current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALAGPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGGLast
1 -56.3001nvi_D mol:protein length:81 Molybdopterin converting factor subunit 1  ali model follow..  30  1MVKVLFFAQVRELVGTDATEVAADTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG 81
2 -56.2001fm0_D mol:protein length:81 MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1  ali model follow..  30  1MIKVLFFAQVRELVGTDATEVAADTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG 81
3 -48.2002q5w_D mol:protein length:77 Molybdopterin converting factor, subunit 1  ali model follow..  24  1.MKVLYFAEIKDILQKAQEDIVLETVQQFEDLLFERYPQ----INNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG 77
4 -46.6001vjk_A mol:protein length:98 molybdopterin converting factor, subunit 1  ali model follow..  29  6.VKVKYFARFRQLAGVDEEEIELPRVRDLIEEIKKRHEKFKEEVFGEDVNIAVNGRYVSWDEELKDGDVVGVFPPVSGG 92
5 -44.4005mpo_A mol:protein length:106 Molybdopterin synthase sulfur carrier subunit  ali model follow..  27  18MVEVLYFAKSAEITGVRSETISVPKALQLWKEIETRHPGLADVR--NQIIFAVRQEYVELGLVLQPGDEIAVIPPISGG 100
6 -43.5004hro_A mol:protein length:90 Small archaeal modifier protein 1  ali model follow..  28  4.MEWKLFADLAEVAGSRTVRVDVDTVGDALDALVGAHPALESRVFGDDINVLRNGEAAALGEATAAGDELALFPPVSGG 90
7 -43.5003po0_A mol:protein length:89 Small archaeal modifier protein 1  ali model follow..  28  3.MEWKLFADLAEVAGSRTVRVDVDTVGDALDALVGAHPALESRVFGDDINVLRNGEAAALGEATAAGDELALFPPVSGG 89
8 -43.1002l83_A mol:protein length:95 Small archaeal modifier protein 1  ali model follow..  28  1.MEWKLFADLAEVAGSRTVRVDVDTVGDALDALVGAHPALESRVFGDDINVLRNGEAAALGEATAAGDELALFPPVSGG 87
9 -37.6003rpf_C mol:protein length:74 Molybdopterin converting factor, subunit 1 (MoaD)  ali model follow..  26  2MVEVRFFGPIKEENF----FIKANDLKELRAILQEKEGLKEWL---GVCAIALNDHLIDNNTPLKDGDVISLLPPVCGG 74
10 -37.0002l52_A mol:protein length:99 METHANOSARCINA ACETIVORANS SAMP1 HOMOLOG  ali model follow..  28  6.VKVKLFANLREAAGTPELPLSGEKVIDVLLSLTDKYPALKYVIFEKGINILINGNNIRHETLLKDSDEIGILPPVSGG 99
11 -37.0004wwm_A mol:protein length:91 Uncharacterized protein  ali model follow..  18  1MPKVILKGPLISQFNFREIYVNDRELLRVLVKIDSKKHLIESNQLKSGILILINGKDWRRNQLLNDNDIIEIIPINHGG 83
12 -35.2002m19_A mol:protein length:106 Molybdopterin converting factor subunit 1  ali model follow..  21  17.LELRFFATFREVVGQKSIYWRVDTVGDVLRSLEAEYDGLAGRLIEDGVNVLKNGREVVHATALDDGDAVSVFPPVAGG 106
13 -32.5002g1e_A mol:protein length:90 hypothetical protein Ta0895  ali model follow..  17  1MVTVRYYATLRPITKKKEETFN-SKISELLERLKVEYGSEFTKQMYDGVIILVNGNNITSDTEIKDDDKIDLFPPVAGG 90
14 -29.1001v8c_A mol:protein length:168 MoaD related protein  ali model follow..  28  2..KVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEVSVFLEGRDVRYSTPLSPGATLDLFPPVAGG 87
15 -28.8004n6e_B mol:protein length:90 ThiS/MoaD family protein  ali model follow..  20  3.VTVSIPTILRTHTGEKSVEAKGATVLEIIDDVESRHAGIKARLVKEEINVYVNDEDVRFEAEVKDGDTLTILPAVAGG 90
