current user: public

If you have questions about the server, please let us know.

Query: ACL93482.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# E-value Template Links and tools%idFirst MSEALKPGGGIKPDLPFTPVRVAVLTITDTRDEASDTSGQILVERIKAAGHELGGRVVVRDDIEQIRAQVRSWIDSKTVDAIVTTGGTGLTGRDVTVEALEPLFDKKIDGFSVVFHLVSYASVGLSTLQSRATAGLIESVFVFCLPGSNGAVKDGWDKVIAAQLDSRHKPCNMVELMPRLLERLast
1 2.000e-50UniRef50_A0A174G0F4 Molybdenum cofactor biosynthesis protein B n=212 Tax=root TaxID=1 RepID=A0A174G0F4_9FIRM  ali  30  3....................RAAIITASDSRGEREDLSGPAIREILEREGYEVISMDILPDDQVMLAGKLQEIADSEKAELILTTGGTGFSERDVTPEATEEVIERKVPGIPEAIRAYSMTITKRAM-LSRATAGIRGKTLIINLPGSPKAVRESLEYIIDALGHGIEILTGEAGNCAR.... 162
2 2.000e-50UniRef50_A0A2H0ATS1 Molybdenum cofactor biosynthesis protein B n=3 Tax=Bacteria TaxID=2 RepID=A0A2H0ATS1_9CHLR  ali  29  2...................FKAGILTISDKRGERQDRSGEVIRGILSQIDAQIVNYDIVPDEKNLIAEKLIQWADKDGIDVIITTGGTGLSPRDVTPEATLSVVDRVVPGFAEAMRLASLKKTPMAV-LSRAVAGTRGGCLIINLPGSPKAVRECLETILPALPHAVETLKGRVSEC...... 160
3 1.000e-49UniRef50_D7N5A1 Putative molybdopterin biosynthesis mog protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=D7N5A1_9FIRM  ali  28  4..................KYSAGVLTISNRRGEREDLGGPILIELIEKLGFEVKNFKIVPDERINIRETIEEWVDEDDLALILTTGGTGFSDRDITPEITIELCDRRVPGISEAMRSYGAKFTPMS-YLSRAESGIRKNTLIINFPGNPKAIRENFEAIIPFLKHGIDILRGK.......... 159
4 2.000e-49UniRef50_B1KU23 Molybdenum cofactor biosynthesis protein B n=297 Tax=root TaxID=1 RepID=B1KU23_CLOBM  ali  28  2...................IKTAIVTISDSKGERKDETGKVLQDILEKRGYKVEYYKIIPDEINIISEELIKLCDEKKVNLIITNGGTGLSKRDVTPEATEKVIEKHVPGFGEAMRASSLSITP-KAILSRGIAGIRKDSLIINLPGSPKAAVENLQAVLGAIPHGIEILLGEASECAR.... 162
5 7.000e-49UniRef50_A0A0P6YFN2 Molybdenum cofactor biosynthesis protein B n=15 Tax=cellular organisms TaxID=131567 RepID=A0A0P6YFN2_9CHLR  ali  32  2...................PAVAILTISDRRGERPDLSGPALIEEVTRLGWQVADYSIVADDAEKIKAYLIEWCDKHVVQMILTTGGTGFAPRDVTPEATLAVIERSAPGLAEYMRMKSFEKTPHAM-LSRAVAGIRKATLIVNLPGSPKAAVENFNFVSPVLPHAFQLLA............ 154
6 7.000e-49UniRef50_B5EEE2 Molybdenum cofactor biosynthesis protein B n=56 Tax=root TaxID=1 RepID=B5EEE2_GEOBB  ali  32  1...................MRAAILTLSDRCGERADGSGPALRSWLEEHGVTVTCTEVIPDEASLISEKLAAWSDSGSFDLILTTGGTGVSPRDVTPEATERVVDRVLPGFGEVMRAESLKKTPHAII-SRAIAGIRKNTLIINLPGSPKGATENISFVWAAVPHAVAKLQGDPEEC...... 159
