDQDIFDRLLPAQIEKWKLKQKKKLERKKLIKDMKAKI-------RVDTIAKRRAE........... 300
24 -9.790sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2  ali follow..  11  378..IIFIIGGPGSGKGTQCEKLEKYGFTHLSTGELLREELASESERSKLIRDIMERG-------------------------DLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEGDPQLVICMDCSADTMTNRLLQRSRSSVDDTTKTIAKRLEAYYRASIP-HKINAEGTPEDVFLQLCTAIDSI...... 561
25 -9.650sp|Q5TBK1|N42L1_HUMAN NEDD4-binding protein 2-like 1 OS=Homo sapiens GN=N4BP2L1 PE=2 SV=1  ali follow..  12  45YLLRGLPG---SGKTTLARQLQHDRALIFSTDD-------------------------------------FFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIID-PYAVMALENNYEVIFREPDTRWKFNVQELARRNGVSREKIHRMKER......................................... 175
26 -9.600sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   12  68.IKICILGPPAVGKSSIAKELANYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIKESMGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKD-IPEFVCALDASDEFLKERVINLTHYSQDRFLRALSN......................................... 259
27 -9.550sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1  ali   19  145...LLLTGGKGSGKSTLAKAICKEAFDKLDAHVERVDCKALRGKRLENIQKTLEVAFSEAVWMQPSV--VLLDDPEHEHSPDAVQSQRLAHALNDMIKEFISMGSLVALIATPLLVSAQGVHIFQCVQHIQPPNQEQRCEILC........................................................ 300
28 -9.450sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   13  1..VILVCGSQDVGKSTFNRYLINHCVDYLECDLGQTEFTPPGCISLLNITEPV-----PFTHLRTPQKMVYYGKPSCKN------NYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLIDLIRLLSPSHVVQFRS........................................................... 136
29 -9.200sp|Q8IV42|PSTK_HUMAN L-seryl-tRNA(Sec) kinase OS=Homo sapiens GN=PSTK PE=2 SV=2  ali follow..  15  18RGLCVLCGLPAAGKSTFARALAHR-IGVVAYDDVMPDAFLAGKLLRQELLKYLEYFLMA-SVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALE.... 248

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Shiryaev SA, Ratnikov BI, Chekanov AV, Sikora S, Rozanov DV, Godzik A,Wang J, Smith JW, Huang Z, Lindberg I, Samuel MA, Diamond MS, Strongin AY. Cleavage targets and the D-arginine-based inhibitors of the West Nile virus NS3 processing proteinase. Biochem J. 2006 Jan 15;393(Pt 2):503-11.