current user: public

If you have questions about the server, please let us know.

Query: ACL93470.1, from C.crescentus

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MTNAITGAAIVGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPAADRFETFVDGLRGGAVRGLNVTIPFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAIQAPGFDVTAAPVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAKGEDALPALLPEAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEAAGRRTVDGLEMLLRQAIPTFETIYGQAPSPKIDVRVLALKLLGEVLast
1 -92.8003don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  29  3...........FAVIGNPISHSLSPLMHHANFQSLNLENTYEAINVPVNQFQDIKKIISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTVL-VKDGKWIGYNTDGIGYVNGLKQI--YEGIEDAYILILGAGGASKGIANELYKIVRPTLTVANRTMSRFNNWSLNIN----KINLSHAESHLDEFDIIINTTPAGMNGNTDSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLKGEL 269
2 -91.9002egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model follow..  31  11..YFQGHMEKVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTII-NNDGRLVGYNTDGLGYVQALEEEM-NITLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDERSAYFSLAEAETRLAEYDIIINTTSVGMHPREVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALRR.. 291
3 -91.2001vi2_A mol:protein length:300 Shikimate 5-dehydrogenase 2  ali model follow..  30  1MSLDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIV-NDDGYLRGYNTDGTGHIRAIKES--GFDIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEKALAFAQRVNENTDLADQQAFAEALASADILTNGTKVGMKPNESLVNDISLLHPGLLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGAEGG. 293
4 -91.0001nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  31  3LGSMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIK-IEDGKAIGYNTDGIGARMALEEE--IGRVKDKNIVIYGAGGAARAVAFELA--KDNNIIIANRTVEKAEALAKEIAEKGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK.. 287
5 -90.7003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  35  17..NAMASQIDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQ--QVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGE-VKAQAFEQLKQSYDVIINSTSASLDGEL-PAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLEGAL 296
6 -90.7001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  34  2.........ETYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTLMRLEDGRLLGDNTDGVGLLSDLERL--SFIRPGLRILLIGAGGASRGVLLPLLSLDC-AVTITNRTVSRAEELAKLFAHTGSIQALSMDELEGHEFDLIINATSSGISGDI-PAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS... 271
7 -90.6002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  28  11..QGAMNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDATGHTTGHNTDVSGFGRGMEEG--LPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSRAQALADVINNAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLS...... 295
8 -90.1002hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  34  2....INAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVK-FENGKAYGYNTDWIGFLKSLKSL--IPEVKEKSILVLGAGGASRAVIYALVKEGA-KVFLWNRTKEKAIKLAQKFPLEV----VNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKE--TKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLR.... 268
9 -89.9004omu_A mol:protein length:283 Shikimate dehydrogenase  ali model follow..  34  2.........DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQG-SGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNA-GVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFD-ELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG. 274