7 1.000e-48UniRef50_U2R4J5 Molybdenum cofactor biosynthesis protein B n=101 Tax=Bacteria TaxID=2 RepID=U2R4J5_9FIRM  ali  32  2...................FKAAVLTVSDRRGERPDAGGPLVVEILKNAGYAVTETAIVPDEKGRIEAALRQWCDREPVDLIVTTGGTGFAPRDVTPEATLAVCDRLTPGIPEAMRYASMQVTNRAM-LSRAAAGIRKGTLIVNLPGSPKAARENLEAVLPALAHGLEMLSGRPADCAGL... 163
8 4.000e-48UniRef50_R6GL94 Probable molybdenum cofactor guanylyltransferase n=2 Tax=environmental samples TaxID=2231195 RepID=R6GL94_9CLOT  ali  26  193...................YTVAIITSSDKAGEREDKSGATVKEIVEANGFTVVKQVILPDEREMLRDEMIKMCDELKVNLILSTGGTGFSKRDITPEATKDVIEREAPGIVEAIRYFSLQITKRAM-LSRAVSGIRKDTLIVNLPGSPKACKEALDFVLDDVKHGIDILLGEARECAR.... 353
9 6.000e-48UniRef50_Q2LTP3 Molybdenum cofactor biosynthesis protein B n=35 Tax=Bacteria TaxID=2 RepID=Q2LTP3_SYNAS  ali  27  13..................SFSAGVVTVSDSRGEREDLSGKEVVRMLEELSILISETAIIPDEKDQIRQTLIDLADNKKLDLIVTTGGTGVTPRDVTPDATLEVIERVLPGMAEAMRQESLKKTPHAMI-SRAVAGIRGQTLIINLPGSPRGVRENLAVILPALKHALEKIRGDETECA..... 173
10 1.000e-47UniRef50_A0A2T0AJZ9 Molybdopterin adenylyltransferase n=10 Tax=Bacteria TaxID=2 RepID=A0A2T0AJZ9_9THEO  ali  30  5.........GIANEAPVPAFRIAILTASDSRGEREDKSAAVIREMVAGLG-EVVAYAVVPDERQILAAKLREFCDTVGVDLILTTGGTGFSPRDVTPEATRDVIEREVPGLPEAMRAASLKATPHAM-LSRAIAGIRGKTLIINLPGSPKGVRENLATILPALPHGLAILKGEVGECGR.... 174
11 1.000e-47UniRef50_I0GD28 Molybdenum cofactor biosynthesis protein B n=96 Tax=Proteobacteria TaxID=1224 RepID=I0GD28_9BRAD  ali  54  1.......MASIDETKQFIPLNIAVLTVSDTRALADDKSGQTLADRLTEAGHHLAAREIVTDDVEAIRAVIRRWIADAGIDVVITTGGTGFTGRDVTPEAIEPLFEKRMDGFSIAFHMMSHAKIGTSTIQSRATAGVAGATYIFCLPGSPGACRDGWDGILKPQLDYRTRPCNFVEIMPRLDEH 176
12 2.000e-47UniRef50_A0A0L6CVS3 Molybdenum cofactor biosynthesis protein B n=24 Tax=Proteobacteria TaxID=1224 RepID=A0A0L6CVS3_9RHOB  ali  53  4..........IDNTKDFIPVRIAVLTVSDTRDMADDRSGDTLVKRLEAAGHILADRMIVRDERDQIADQLREWVASPEVDVVISTGGTGLTGRDVTVEAHRDVYEKEIDAFGTVFTMVSMQKIGTSAIQSRATGGVAGGTYLFALPGSPGACKDAWDEILSFQLDYRHRPCNFVEITPRLDEH 176
13 2.000e-47UniRef50_UPI000780FD11 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Anaerolinea thermolimosa TaxID=229919 RepID=UPI000780FD11 :_  ali  28  1...................MRVSILTVSDRSGIRPDSAGPVLVSACQERNWNVVETDIVPDEFHQIQSKLIQWCQSGEVDVILTTGGTGFSPRDITPEATLGILDRQAPGLAEAMRLESLKITPYAM-LSRSVCGIRGKTIIINLPGSPKAALENFLTVAPVLPHAVHLLQDSPEAEHR.... 163
