current user: public |
|
Query: ACL93474.1, from C.crescentus |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . | |||||||
# | Score | Template | Links and tools | %id | First | MKVRPMANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEDAIAKGDVAVAKAAFVEAQSELMRAVSKGVVHPNTGSRKVSRLAARLKKLDKAAA | Last |
1 | -47.400 | PF01649.18; D9T9K3_MICAI/2-84; Ribosomal protein S20 | ali follow.. | 34 | 1 | ......ANIKSQIKRNRQNEKRRLRNKSVKSSLKTAIRKFHEAAEAGDTEKATVLMREATRKLDKAASKGVIHSNQAANRKSAIAKRV........ | 82 |
2 | -6.910 | PF02091.15; SYGA_PELCD/3-280; Glycyl-tRNA synthetase alpha subunit | ali follow.. | 7 | 207 | ............................LFNLFDMYEKECSRLAKSQLVLPAYDYVLKASHAFNLLDARGAISVTERAHYIGRVRNLARLCAE... | 271 |
3 | -6.370 | PF10925.8; D5XEL2_THEPJ/40-96; Protein of unknown function (DUF2680 topsan) | ali follow.. | 7 | 14 | ....................................................DKMLELRKELLQKYVDMGKITKEDADARIQWMEQNHNARIE... | 54 |
4 | -6.320 | PF10938.8; E6X1K7_NITSE/69-208; YfdX protein | ali follow.. | 9 | 5 | ....................................TQQTLVQLSQNKKDEAIKSLEKAIGKMEVVLSH........................... | 37 |
5 | -6.240 | PF04010.13; Q12XB6_METBU/11-83; Protein of unknown function (DUF357 topsan) | ali follow.. | 13 | 3 | .....ERLLSEALAKADISPIENSHMRTVAEDYKNMARSYYE-IRSEDPVNALICFSYGHAWLDAGARLGVF........................ | 73 |
6 | -6.220 | PF16148.5; F0RFZ5_CELLC/37-396; Domain of unknown function (DUF4856 topsan) | ali follow.. | 13 | 235 | ..............................NDIYEAFKLGRAAIVAKDYELRDEQAQIIREKVSKVVAVRSVYQSGKEVLESDKASAFHSLSEALG | 302 |
7 | -5.970 | PF18071.1; J3D3B1_9BURK/5-145; HMW1C N-terminal | ali follow.. | 15 | 4 | ....................................LENFEYLCYSRQQEPAARELVKLLLLIDRSLSAAIGAQERDAHGLTRITSAISALFSDPS | 74 |
8 | -5.650 | PF01217.20; COPZ1_BOVIN/12-153; Clathrin adaptor complex small chain | ali follow.. | 16 | 79 | ................................LMTVLNCLFDSLSQ-EKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDV..... | 142 |
9 | -5.450 | PF08332.10; F8WHB5_MOUSE/57-184; Calcium/calmodulin dependent protein kinase II association domain | ali follow.. | 11 | 2 | .............................KQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFE................................ | 36 |
10 | -5.440 | PF00838.17; I1CDG2_RHIO9/1-163; Translationally controlled tumour protein | ali follow.. | 9 | 80 | .........................KKSYMTYIKGYMKALKKELQETKPDRVEAFEKGAASLVKRILTN........................... | 123 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13. |