current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -3.330PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  10  9.LEILNYAEFADEKGCVSITIGLGDIHIRAVKDGFFAEAMGHVRTQEEITLILNDNLLSKDWVTDSWEMCEVEAPKD.. 91
2 -2.910HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  12  62.....VWSAIRAKEGMGGLILEGTEAKILSDVVAQFYAYLSGCMFNDPVGMAIYAELHYMMSSLMLGE........... 124
3 -2.910HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  10  79...........ALRRREIFPMTEEGRTAVAQYLNDAYNAEPERWSAHPSIL----------------DCEPWTPPAP.. 128
5 -2.210PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8]  ali follow..  12  1.LTETQFKVQAEQQRLEAVTAQVADVEQSLEKTKAAAEKQKKKLEALQKETKAARATALTVQDIEAMGKKATF...... 72
6 -2.060PB053138 Q73Q90_TREDE/1-298 PB053138; Pfam-B_53138;  ali follow..  12  235...............................................NHAYNVLSYIYDNDNPIEDGNTIA........ 258
7 -1.940PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  16  152.......KSLSKAVRAVVESKAAKRLDDAKTNLTAKLDEASKLLADSDGKVADNA........................ 199
9 -1.760PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  19  173IMRVLTFQRLTDVYGDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFNGS........... 245
10 -1.540PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  9IASFFMVSFVITSCLDDDNNIEYSPDATIHAF---------DTAGLGSYKFTIDQL----SREIYNEDSLPVHADTI.. 74

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.