current user: public

If you have questions about the server, please let us know.

Query: ACL93476.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MIAKPLTVVPGFDVWPGLLDISAQRALVEAVLAGAEQAPFSNYRTAYGKPMSVAMTALGSLGWTSDARGYRYVDRHPETGRPWPDMPPALLDLWTVLGDPETPPDSCLVNLYRDGARMGLHQDRDEADPRFPVLSISLGDTAVFRIGGVNRKDPTRSLRLASGDVCRLLGPARLAFHGVDRILPGSSSLVPGGGRINLTLRRARTALast
1 -70.000sp|Q13686|ALKB1_HUMAN Alkylated DNA repair protein alkB homolog 1 OS=Homo sapiens GN=ALKBH1 PE=1 SV=2  ali follow..  25  91...YGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEYLKTARVNMTVRQVLAT 349
2 -55.600sp|Q6NS38|ALKB2_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1  ali follow..  18  66...........DCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTL-----SPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGDHIGEHRDDEELAPGSPIASVSFGACRDFVFRHKDRRVAVVRLPLAHGSLLMMNHPTNTHWHSLPVRKK------VLAPRVNLTFRKILLT 259
3 -52.500sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1  ali follow..  16  90...........VCLYPGFVDVKEADWILEQLCQDV---PWKQRTGIREDITYQQPRLTAWYGELP--YTYSRITMEPNP----HWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEDSVDWHSDDESLGRCPIIASLSFGATRTFEMRKKPPPEERVKIPLDHGTLLIMEGATQADWHRVPK------EYHSREPRVNLTFRTVYPD 280
4 -47.800sp|Q9BT30|ALKB7_HUMAN Probable alpha-ketoglutarate-dependent dioxygenase ABH7 OS=Homo sapiens GN=ALKBH7 PE=2 SV=1  ali follow..  17  28......RLQDAAVVRPGFLSTAEEETLSRELEP--------------------------ELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRVQAGQTLLSSVHVLDLEARGYIKPHVDSIKF-CGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFHEILRDEESFFGERRRGRRISVICRSLPEG 208
5 -47.300sp|Q3KRA9|ALKB6_HUMAN Probable alpha-ketoglutarate-dependent dioxygenase ABH6 OS=Homo sapiens GN=ALKBH6 PE=1 SV=2  ali follow..  19  18......QAPPVIYYVPDFISKEEEEYLLRQVFNAPKPK-----------WTQLSGRKLQNWG-------GLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPL--YYPTVSTISLGSHTVLDFYEPRRPEDDTSLLLEPRSLLVLRGPAYTRLHGIAAARVDALDAASRGTRVSLTIRRVPRV 229
6 -44.700sp|Q9NXW9|ALKB4_HUMAN Probable alpha-ketoglutarate-dependent dioxygenase ABH4 OS=Homo sapiens GN=ALKBH4 PE=1 SV=1  ali follow..  14  70........FPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPK----------------VNFRKQKLKTEGFCGLPSFSREVVRRMGLYPGGFRPVEQCNLDYCPEGSAIDPHLDDAWL-WGERLVSLNLLSPTVLSMCREAPGSVEVAIPLPARSLLVLTGAARHQWHAIHRRH-------IEARRVCVTFRELSAE 276
7 -43.900sp|Q96BT7|ALKB8_HUMAN Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens GN=ALKBH8 PE=1 SV=2  ali   19  132......ALPPGLMVVEEIISSEEEKMLLESV-------DWTEDTDNQNSQKSLKHRRVKHFGYE-FHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSA-FEDEIVSLSLGSEIVMDFKH--PDGIAVPVMLPRRSLLVMTGESRYLWHGITCRKFD..................... 300
8 -32.800sp|Q6P6C2|ALKB5_HUMAN Probable alpha-ketoglutarate-dependent dioxygenase ABH5 OS=Homo sapiens GN=ALKBH5 PE=1 SV=1  ali follow..  15  77QKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKVIPEGFVNSAVINDYQPGGCIVSHVDPIHI-FERPIVSVSFFSDSALCFGCKRVSEPVLSLPVRRGSVTVLSGYAADEIHCIR-------PQDIKERRAVIILRKTRLD 288