10 -88.9003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  33  2........SDRYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSEGGKGMNITAPFKLRAFELADRRSERAQLARAANALKF-EDGRIVAENFDGIGLLRDIEENL-GEPLRNRRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNELDHS-RLRISRYEALEGQSFDIVVNATSASLTADL-PPLPADVLGEAALAYELAYGKGLTPFLRLAREQGARLADGVGMLVEQAAEAFAWWRGVRPDTRAVINQLTIPL.... 271
11 -88.6001p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  33  2.........DLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRL--NWLRPNQHVLILGAGGATKGVLLPLLQAQ-QNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGLSGGT-ASVDAEILKLGSAFYDMQYKGTDTPFIALCKSLGLTNVDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML... 272
12 -88.4003tnl_A mol:protein length:315 Shikimate dehydrogenase  ali model follow..  30  23ITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVV-NDDGVLTGHITDGTGYMRALKEA--GHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKLFDIEDHEQLRKEIAESVIFTNATGVGMKPGETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF....... 309
13 -88.0001wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  35  2.........LRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRR-AFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVL-QVEGRLFGFNTDAPGFLEALKAGGIPL---KGPALVLGAGGAGRAVAFALREAGL-EVWVWNRTPQRALALAEEFGLRAVPL------EKAREARLLVNATRVGLEDPSASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRAL.... 261
14 -87.9003fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogenase fusion protein  ali model follow..  25  1....MSLNTSIYGLIGEKLGHSHSSYIHKLIFEKVGIKGIYNLFEVPKEKLKESVDTFKIIKCGGLNVTIPYKVEVMKELYEISEKARKIGAVNTLK-FSREGISGFNTDYIGFGKMLSKF--RVEIKNNICVVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTSEIYGEFKV------ISYDELSNLKGDVIINCTPKGMYPKGESPVDKEVVAKFSSAVDLIYNPVETLFLKYARESGVKAVNGLYMLVSQAAASEEIWNDISIDEIIVDEIFEVLEEK.. 271
15 -87.5003t4e_A mol:protein length:312 Quinate/shikimate dehydrogenase  ali model follow..  31  20...DVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIV-NDDGYLRGYNTDGTGHIRAIKES--GFDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKFEKAVAFAKRVNENTDLADQHAFTEALASADILTNGTKVGMKPNESLIGDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGFT..... 305
16 -86.9004k28_A mol:protein length:269 Shikimate dehydrogenase family protein  ali model follow..  27  2....IRGSTELVAIVGSPIAQVKSPQNFNTWFNHNNCNLAMLPIDLHEAALDSFADTLRGWNLRGCVVTVPYKQALANRVDGLSERAAALGSINVIRRERDGRLLGDNVDGAGFLGAAHKH--GFEPAGKRALVIGCGGVGSAIAYALAEAGIASITLCDPSTARMGAVCELLGNGFPGLTVSTQFSGLEDFDLVANASPVGMGTRAELPLSLATLQPDTLVADVVTSPEITPLLNRARQVGCRIQTGPEMAFAQLG-HLGAFMGVTPL................ 267
17 -85.7005dzs_A mol:protein length:276 Shikimate dehydrogenase (NADP(+))  ali model follow..  26  2.........NFFGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTIL-LRENMLYGYNTDYFGLDSMFKMA--NIDVQGKVAVILGTGGASKAALTYFIDSGIEKLYVSTRKKDDKKLLNSKAIL------IDYEELKHIKGDIILNATPVGMYPNGISPVSKSIIQNFDILIDLIYNPGETEFLRIGNSMGKKTCDGLYMLVGQAIKSQEIWQDTKIDNSILDVIYNELKLE.. 267
18 -84.8001npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like protein HI0607  ali model follow..  27  2....INKDTQLMSLSGRP--SNFGTTFHNYLYDKLGLNFIYKAFTT--QDIEHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPSAQAIESVNTIV-NDNGFLRAYNTDYIAIVKLIEK---YHLNKNAKVIVHGSGGMAKAVVAAFKNSGFEKLKIYARNVKTGQYLAALYGYAYIN------SLENQQADILVNVTSIGMKGGKELAFPKAFIDNASVAFDVVAMPVETPFIRYAQARGKQTISGAAVIVLQAVEQFELYTHQRPSDELIAEAAAFARTK.. 270