14 3.000e-47UniRef50_A5CZ06 Molybdenum cofactor biosynthesis protein B n=83 Tax=cellular organisms TaxID=131567 RepID=A5CZ06_PELTS  ali  28  5.................ARYRIAIVTVSDSRGERKDESGPAIREMVGALG-DVVSYQVVPDDLDVLKETLVNLSDRGRVDLIFTTGGTGLSPRDNTPEATLAVIEREVPGLAEAMRMESMKKTNRAM-LSRAVAGVRHRTLIVNLPGSVKAVKECLGVIMPVLPHGLEILTGRGGEC...... 164
15 3.000e-47UniRef50_A0A226C130 Molybdenum cofactor biosynthesis protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226C130_9FIRM  ali  25  2...................YKAGVITASDSRSKETDESGALLKSKLESLEIEVQEYQVIPDERGELSNLMNQWC-NQNLNLILTTGGTGLGPRDFTPEATKDIIEREVPGISEEMRRVSSQKTSKGM-LSRGISGIKKQTLIINLPGSPKAVKECFETIEPALIHALDTLTGIASECAR.... 161
16 3.000e-47UniRef50_B0SV91 Molybdenum cofactor biosynthesis protein B n=22 Tax=Alphaproteobacteria TaxID=28211 RepID=B0SV91_CAUSK  ali  55  1MDDAPLAAAGIDERLPFYPLNIAVLTISDTRDHNTDTSGALLVDRLTAAGHGLAGRVIVPDEVEAIRRQVQAWADDEAIDVILTTGGTGFAPRDVTPEAVTPLFRRTMDGFSVVFHQASQATVGVATLQSRALAGQVGDTFVFCVPGSTGACRDAWDLVLGQELDSRFRPCSLVGQIPRYR.. 185
17 4.000e-47UniRef50_E5XI65 Cyclic pyranopterin monophosphate synthase n=7 Tax=Clostridiales TaxID=186802 RepID=E5XI65_9FIRM  ali  25  209.................RRWKAAVVTMSDKAGEREDKSGPLICEMIADQGYDVVRTELLPDEQKEIEKCLCTLCDDEKVDIVFTTGGTGFSLRDCTPEATMAVAHRNVPGIAEAMRAASAEVTPRAM-LSRAVSAIRNHTLIVNLPGSPKAVKENLEAVLPVVEHGLEILTGQAGECGR.... 371
18 4.000e-47UniRef50_F7ZFC0 Molybdenum cofactor biosynthesis protein B n=1752 Tax=root TaxID=1 RepID=F7ZFC0_ROSLO  ali  49  4..........IDQSKDFIAIRIAILTVSDTRDLSQDKSGDVLVQRLLEAGHELADRRILPDERDQIADQLRIWCKDSSIDVVISTGGTGLTGRDISVEAHRDVYEKEIDAFGTVFTIVSMQKIGTSAVQSRATAGVAMGTYLFALPGSPGACKDAWDEILARQLDYRHRPCNFVEILPRLDEH 176
19 5.000e-47UniRef50_A0A0S7BAN7 Molybdopterin adenylyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A0S7BAN7_9CHLR  ali  29  1...................MRFGVLTISDRSGVRPDASGPALQTAVEKQGWQVVKYAIIPDDLTTICVTLASWCDTGEYDILLTTGGTGFAPRDVTPEATVQVVDKLTPGIPEAMRQASLAVTEHAM-LSRAAAGIRGKTLIINLPGSPKAAIENFHTISPVLQHAIDLIQGNPE........ 157
20 7.000e-47UniRef50_A0A174BBW2 Molybdenum cofactor biosynthesis protein B n=22 Tax=root TaxID=1 RepID=A0A174BBW2_9FIRM  ali  25  2...............DMNRIQAAIITMSDSRSQSTDESGAVIKEILEANDYAVVHYELISDDFEGIKNSLIRVCDQ-NISLVLTTGGTGLSKRDNTPEATKAIIEKEVQGISEAMRYHSLQITPRAM-LSRGVSGIRQNSLIINLPGSPKAVRENLEYIIPSLRHGLEILRGEASNCAR.... 166