9 -31.200sp|Q96BT7|ALKB8_HUMAN Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens GN=ALKBH8 PE=1 SV=2  ali   17  3.....................LESVDWTEDTDNQNSQKSLKHRRVKHFG---------------EFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSA-FEDEIVSLSLGSEIVMDF--KHPDGIAVPVMLPRRSLLVMTGESRYLWHGITCRKFDTVQASERGLRTSFTFRKVRQT 189
10 -27.800sp|Q9C0B1|FTO_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens GN=FTO PE=1 SV=3  ali follow..  14  47.........PKLIL-ASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFFGMGMAVSWHHDENVDRSAVAVYSYSCEGPEEESEDDSHLEGPGLAIPLHQGDCYFMLDDLNATHHCVLA----------SQPRFSSTHRVAECS 327
11 -14.100sp|Q32P28|P3H1_HUMAN(removed signalp:1-22) Prolyl 3-hydroxylase 1 OS=Homo sapiens GN=LEPRE1 PE=1 SV=2  ali   13  1.............VMDGVISDHECQELQRLTNVAATSGD-HTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAESAILYLN-GGNFYFT--ELDAKTVTAEVQPQCGRAVGFSSGTENP-HGVKAVT--------RGQRCAIAL...... 202
12 -14.100sp|Q8N543|OGFD1_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1 OS=Homo sapiens GN=OGFOD1 PE=1 SV=1  ali follow..  11  64............CVIPNFIQSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILF-----------------EDFRSWLSDISKIDLESTIDMSCAKYEFTDALLCHDDELEGRRIAFILYLV-GTLDLYSIDEHFQPKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKS------RLSIS....... 234
13 -13.900sp|O00469|PLOD2_HUMAN(removed signalp:1-25) Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens GN=PLOD2 PE=1 SV=2  ali   11  90............VFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVP---------TDDIHMKQVDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQLRPHHDASTFTINIALNNVG-GGGCKF------LRYNCSIESPRKGWSFMHPGRLTH-LHEGLPVKNGT--------RYIAV....... 257
14 -13.800sp|Q9H6Z9|EGLN3_HUMAN Egl nine homolog 3 OS=Homo sapiens GN=EGLN3 PE=1 SV=1  ali follow..  12  27..........GFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRG---------QITWIGGNEEGCEAISFLLSLIDRLVLYCGYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLGGILRI---FPEGKSFIADVEPIFDRLLFFW-SDRRNPHEVQPS---------YATRYAMT....... 209
15 -13.600sp|Q6PK18|CQ101_HUMAN PKHD domain-containing transmembrane protein C17orf101 OS=Homo sapiens GN=C17orf101 PE=2 SV=2  ali follow..  108.........CGRGVTDVVITREEAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASTKPTFFSRINSTEARTAHDEYWHAHVDKVLLYLS-GGRFMF-----MEEGANKTVEPRAGRVSFFTSGSENL-HRVEKVH--------WGTRYAITI...... 303
16 -13.500sp|Q02809|PLOD1_HUMAN(removed signalp:1-18) Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens GN=PLOD1 PE=1 SV=2  ali   11  75LAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPT---------IDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQLMPHHDASTFTINIALNRVG-GGGCRF------LRYNCSIRAPRKGWTLMHPGRLTHY-HEGLPTTRGT--------RYIAV....... 254
17 -13.500sp|Q6N063|OGFD2_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 OS=Homo sapiens GN=OGFOD2 PE=2 SV=2  ali follow..  16  139............IYRVPVFTAPFCQALLEELEH--------------FEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLGCHYDNAELT-----LNVALGGALYFG-QAPTALTEPLEVEHVVGQGVLHRGGQL---HGARPL--------GTGERWNLV....... 304