19 -84.2004xij_A mol:protein length:275 Shikimate 5-dehydrogenase  ali model follow..  31  2...AMVPDSRKAAVLGSPITHSRSPQLHLAAYRALGLPWTYERIECTAEQLPGLVSALGP-EWVGLSVTMPGKFAALEFADQRTDRAQLVGSANTLVRMPTGGWRADNTDVDGVTGALGT-------AGDSALVIGSGGTAPAAVVALAELGVQRITIVARDEGKASRLVDLARRGWCDIGGAALADAVASADAAVSTIPADAAA-----VYADALARVPRVLDAIYDPWPTPLAQAVEAAGGEAINGLQMLLNQAFAQVEQFTGMPAPKEAMRAAL........ 268
20 -83.9004p4g_A mol:protein length:277 Shikimate 5-dehydrogenase AroE (5-dehydroshikimate reductase)  ali model follow..  30  1....MSEGPKKAGVLGSPIAHSRSPQLHLAAYRALGLDWTYERIECGAAELPVVVGGFGP-EWVGVSVTMPGKFAALRFADERTARADLVGSANTLV-RTPHGWRADNTDIDGVAGALGA-------AAGHALVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTRRFCAFDSGGLADAVAAAEVLVSTIPAEVAAGYA-----GTLAAIPVLLDAIYDPWPTPLAAAVGSAGGRVISGLQMLLHQAFAQVEQFTGLPAPREAMTCALAALDLD.. 271
21 -82.9004foo_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  27  2.......KLKSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPLPLESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLV-LENDELVGYNTDALGFYLSLK------QKNYQNALILGAGGSAKALACELKKQGL-QVSVLNRSSRGLDFFQRLGCDCFM-------EPPKSAFDLIINATSASLHNELPKEVLKGYFKEGKLAYDLAYGF-LTPFLSLAKELKTPFQDGKDMLIYKAALSFEKFSASQIPYSKAFEVMRSVFLE.. 265
22 -82.3004fsh_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  27  2.......KLKSFGVFGNPIKHSKSPLIHNACFKKLGFLGHYRPILLPLES--HIKNEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECASINTLV-LENDELVGYNTDALGFYLSLK------HQNYQNALILGSGGSAKALACGLKKQGL-KVSVLNRSPRGLDFFQRLGCDCFM-------EPPKSAFDLIINATSASLNNELPKEVLKGYFKEAKLAYDLAYGF-LTPFLALAKELKIPFQDGKDMLIYQASLSFEKFSASQIPYSKAFEVMRSVFLE.. 265
23 -80.9003u62_A mol:protein length:253 Shikimate dehydrogenase  ali model follow..  28  3...........FCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILE-EYDGFNATIPHKERVMRYVEPSED-AQRIKAVNCVF-----RGKGYNTDWVGVVKSLEG-----VEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVK----IFSLDQLDEVVKKAKSLFNTTSVGMKGEE-LPVSDDSLKNLSLVYDVIYFD--TPLVVKARKLGVKIIKGNLMFYYQAMENLKIWGIYDEEVEVFGEVLK....... 253
24 -74.8002gpt_A mol:protein length:523 3-dehydroquinate dehydratase/ shikimate 5-dehydrogenase  ali model follow..  29  228..RRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLV--DNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRKSDGKLLGYNTDCIGSISAIEDGSSSSPLASKTVVVIGAGGAGKALAYGAKEKGA-KVVIANRTYERALELAEAIGGKALSLT-DLDNYHPEDGMVLANTTSMGMQPNEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKYGSRE. 518
25 -71.0005swv_C mol:protein length:531 Pentafunctional AROM polypeptide  ali model follow..  25  243RVLIGEILPEKFFLFGKPIKHSRSPILHSTAYELLGLPHTYEAFET--DTVDEVQKVLNLPDFGGANVTIPYKLSVMKFMDELSDEARFFGAVNTIIPGDKLVLRGDNTDWRGIYDTFANALDGVSLRDTNGLVIGAGGTSRAAIYSLHRLGVSRIYLLNRTLANSYRVQDVFPPDIDSDNIPSEELSSVTLSAVVSTIPADIELPEKIKALLANKADGGVFLDMAYKPLHTPLMAVASDLEWKCCNGLEALVRQGLASFHLWTGMTAPFDAVYQKVIE...... 531
26 -36.1004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  10  7.PDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPGNFSASLHAI--TQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDRAHNLKNGKMANNQPGIIYAEIASRY---LKADSKDVLVVGLGKVGFPGAEHLVQKDF-RVYGYDADETLLERATSNLGI------IPFDPANPKKFSIIFEATPCAN------TIPEAVLSENCVLSTPGI-PCAISEELRDKYEVQLIAEGTASMLYSVL............................ 260
27 -16.8003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  15  18.............................................................................................................................KNGGNKILLVGNGMLASEIAPYFSYPQY-KVTVAGRNIDHVRAFAEKYEYE--YVLINDIDSLIKNNDVIITATS-----SKTPIVEERSLMPGKLFIDL............................................................ 109
