current user: public

If you have questions about the server, please let us know.

Query: ACL93481.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MSKLTHIDDQGRARMVDVSEKPATAREAVAAGFVRMSAETLALAISGSGRKGDVRAVAELAGVMAAKKTSDLIPLCHPLALSKVEVAVEPADGGLSVTARVKTTGPTGVEMEALTAASVACLTIYDMLKAAEKGMVIEAVRLLEKTGGKSGDWKADQPLast
1 -93.900sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3  ali   49  30.EQLTHVDSEGRAAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKVTSQLIPLCHHVALSHIQVQLELDSTAVKIQASCRARGPTGVEMEALTSAAVAALTLYDMCKAVSRDIVLEEIKLISKTGGQRGDFHR... 185
2 -59.500sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3  ali   50  180.EQLTHVDSEGRAAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKVTSQLIPLCHHVALSHIQVQLELDSTAVKIQASCRARGPTGVEMEALTSAAVA...................................... 300
3 -7.030sp|A8MWY0|K132L_HUMAN UPF0577 protein KIAA1324-like OS=Homo sapiens GN=KIAA1324L PE=2 SV=2  ali   20  120...................................................................ESAEACPLCTEHDFHEIEGACKRGFQETLYVETVDFWLKVGAGVGAFTAVLLVALTCYFWKK--NQKLEYKYSKLVMTTNSKECELPAAD. 228
4 -6.700sp|Q6UXG2|K1324_HUMAN(removed signalp:1-41) UPF0577 protein KIAA1324 OS=Homo sapiens GN=KIAA1324 PE=2 SV=2  ali   15  60...................................................................ESAAACPLCSVADYHAIVSSCVAGIQKTTYVKTIDFWLKVGISAGTCTAILLTVLTCYFWKK--NQKLEYKYSKLVMNATLKDCD...... 163
5 -5.820sp|Q9UFV3|YO007_HUMAN Putative uncharacterized protein DKFZp434L187 OS=Homo sapiens PE=2 SV=2  ali follow..  17  2.....................AETYRRSRQHEQLPGQRHMDLLTGYSKLIQSRLKLLLHLGSQPPVGKTFFFSCWCHPLSKTTPNVWYKFSETALSILNSCQA-SQLGVRKMPGDMSSSPRVREFSALVAIKEKIHI--LPTNAKVGSKFGS...... 132
6 -5.790sp|Q99814|EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens GN=EPAS1 PE=1 SV=3  ali   17  26......VTNRGR----TVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMD-IPLDSKTFLSRHSMDMKF------TYCDDRITELIGYHPEELLGRS-----AYEFYHALDSENMTKSHQNLCTKGAKHGGY..... 166
7 -5.730sp|Q9H6X5|CS044_HUMAN Uncharacterized protein C19orf44 OS=Homo sapiens GN=C19orf44 PE=2 SV=1  ali   57  277..............................................................................................................IEALTAYSPAVLALHDVLK............................. 295
8 -5.690sp|P31431|SDC4_HUMAN(removed signalp:1-18) Syndecan-4 OS=Homo sapiens GN=SDC4 PE=1 SV=2  ali follow..  17  109.................................................................................NKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNE........ 177
9 -5.510sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2  ali   20  191...LKAIKEMGFTNMTEIQHK------------------SIRPLLEGR----DLLAAAKTG---SGKTLAFLIPAVELI-------------------VKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIM---GGSN........ 290
10 -5.460sp|Q96RL1|UIMC1_HUMAN BRCA1-A complex subunit RAP80 OS=Homo sapiens GN=UIMC1 PE=1 SV=2  ali   30  130........................................................................IPFC-----------------------------PDGVDPNQYTKVILCQLEVYQ------KSLKMAQRQLLNKK--GFGEPVLPRP 178

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.