current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -45.300sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali follow..  26  7.VEVLYFAKSAEITGVRSETISVPKALQLWKEIETRHPGLADVR--NQIIFAVRQEYVELGLVLQPGDEIAVIPPISGG 88
2 -23.500sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 homolog OS=Homo sapiens GN=URM1 PE=1 SV=1  ali follow..  16  7.VEVEFGGGAELLFDGIKKQEEPWDIRNLLIWIKKNLLKERPELFIQGILVLINDADWE-DYQLQDQDSVLFISTLHGG 101
3 -9.460sp|O96007|MOC2B_HUMAN Molybdopterin synthase catalytic subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali follow..  12  2......................................................SSLEISSSCFSLETKLPLSPPLVED 26
5 -7.140sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1  ali follow..  32................SEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFRIADNHTPKELGMEEEDVIEVYQEQTGG 97
6 -6.920sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=1  ali follow..  28................SVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFPINETDTPAQLEMEDEDTIDVFQQQTGG 93
7 -6.890sp|Q6EEV6|SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2  ali follow..  28................SVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFPISGTDKPAQLEMEDEDTIDVFQQPTGG 93
8 -6.790sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2  ali follow..  27................SVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFPINETDTPAQLEMEDEDTIDVFQQQTGG 92
9 -6.330sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2  ali follow..  21  93LFSSTLVGCWSDVVGRRSSLLACILLSALGYLLLGAATNVFLFVLARVPAGIFKHTLSISRALLSDPLVIGHFNPVVGG 188
10 -6.310sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1  ali   16  229......FANMLGQPGSTPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGN.. 299

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.