28 -14.8003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  19  4...............................................................................................................................MRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRM-TKQVDAKDEAGLAKALGGFDAVISAAPFFLT----PIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS........................................... 116
29 -14.8005l76_A mol:protein length:497 Alpha-aminoadipic semialdehyde synthase, mitochondrial  ali model follow..  16  8...........................................................................................LGTENLYFQSMALPDKYKYIQTLRESRERAQSLSMGTRRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINDICKQEEKLGFLVAKQDLVISLLPYVLH----PLVAKACITNKVNMVTASYITPALKELKSVEDAGITIIGELGMLAMESIDKAK........................ 185
30 -14.2004n7r_A mol:protein length:472 Glutamyl-tRNA reductase 1, chloroplastic  ali model follow..  12  74......NRMEIYVLALSQ--HRGVKEVTEWMSKTSGIPVSEICQHRFLLYNKDATQHIFEVS-AGLDSLVLGEGQILAQVKQVVKVGQGVNGFGRNISGTVGKRVRTETNSSAAVELALMKLPQSSNVSARMCVIGAGKMGKLVIKHLMAKGCTKVVVVNRSEERVSAIREEMPGIIIYRPLDEMLACASEADVVFTSTAFLKEHVENLPQASPEVGGLRHFVDIVYN---KEVVAANKEDRMRKAMEAQTIITEESTQFEAWRETVPTIKKLRAYAERIRVAEL 390
31 -13.4001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  18  49......NRVEVYASGARDRAEELGDLIHDDAWVKRGSEAVRHLFRVA----------------SGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKINLGKRAREETRISEGAVSIGSAAVELSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGE--AVRFDELVDHLARSDVVVSATAA--VDDVREALRKRDRRSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLER.......................... 299
32 -13.1002axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  20  14.................................................................................................................................KNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKAISLDVSALDKVLADNDVVISLIPYTFH----PNVVKSAIRTKTDVVTSSYISPALRELPEIVKAGITVMNEIGLYAVKTIDEVH........................ 152
33 -12.5001e5l_A mol:protein length:450 SACCHAROPINE REDUCTASE  ali model follow..  17  1..............................................................................................................................MATKSVLMLGSGFVTRPTLDVLTDSG-IKVTVACRTLESAKKLSAGVQHSLDVNDDAALDAEVAKHDLVISLIPYTFH----ATVIKSAIRQKKHVVTTSYVSPAMMELQAAKDAGITVMNEIGLYAIKTIEEVH........................ 142
34 -11.9003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  20  9...............................................................................................................................RHMKVLILGAGNIGRAIAWDLKDE--FDVYIGDVNNENLEKVKEFATPKVDASNFDKLVEVMKEFELVIGALP----GFLGFKSIKAAIKSKVDMVDVSFMPENPLELDEAEKAQVTIVFDAGILMGRIFQELD........................ 145
35 -10.4003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  21  147........................................................................................................................QHTDFTIHGANVAVLGLGRVGMSVARKFAALGA-KVKVGARESDLLARIAEM----MEPFHISKAAQELRDVDVCINTIPALVVTANV----LAEMPSHTFVIDLASKPGGTD--RYAEKRGIKALLVPGL.................................. 268
36 -10.3002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  18  149........................................................................................................................QHTDYTIHGSQVAVLGLGRTGMTIARTFAALGA-NVKVGARSSAHLARITEM----LVPFHTDELKEHVKDIDICINTIPSMILNQTV----LSSMTPKTLILDLASRPGGTD--KYAEKQGIKALLAPGL.................................. 270
