|
current user: public |
|
Query: ACL93487.1, from C.crescentus |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 | |||||||
# | Score | Template | Links and tools | %id | First | MKAGPDAEADALGDEEDIAMFVQALAGVNMDYRRVLSLLIPRLAALEERGDTAGAVRLIQEIQAIINAPERPEH | Last |
1 | -7.150 | PF06134.11; RHAA_BACHD/1-417; L-rhamnose isomerase (RhaA) | ali follow.. | 15 | 331 | ..............INRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTY......... | 381 |
2 | -7.050 | PF17114.5; S9VWV7_SCHCR/61-205; Gef2-related medial cortical node protein Nod1 | ali follow.. | 14 | 60 | .......DNSNLNHEFFLQQVKSNFLSLPKIKIKMLSVFFSIVQIVLSKGGSHERVQFFASIAAVILPK..... | 123 |
3 | -5.850 | PF03571.15; C4XVZ5_CLAL4/140-688; Peptidase family M49 | ali follow.. | 8 | 440 | .........KHSEGTFDDLEIVVDESKLNKEAVDALAAFLHSLHVFKTTANVKEGLAFYNDMTEV......... | 495 |
4 | -5.840 | PF09543.10; Q1CVP2_MYXXD/3-120; Protein of unknown function (DUF2379 topsan) | ali follow.. | 17 | 46 | .........TALQTQAGATELLREAMRRIKDGSWRLMRALHRMYQHKRAGDFDSARQEMREVLAE......... | 101 |
5 | -5.770 | PF00611.23; Q75DE5_ASHGO/18-94; Fes/CIP4, and EFC/F-BAR homology domain | ali follow.. | 18 | 17 | ...............KNMVTFFEERSKLEKDYSRKLGAIANRLEQQLESTPDYGNMQKCAELCRAEQSKLAQSH | 75 |
6 | -5.660 | PF18822.1; V6ART6_9ARCH/84-206; CdvA-like coiled-coil domain | ali follow.. | 19 | 11 | ......SENDEMREDAEIIKYKSKLLSLEEAEKDISTRLSARLEALNEQLKSVKVLLFDAKVQ........... | 69 |
7 | -5.550 | PF12931.7; U1HK14_ENDPU/1170-1475; Sec23-binding domain of Sec16 | ali follow.. | 17 | 195 | ................EVYEFASSVLASNSRSALMPHLQAYKLQSLAEAGFKTEAQAYCDAIGASLRSTTKLS. | 254 |
8 | -5.410 | PF01158.18; A7ATP0_BABBO/13-113; Ribosomal protein L36e | ali follow.. | 14 | 39 | .................VSEVIREVCGFAPYERHMIELIKTGSASAQKRGTLRRAKTKNDEMMRVVELQRK... | 101 |
9 | -5.300 | PF11349.8; C6WR17_ACTMD/8-134; Protein of unknown function (DUF3151 topsan) | ali follow.. | 17 | 86 | ..............................PNQGFLRSLAALSRAAGGIGEVAEQDRCAKFLADS......... | 120 |
10 | -5.300 | PF13481.6; B2JV40_PARP8/220-401; AAA domain | ali follow.. | 14 | 110 | ...........LLDPRDTDDLCEAIETCGITGGVVFIDPFALATIGLEENSSADMGRAGAALNTL......... | 163 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82. |