current user: public

If you have questions about the server, please let us know.

Query: ACL93473.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MAQFQTLIVEAPESAPGVTLIRLNRPEALNALNTALLGELAQALAAAQADDSVGCIVLTGSAKAFAAGADIKEMSDKTYAQMFKADFFTAGARAIEQCRKPIIAAVAGYALGGGCELAMMCDFILAADTAKFGQPEINLGVAPGIGGTQRLTRFVGKSKAMDMILTGRMMGAEEAERSGLVSRIFPADSLVDETLAIAAKIAGQSPLAVAMNKELVEAAYETTLTTGVALERRLFHSLFAFEDQKEGMTAFVEKRKPLFKGALast
1 -97.600sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4  ali follow..  55  31.ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCY-SSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKD. 289
2 -94.300sp|Q86YB7|ECHD2_HUMAN(removed signalp:1-16) Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=2 SV=2  ali follow..  36  21............GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVGVFCAGADLKEREQMSEAEVGVVQRLRGLMNDIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAAFREKRTPKFVG. 275
3 -90.500sp|Q96DC8|ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2  ali follow..  28  42ESEPRPTSARQLD---GIRNIVLSNPKKRNALSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEQTCSKVMMHIRNHPVPVIAMVNGLAAAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH. 300
4 -89.400sp|Q13825|AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1  ali follow..  34  84............EENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVGIFCAGADLKERAKMSSSEVGPVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKG. 338
5 -85.500sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2  ali follow..  29  54..SYESLRVT--SAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGQSLVNELAFTARKMMADEALGSGLVSRVFPDEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVT. 324
6 -83.700sp|Q9NTX5|ECHD1_HUMAN Enoyl-CoA hydratase domain-containing protein 1 OS=Homo sapiens GN=ECHDC1 PE=1 SV=2  ali follow..  20  47LQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEA---IAKKGKFN.... 306
7 -79.300sp|P42126|D3D2_HUMAN(removed signalp:1-19) 3,2-trans-enoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=DCI PE=1 SV=1  ali follow..  22  24..GSQRVLVEP-DAGAGVAVMKFKNPPV-NSLSLEFLTELVISLEKLENDKSFRGVILTSDRGVFSAGLDLTEMCGRSPAHYAGWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEEK... 282
8 -77.900sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2  ali   27  35LLTRTHINYGVKG---DVAVVRINSPNSVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKGCFIAGADINMLAACKTLQEVTSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKP-PEERTIEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTI-PFVRQQVYKKVEEKVRKQTKG. 296
9 -72.400sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3  ali   31  6............RLHNALALIRLRNPP-VNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAPRTFG----LTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVN-SDPVEEAIRFAQRVSDQPLLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANK... 280
10 -68.000sp|Q8N8U2|CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens GN=CDYL2 PE=2 SV=2  ali follow..  23  248..RFRDIVVRKEE---GFTHILLSQTSDNNALTPEIMKEVRRALCNAATD-DSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRRKAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYLQDKIYEV... 506
11 -67.400sp|O75521|PECI_HUMAN Peroxisomal 3,2-trans-enoyl-CoA isomerase OS=Homo sapiens GN=PECI PE=1 SV=4  ali follow..  27  137.TGFETLVVTSED---GITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSII-TVLTGNGDYYSSGNDLTNFTDIPPGGVEEAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSK..... 393
12 -66.400sp|Q9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1  ali follow..  25  280ASTYRDIVVKKED---GFTQIVLSRSTEKNALNTEVIKEIVNALNSAAAD-DSKLVLFSAAGSVFCCGLDFGYFVKHLRNNLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF... 540
13 -66.200sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2  ali follow..  24  338AYRYRDIVVRKQD---GFTHILLSKSSENNSLNPEVMREVQSALSTAAAD-DSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF... 598
14 -66.200sp|Q9Y6F7|CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens GN=CDY2A PE=1 SV=1  ali follow..  24  283..TYRDIVVKKED---GFTQIVLSRSTEKNALNTEVIKEMVNALNSAAAD-DSKLVLFSAAGSVFCCGLDFGYFVRHLRNDLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF... 541
15 -45.300sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2  ali follow..  27  41............EKKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGKAFCAGGDIRVISEAEKAKQKIAPVFYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQG-KLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAM-ALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLKDQSPKWK.. 360
16 -32.700sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2  ali   28  1...................................................................................................................EVAISCQYRIATKDTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVL...... 198
17 -9.460sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3  ali   25  1..................................................................................................................................................................LITSGRRILADEALKLGILDKVVN-SDPVEEAIRFAQRVSDQP--AQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERK...... 127

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.