21 1.000e-46UniRef50_A0A1F8PV34 Molybdenum cofactor biosynthesis protein B n=9 Tax=Bacteria TaxID=2 RepID=A0A1F8PV34_9CHLR  ali  30  10...................LRFAILTVSDRRGERLDAAGPLLAEVINNQGWNIVYQQVLPDDQSSIKELLTAWCDSGELDVVLTTGGTGFSSRDVTPDATRAVIDRDAPGLAEAMRSASLKITPHAM-LSRAAAGIRKNTLIVNLPGSPKAAAENLQVIMAVLPHAVQLL............. 161
22 1.000e-46UniRef50_A0A1M5UF77 Molybdenum cofactor biosynthesis protein B n=4 Tax=Peptoniphilaceae TaxID=1570339 RepID=A0A1M5UF77_9FIRM  ali  29  2...................FRAYIVTVSDSSYFEKDLSGPTLVNILTEKGYEVVGREILPDDREKISSVLEMLCDEDKADLILTTGGTGFAKRDVTPEATLDVIEKSVPGFGEIMRSKSFEITK-NAILSRETAGIRRDTLIINLPGSPKAASENLNFIIDSVEHGLSILRGEKTDC...... 160
23 1.000e-46UniRef50_A0A2A4FY21 Molybdenum cofactor biosynthesis protein B n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2A4FY21_9SPHN  ali  58  3..........IKEDLPFHPVRIAVLTVSDSRDLSTDRSGDTLAARIETAGHILADRAIVTDDVDHIVARLHGWIDDPQVDCVITTGGTGVTGRDVTPEALARVWDKEIPGFGELFRWLSYAKIGTSTIQSRATACVARGTYIFALPGSTGAVKDGWDDILVHQLDSRHMPCNFVELMPRLMER 175
24 2.000e-46UniRef50_P0AF00 Molybdenum cofactor biosynthesis protein B n=855 Tax=root TaxID=1 RepID=MOAB_ECO57  ali  43  6..............TEFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK.... 170
25 3.000e-46UniRef50_A0A1F9U2Q7 Molybdenum cofactor biosynthesis protein (Fragment) n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_01_FULL_54_10 TaxID=1797945 RepID  ali  29  1......................GVLTVSDRSGEREDRGGPALKSVVSGMGWRIGVEAIVPDEIERIQKTILNWTDEKEIDLVLTTGGTGISPRDVTPEATRGLLEKELPGLMEFVRFQSVRKTPLAV-LSRAVAGVRKKSLIFNLPGNPEGAKECLELILDVIPHALAIIQGEDHTHENDKER 162
26 5.000e-46UniRef50_A0A1G9WEL6 Molybdenum cofactor synthesis domain-containing protein n=1 Tax=Megasphaera paucivorans TaxID=349095 RepID=A0A1G9WEL6_9FIRM  ali  27  146..............TVKRPYQAAVITLSDSRGEREDVSGPLISERLQRAGYEVVEKILIADDAAVLRHQLCRLADQRQLDLVATTGGTGFAPRDITPEATLAVATKNVPGIAEAMRSYSLHITPRAM-LSRAVSVIRHKTLIINFPGSPAACEECLDCILDTLPHGLAVLRGEVTECAR.... 311
27 7.000e-46UniRef50_A0A2M7T4V3 Molybdenum cofactor biosynthesis protein B n=18 Tax=Bacteria TaxID=2 RepID=A0A2M7T4V3_9ACTN  ali  29  4.................KGVKVAILTMSDARGERVDTSGPEIRSIVEAEGAIVFYYEVIPDEQYEIEERLVRLADLEDADLILTTGGTGFSPRDVTPEATLAVIERNAPGFVEAIRHASLKITPHAM-LSRAVSGMRGQTLIINLPGSPKAVRESLQVVMPALPHGLEILKCQTGECA..... 165