18 -12.800sp|O60568|PLOD3_HUMAN(removed signalp:1-24) Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 OS=Homo sapiens GN=PLOD3 PE=1 SV=1  ali   10  82..EGIVEQPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRLAGGYENVPTVDIHMKQVGYEDQWL---------QLLRTYVGPMTESLFPGYHTKARAVMNFVVRYRPDEQLRPHHDSSTFTLNVALNHKG-GGGCRF------LRYDCVISSPRKGWALLHPGRLTHY-HEGLPTTWGT--------RYIMV....... 259
19 -12.800sp|Q96KS0|EGLN2_HUMAN Egl nine homolog 2 OS=Homo sapiens GN=EGLN2 PE=1 SV=1  ali follow..  10  190..........GICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAW---------VEGHEPGCRSIGALMAHVDAVIRHCAVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRTCIYYLN-GGLLQI---FPEGRPVVANIEPLFDRLLIFW-SDRRNPHEVKPA---------YATRYAIT....... 371
20 -12.600sp|Q8IVL5|P3H2_HUMAN(removed signalp:1-24) Prolyl 3-hydroxylase 2 OS=Homo sapiens GN=LEPREL1 PE=2 SV=1  ali   17  90........................................................................................................ALSGQQDRRNDLSHPIHADKEPPAYTFRDYSALLGGEFIFT--EMDAKTVTASIKPKCGRMISFSSGGENP-HGVKAV--------TKGKRCAVA....... 192
21 -12.000sp|Q8IVL6|P3H3_HUMAN(removed signalp:1-20) Prolyl 3-hydroxylase 3 OS=Homo sapiens GN=LEPREL2 PE=2 SV=1  ali   14  1................GLLTPAECGVLLQLAKDAAGAGA-HTPHERFEGLTVLKAAQLARAGTVGSQGAKLLLEVSERVRTLTQAYFSPERPLHLSFTHLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDSGLLYLN-GGDLFFT--EPNALTVTARVRPRCGRLVAFSSGVENP-HGVWAVT--------RGRRCALA....... 200
22 -11.300sp|Q9H6W3|NO66_HUMAN Lysine-specific demethylase NO66 OS=Homo sapiens GN=NO66 PE=1 SV=2  ali   14  1.................................................................................PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIE------AFVLQLEGRKLWRVYRPRVPEPVLQTVLEPGDLLYF----RGFIHQAECQDGVHS--------LHLTLSTYQRN 126
23 -11.000sp|O14832|PAHX_HUMAN Phytanoyl-CoA dioxygenase, peroxisomal OS=Homo sapiens GN=PHYH PE=1 SV=1  ali follow..  10  53LTLEQRKFENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTL-PEILKYVECFTGPNIM--AMHTMLINKPPDSGKKTSRHPLHEHISRNNGCLVVLPGTHKGSLKPHDYENKARVHLVMEKGDTVFFHP---LLIHG-------SGQNKTQGFRKAISCHFASAD 286
24 -10.900sp|Q5SRE7|PHYD1_HUMAN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens GN=PHYHD1 PE=1 SV=2  ali follow..  11  4LSPSQLQKQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGST-DKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAFKSITHSFKVQTLARSGGEVSPHQDAEDATLENGCLWFIPGSHTSGVSRRMVDNSLFVPTPVQRGALVLIHG---EVVHK-------SKQNLSDRSRQAYTFHLMEAS 268
25 -10.500sp|P13674|P4HA1_HUMAN(removed signalp:1-17) Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2  ali follow..  13  309AKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLRRATISNPITGDLETVHYRISKSAWL-----------------SGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGATWLFYMSDVSAGGATVSVWPKKGTAVFWGEGDYSTRHAACPVLVGN.................... 492
26 -10.500sp|O15460|P4HA2_HUMAN(removed signalp:1-21) Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens GN=P4HA2 PE=1 SV=1  ali follow..  12  306FKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWL-----------------EEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGATFLNYMSDVEAGGATVAIWPKKGTAVFWGEGDYRTRHAACPVLVGC.................... 489