16 -28.1003dwg_C mol:protein length:93 9.5 kDa culture filtrate antigen cfp10A  ali model follow..  23  3.VTVSIPTILRPHTGQKSVSASGDTLGAVISDLEANYSGISERLMDPSVNIYVNDEDVRFATAIADGDSVTILPAVAGG 93
17 -26.1001rws_A mol:protein length:77 hypothetical protein PF1061  ali model follow..  23  5MIKVKVIGRNIEK------EIEWREGMKVRDILRAVG------FNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG 71
18 -25.7005lda_B mol:protein length:69 SAMP2  ali model follow..  23  3MIKVKVIGRNIEK------EIEWREGMKVRDILRAVG------FNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG 69
19 -25.0002k9x_A mol:protein length:110 Uncharacterized protein  ali model follow..  19  7.ITVQFAGGCELLFAKQTSL-TGTNLNGLVQLLKTNYVKERPDLLRPGILVLVNSCDAEMDYVLNDGDTVEFISTLHGG 102
20 -24.5002ax5_A mol:protein length:107 Hypothetical 11.0 kDa protein in FAA3-MAS3 intergenic region  ali model follow..  15  4.VKVEFLGGLDAIFGKQRVH-DPVTVGDLIDHIVSTMINNPNDVSRPGIITLINDTDWELDYILEDGDIISFTSTLHGG 99
21 -23.0001wgk_A mol:protein length:114 RIKEN cDNA 2900073H19 protein  ali model follow..  15  14.VKVEFGGGAELLFDGVKKQEEPWDIRNLLVWIKKNLLKERPELFIQGILVLINDADWE-DYQLQDQDSILFISTLHGG 108
22 -20.4001ryj_A mol:protein length:70 unknown  ali model follow..  13  6........KFTVITDDGKKILESGAPRRIKDVLGELE------IPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG 70
23 -19.0002l32_A mol:protein length:74 Small archaeal modifier protein 2  ali model follow..  24  6...........EVVGEETSEVAVDDDGTYADLVRAVD------LSPHEVTVLVDGRPVPEDQSV-EVDRVKVLRLIKGG 66
24 -17.9004idi_A mol:protein length:144 Oryza sativa Rurm1-related  ali model follow..  17  52.....LIAFIRDNIIEKKFVFSDYDIVSADEKLCKVMVDNKEYSNKPGIIVLVNEYLGTYSYQIKNDDKICFLSTLHGG 138
25 -16.6004hrs_A mol:protein length:67 Small archaeal modifier protein 2  ali model follow..  25  10..............GEETSEVAVDDDGTYADLVRAVD------LSPHEVTVLVDGRPVPEDQSV-EVDRVKVLRLIKGG 67
26 -15.1005gha_E mol:protein length:85 Sulfur Carrier TtuB  ali model follow..  18  19............LRLPERKEVEVKGNRPLREVLEELG------LNPETVVAVRGEELLTLEDEVREEDTLEVLSAISG. 78
27 -14.2002lek_A mol:protein length:73 Putative thiamin biosynthesis ThiS  ali model follow..  23  1.........MLVTINGEQREVQSASVAALMTELD---------CTDGHYAVALNYDVVPDETPVTAGDEIEILTPRQGG 65
28 -13.5002k5p_A mol:protein length:78 thiamine-biosynthesis protein  ali model follow..  15  1.........MNLTVNGKPSTVDGAESLNVTELLSAL-----KVAQAEYVTVELNGEVLEDATTVKDGDAVEFLYFMGGG 69
29 -13.5002cu3_A mol:protein length:64 unknown function protein  ali model follow..  17  3............WLNGEPRPLEGKTLKEVLEEMG---------VELKGVAVLLNEEAFLPDRPLRDGDVVEVVALMQGG 64
30 -13.4001f0z_A mol:protein length:66 THIS PROTEIN  ali model follow..  18  6................NDQAMQCAAGQTVHELLEQLD------QRQAGAALAINQQIVPAQHIVQDGDQILLFQVIAGG 66
31 -13.3002hj1_A mol:protein length:97 Hypothetical protein  ali model follow..  9.IEIAYAFPERYYL----KSFQVDEGITVQTAITQSGLSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLL.. 81
32 -11.4001tyg_B mol:protein length:87 yjbS  ali model follow..  21  21.................KWKKDTGTIQDLLASYQ---------LENKIVIVERNKEIIGHEVELCDRDVIEIVHFVGGG 77

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.