28 8.000e-46UniRef50_A0A2G6EQQ8 Molybdenum cofactor biosynthesis protein B n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G6EQQ8_9GAMM  ali  52  2..............TDFHPLQIAVLTVSDTRTLADDKSGAYLAKALQDSGHHLADRQICPDDKYRIRAQVSAWIADASVQVILSTGGTGVTGRDITPEALTPLFDKRIEGFGELFRQISYAEIGTSTVQSRALAGLANQTYIFALPGSAGACRTAWSKILQAQLDNRHRPCNFSELIIRLGER 170
29 1.000e-45UniRef50_A0A258BKC8 Molybdenum cofactor biosynthesis protein B n=1 Tax=Asticcacaulis sp. 32-58-5 TaxID=1970317 RepID=A0A258BKC8_9CAUL  ali  54  1.......MAGINPDLPFYPLNIAVLTISDTRDMITDTSGALLADSLIAAGHKLNDRKIVTDEIHAIRDQIGQWIADEDIDVVLTTGGTGFAPRDVTPEAIRPLFKREMEGFGVVFHNASLATVGVATLQSRAFAGQAGDKFIFCLPGSTGACRDGWDLVLALELDSRFRPCSLVGQIPRYR.. 174
30 1.000e-45UniRef50_B1X223 Molybdenum cofactor biosynthesis protein B n=234 Tax=Bacteria TaxID=2 RepID=B1X223_CYAA5  ali  52  9..................PLKIAVLTVSDTRTEADDKSGKILVDNLTATGHLLAEKTIVPDNIYQIRAVISRWVADESVQVILTTGGTGVTGRDATPEAIKPLLDKEIEGFGEIFRMISYQEIKTSTIQSRTLAGVANGTYIFCLPGSSGACQTGWS-IIKDQLDSRHRPCNLAQLIPRLTE. 171
31 2.000e-45UniRef50_UPI0006847386 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Alicyclobacillus herbarius TaxID=122960 RepID=UPI0006847386  ali  27  11..................RYQAAVLTASDTAGVRQDKSGDALQRLLEESGFTVSARAATPDDLVTLTDTLRQWVNDSHIHLVLTTGGTGAGPRDVTPEATKSIITKELPGVAEAMRMESLRHTPFAM-TSRQVAGIAGDTIIINLPGSEKAVRECFAVIRPVLRHLVDLVCGDTEHR...... 170
32 2.000e-45UniRef50_A0A2E6GFW3 Molybdenum cofactor biosynthesis protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6GFW3_9CHLR  ali  32  2...................VSVAILTISDSRGSNQDVSGDMVSKNIKTHGFQEVYRGIVPDNQEEIRSKLIQLSDDEKINVILTTGGTGLGPRDCTPEATKKILDLEVPGISEAMRIETRKNADTSI-LSRGISGLRGNCLIVNLPGSPKAVSECLNSVISVIGHAVEMLSGRTEH....... 159
33 2.000e-45UniRef50_A0A1V5DKA4 Molybdenum cofactor biosynthesis protein B n=212 Tax=Bacteria TaxID=2 RepID=A0A1V5DKA4_9DELT  ali  28  3...................FRAGVVTVSDSRGEREDLSGKEVIRMLQELSILVTEKVIIPDEKDRIRQTLTDLSDEKALDLIVTTGGTGVTPRDLTPDATLEVIDRALPGMAEAMRQESLKITPHAMI-SRAVAGIRGRTLIINLPGSPRGVRENLAVVLPALKHAMEKIKGDETECA..... 162
34 2.000e-45UniRef50_A0A0C9Q0X7 Molybdenum cofactor biosynthesis protein B n=21 Tax=Bacteria TaxID=2 RepID=A0A0C9Q0X7_9BACT  ali  27  2...................IRAAILTLSDSRGEREDKSGEVIRNMLLGIDATITAYEVIPDEKELITKKLFEFA--EKADLIVTTGGTGVGPRDVTPEATRAVIEKELPGFGEAMRMEGLKHTSRAM-GSRAIAGIYKQTLIINLPGSPKGVAENLAVVLPVIPHTVGLIKGTVTECAKDREK 164
