current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALAGPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGGLast
1 -27.300PF14451.6; Q63PX0_BURPS/1-81; Mut7-C ubiquitin  ali follow..  14  4.VTFRFYEELNDFLARPLRRREFASVKHAIEALGVPHTEVE--------LILVNGESTPFSHVLEEGDRVAVYPSFEAI 80
2 -23.900PF02597.20; Y552_ARCFU/5-88; ThiS family  ali follow..  26  1...VRLPASINQ--GDLEIDAEKLTVNQLIALLSQITGKDLEKILKRDISIFVNGRNVRYETEVRSGDEVSIVPTVAGG 84
3 -23.700PF09138.11; URM1_DICDI/2-96; Urm1 (Ubiquitin related modifier)  ali follow..  12  2.VKIELSGGLELLFDKKKVH-NEIPLKDLILYMRDNLLKERSELFVVDILVLINDADWELSYNVEDKDTIIFISTLHGG 95
4 -10.600PF03658.14; I3Y587_THIV6/1-81; RnfH family Ubiquitin  ali follow..  15  3.VSIVYALAKRQIW----LNIEVPEGATLREAVERSG-AQCPEIDLDQQKVGVFGKVSALETKLADGDRVEIYRPLI.. 75
5 -8.410PF02824.21; Q9VDV2_DROME/289-362; TGS domain  ali follow..  1...IRVYTKKPGAPPDFDDGLILRKGVSVEHVCHAIHRTLAAQFKYALVSTKYSPQRVGIAHVMADEDVIQVV...... 73
6 -7.120PF01802.17; TRX2_PSHV1/10-313; Herpesvirus VP23 like capsid protein  ali follow..  17  24..TILMAPSLRRCLFLHDVDRNSPDYATSLAAYRRRFPLLVTAVGRQELSAVSLSIGCPKGLNFRNGSNVSLIPPIGG. 114
7 -6.290PF14453.6; A6LR54_CLOB8/1-57; ThiS-like ubiquitin  ali follow..  20......................................EVRSRIKSDADIVILNGFPIKQDYSLNEGDKVTLI...... 54
8 -5.660PF14950.6; SPIDR_HUMAN/11-369; Domain of unknown function (DUF4502 topsan)  ali follow..  23  326............................................PGAGLKVLFTKETAG-YLRGRPQDTVRIFPP.... 355
9 -5.540PF08953.11; G3PZB3_GASAC/5-70; Domain of unknown function (DUF1899 topsan)  ali follow..  13  37..................................................CAVNPRFLAVITECGGGGAFLVLSINHTG 65
10 -5.430PF01479.25; Q9WY66_THEMA/1-46; S4 domain  ali follow..  17  7............................LKISVVKRRTIAQKLLKGQRVL--VNGRPAKASYEVKDGDIV......... 46

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.