27 -9.780sp|Q8IUF8|MINA_HUMAN MYC-induced nuclear antigen OS=Homo sapiens GN=MINA PE=1 SV=1  ali follow..  14  145......................................................................................DELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVE------VFILQLEGEKHWRLYHPTVPRPVHEFMLKPGDLLYF----RGTIHQADTPAGLAHS-------THVTI...... 256
28 -9.620sp|Q9GZT9|EGLN1_HUMAN Egl nine homolog 1 OS=Homo sapiens GN=EGLN1 PE=1 SV=1  ali follow..  12  206..........GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITW------IEGKEPGCETIGLLMSSMDDLIRHCNGKSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYGGILRIF---PEGKAQFADIEPKFDRLLFF--SDRRNPHEVQPAYAT---------RYAIT....... 387
29 -9.490sp|Q8NFU7|TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens GN=TET1 PE=1 SV=2  ali   15  45.........................................................................................................................SDSEHIFLDANIGGVA--------------------IAPAHGSVLI----ARRELHATTPVEH---PNRNHPTRLSLVFYQHKN. 103
30 -9.320sp|Q6N021|TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens GN=TET2 PE=1 SV=3  ali   11  48.........................................................................................................................SDSEQSFLDPDIGGVAVA--------------------PTHGSILI----AKRELHATTPLKN---PNRNHPTRISLVFYQHKS. 106
31 -9.290sp|Q5U4P2|ASPH1_HUMAN Aspartate beta-hydroxylase domain-containing protein 1 OS=Homo sapiens GN=ASPHD1 PE=1 SV=3  ali follow..  16  187.........PGLLFLPDFVPRDAQRHDVELLESSFRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQL-LLYQAGRCQPSNCRRCPGAYRALRGLRSFMSANTFG--NAGFSVLLPGARLEGRCGPTNARVRCHL-GLKIPPGCELVVGGEPQC--------AEGHCLLVDDSFL---HTV------HNGSPEDGPRVVFIVDLWHP. 372
32 -9.270sp|Q7Z4N8|P4HA3_HUMAN(removed signalp:1-19) Prolyl 4-hydroxylase subunit alpha-3 OS=Homo sapiens GN=P4HA3 PE=1 SV=1  ali follow..  10  318IRKEVIHLEPYIALYHDFVSDSEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKSA-----------------LKDTVDPKLVTLNHRIAALTGLDVRPPYAEYLQVVN-YGIGGHYEPHFDHATSPSSPLLSSVEAGGATAF-------IYANLSVPVVRNAALFWGEGDSDTLHAGCPVLVGD.................... 500
33 -9.210sp|Q6ICH7|ASPH2_HUMAN Aspartate beta-hydroxylase domain-containing protein 2 OS=Homo sapiens GN=ASPHD2 PE=2 SV=1  ali follow..  14  171.........PDLPTTP-YFSRDAQKHDVEVLERNFQTETLYKAFSNCSLPQGWKMNSTPSGEWFTF-YLVNQGVCVPRNCRKCPRTYRLLGSLRTCIG--NNVFGNACISVLSPGTVITEHYGPTNIRIRCHL-GLKTPNGCELVVGGEPQC--------AEGRCLLFDDSFL---HAAFHEGSAE-----DGPRVVFMVDLWHP. 351
34 -9.200sp|O43151|TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens GN=TET3 PE=2 SV=3  ali   15  4........................................................................................................................WSDSEHNFLDENIGGVA--------------------VAPAHGSILI----ARRELHATTPLKK---PNRCHPTRISLVFYQHKN. 63

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 1 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.