35 2.000e-45UniRef50_B9M749 Molybdenum cofactor biosynthesis protein B n=5 Tax=Bacteria TaxID=2 RepID=B9M749_GEODF  ali  32  1...................MKAAVLTLSDARGEREDGSGPALQNWLAAHEVAIVKSAIVADEHEEIVSILKEWADSGGVDLILTTGGTGVSPRDVTPEATMAVLDRVIPGFGEVMRARSLEKTPHAMI-SRAIAGIRGRSLIINLPGSPKGAVENIEAVWPAVPHAVEKIQGSTRDCA..... 160
36 2.000e-45UniRef50_A0A2E8X1S6 Molybdenum cofactor biosynthesis protein B n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8X1S6_9CHLR  ali  29  13.....................VGILTISDSKGERPDISGDTISKICTSEGFVEIFREIVADDITEISNLLSKWSDSKKVNVIFTTGGTGISPRDNTPEATKSILDIEIPGISEFMRMKTSEITPTAI-LSRSVTGIRNDCLIINLPGSPKGVQECLEIILPTLSHALEMIKGQKTH....... 169
37 3.000e-45UniRef50_A0A2E7R467 Molybdenum cofactor biosynthesis protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7R467_9CHLR  ali  27  8.....................AGILTISDSTGEREDTSGPAIQDLLSQQPLNILEQQIVPDERNLIADILVSWADDKLLHLIITTGGTGLSERDVTPQATESVIDYRIPGIEEAMRANGMRQTPFAM-LSRLVVGVRNGTLIINLPGSEKAVTENLQTIMPVLSHALGQINGHKD........ 162
38 3.000e-45UniRef50_A0A2H6FX94 Molybdenum cofactor biosynthesis protein B n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6FX94_9BACT  ali  28  2...................FKVAVLTLSDSKGSRQDKSGPLVSKIIKKAGGSVVSYDILPDKKSLIKKKLLSLCD--KVDLILTTGGTGTSPRDVTPEATREVIRREMPGIAEAMRMKGLKKTPYAMI-SRAVAGIRGKTLIINLPGSPAAVRQNLEVILPVLPHAIEKIKGSKKECA..... 159
39 4.000e-45UniRef50_A0A174TGF8 Molybdenum cofactor synthesis protein n=21 Tax=Terrabacteria group TaxID=1783272 RepID=A0A174TGF8_9CLOT  ali  26  2...................YTLGIITSSDSRGEREDKSGEVIKNISEENGFEVKRYVVLPDERDKLSEEMIYMSDVLGVDLILTTGGTGFSERDVTPEATKDVIYKEALGIAEAIRNYSFTITKRAM-LSRGTAGIRNKTLIVNMPGSPKACTEILDYILNDLKHGLDILKGSASECAR.... 162
40 4.000e-45UniRef50_A0A2H6FE74 Molybdopterin adenylyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6FE74_9BACT  ali  27  5..................KISVSILTMSDRKGERDDFSGRTVKESLDPTLYKVVEYDIIPDDSETIVSKLKDYS--EKSDLILTTGGTGLSPRDFTPEATLKVIDREVPGIAEAMRNHSMQYTNRAM-LSRAVAGVRKECLIINLPGSPKAAKENLEAILGTIPHAVEKIKGSKEECAR.... 164
41 6.000e-45UniRef50_A0A1V4X4W8 Molybdopterin adenylyltransferase n=11 Tax=Bacteria TaxID=2 RepID=A0A1V4X4W8_9DELT  ali  30  2...................IRAGVLTLSDSRGEREDLSGPEVIRMLRAAGIETVHSEVVPDEAQIISSKLVEFADVRGLDLVVTTGGTGVSPRDVTPDATLSIIDREIPGMAEAMRRESMLKTPHAMI-SRAVAGIRGQTLIVNLPGSPKGVRENLAVILPALTHAIEKIKGDPSDC...... 160
42 9.000e-45UniRef50_A0A1H6UU86 Molybdenum cofactor biosynthesis protein B n=9 Tax=Firmicutes TaxID=1239 RepID=A0A1H6UU86_9FIRM  ali  29  4.....................VAIITASDSKGEREDISGQTIREILMAAGYKIHSQIILPDEKELLADKMRELIKQD-VALILTTGGTGFSQRDVTPEATLAVIERQVPGIPEAMRYLSLQITKRAM-LSRAVAGICQNTLLVNLPGSPKAVKECLSFVLPELEHGLKILRGEASECART... 162