37 -10.2001lu9_A mol:protein length:287 Methylene Tetrahydromethanopterin Dehydrogenase  ali model follow..  16  4..................LLFQFDTDATPSVFDDGGADHITGYGNVTPDNVGAYVDGTTAIFVGGGDMA-----AGERVFEAVKKRFFGPFRVSCML-------NGSNTTAAAGVALVVKAA-GGSVKGKKAVVLAGGPVGMRSAALLAGEGA-EVVLCGRKLDKAQAAADSVNKRAETADDASRAEAVKGAHFVFTAGAIGLE................................................................................. 201
38 -10.2004ina_A mol:protein length:405 saccharopine dehydrogenase  ali model follow..  18  2.................................................................................................................................AKVLQIGAGGVGGVVAHKMAMNRFSHITLASRTLSKCQEIAQSIKATVDADSIEELVALINEVKPQIVLN--IALPYQDLTIMEACLRTGVPYLDTFEYKEQWAFHDRYKEKGVMALLGSGVFCAYAQKHYF........................ 159
39 -10.2002i99_A mol:protein length:312 Mu-crystallin homolog  ali model follow..  17  88.....................................................................VPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLK------------PPSSEVLCILGAGVQAYSHYEIFTEFSFKEVRIWNRTKENAEKFADTVQGEVRVC--SSVQEAVAGADVIITVTLVGASRPDWRELDDELMKEAVLYVD............................................................. 248
40 -10.1004rl6_A mol:protein length:427 Saccharopine dehydrogenase  ali model follow..  13  2.................................................................................................................................SRLLVIGCGGVAQVAISKICQDSFTEIMIASRTKSKCDDLKAKLEGALDADKVEEVIALIGSYKPEAVLN--VALPYQDLTIMDACLATGVHYIDTFDYSWQWAYQEKFKEAGLTALLGSGVFSAYALKHYF........................ 178
41 -10.0004bv8_A mol:protein length:335 THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE  ali model follow..  15  104.....................................................................VPSHQASVLLFDPSNGSLLAVMDGNVITAKRTAAVSAIATKLLK------------PPGSDVLCILGAGVQAYSHYEIFTEFSFKEVRMWNRTRENAEKFASTVQGDVRVC--SSVQEAVTGADVIITVTMVGASRPDWRELDDELMRQAVLYVDSREAALKES--KPAHCEKTTVFKSLGMAVEDLVAAKLVY...................... 322
42 -9.6405gzi_B mol:protein length:359 Lysine cyclodeaminase  ali model follow..  18  95.....................................................................LPTILGTVARYDDTTGALTALMDGVLLTALRTGAASAVASRLLA------------RPDSHTLGLIGTGAQAVTQLHALSLLPLQRALVWDTDPAHRESFARRAAFTGVSVEIAEPARIAAEADVISTATSVGADLVGKTELPLGLLERAFVTAD............................................................. 260
43 -9.0305jo9_A mol:protein length:242 Ribitol 2-dehydrogenase  ali model follow..  14  4.............................................................................................................................ELEGKVAAVTGAAGIGLASAEAMLAAGA-RVVMVDRDEAALKALCNKHGDTVIPLVVDRVLEKACQLDILHANAGTYVGGDLVDADTMAIDRMLNLNVNVVMKNVHDVLPHMIERRTGDIIVTSSLAAHFPTPWEPVYASSKWAINCFVQTVRRQVFKH. 174
44 -9.0104gmf_A mol:protein length:372 Yersiniabactin biosynthetic protein YbtU  ali model follow..  17  9..................................................................................................................................RVLIVGAKGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPL----YTSPEQITGMPDIACIVVRSTVAGGAGTQLARHFLARGVHV--IQEHPLHPSLQTLAQEQGCCYWINTFYPHTRAGRTW......................... 137
45 -9.0004gmg_A mol:protein length:385 Yersiniabactin biosynthetic protein YbtU  ali model follow..  17  23..................................................................................................................................RVLIVGAKGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPL----YTSPEQITGMPDIACIVVRSTVAGGAGTQLARHFLARGVHV--IQEHPLHPSLQTLAQEQGCCYWINTFYPHTRAGRTW......................... 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.