43 9.000e-45UniRef50_A0A2L1S2R9 Molybdenum cofactor biosynthesis protein B n=44 Tax=Bacteria TaxID=2 RepID=A0A2L1S2R9_9RHIZ  ali  55  11............EDRAFKPLSIAVIAVSDTRTLETDTGGALLKSLLEADGHHCFERQVVRDEIQLVRAAVQAYVATPRVDVILTTGGTGFSGRDITPEAVEPLFDKRMEGFSVLFHQYSATTVGTSSLQSRATAGLIGTTFVFCLPGSRGACRDAWEGILTHQLDYRHKPCNFVELMPRLDER 181
44 1.000e-44UniRef50_A0A1H2VP63 Molybdenum cofactor biosynthesis protein B n=2 Tax=Thiocapsa roseopersicina TaxID=1058 RepID=A0A1H2VP63_THIRO  ali  50  337......AMPKHFKDQDFLPLQIAVLTVSDTRTEENDTSGRCLVERAEAAGHRVMAKRIVPDDIYRMRAAFSEWIADPEIQVILSTGGTGVTGRDSTPEAVAPLLDKPLEGFGELFRSFSLEEIGTSTLQSRALGGLANGTFIFCLPGSSGACRTAWDRILLAQLDSRTQPCNFAQLIPRLLER 513
45 1.000e-44UniRef50_A0A0U5IQ02 Molybdenum cofactor biosynthesis protein B (Modular protein) n=1 Tax=Thiocapsa sp. KS1 TaxID=610332 RepID=A0A0U5IQ02_9GAMM  ali  52  327..................PLSIAVLTVSDSRTEDNDRSGQLLVERAEAAGHRVMAKRIVPDDIYRMRAVFSEWIADPEIQVILSTGGTGVTGRDSTPEAVAPLLDKPLEGFGELFRSVSLEEIGTSTLQSRALGGLANGTFIFCLPGSSGACRTAWDRILLAQLDSRTRPCNFAQLIPRLLER 491
46 1.000e-44UniRef50_D4N0A3 Molybdenum cofactor synthesis domain n=277 Tax=Bacteria TaxID=2 RepID=D4N0A3_ANAHA  ali  30  131.SGTIKVGDKIEVIYPEKPYMAAVMTLSDSRGERVDTSGPRAAEILKEHGFKIVEEILLPDEEAQIKKHLIRLSDSRQVDLIITTGGTGLSPRDRTPEATLAVADRNVPGISEAIRAGSMTITKRAM-LSRGVSVIRKKTLIINLPGSKKAVEESLSFIIDQLPHGLDTLRENTEDCGR.... 311
47 1.000e-44UniRef50_U2ERL1 Molybdenum cofactor biosynthesis protein B n=29 Tax=Bacteria TaxID=2 RepID=U2ERL1_9GAMM  ali  59  3..............DPFVPLSVAVLTVSDTRTEATDKSGRLLVERVESAGHHVYEKAICIDDIHEIRARVARWIADDKPDVVITTGGTGLTGRDVTPQAVEVLFDRRIDGFGEMFRMLSYESIGTSTLQSRAIAGVSKATFVFCLPGSSGACADGWDKLIAAQIDARTRPCNLQELLPRLTER 171
48 1.000e-44UniRef50_A0A2E1UUI3 Molybdenum cofactor biosynthesis protein B n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2E1UUI3_9GAMM  ali  51  6..................KLNIAILTISDSRTKETDKSGNLLCELVEEAEHTAIEHAIVKDNIYSIRSIVSSWIDTEKINVVITTGGTGVTGTDGTPEAVEVLLDKRIDGFGEIFRSLSYKKIKTSTIQSRAIAGVANSTYIFCLPGSPGACKDAWLDIIQYQLDSEHKPCNLVELMPRL... 167
49 1.000e-44UniRef50_Q0WR87 Molybdopterin biosynthesis CNX1 protein n=1 Tax=Arabidopsis thaliana TaxID=3702 RepID=Q0WR87_ARATH  ali  25  78..GSIRKEKKYDEVPGPE-YKVAILTVSDTAGAGPDRSGPRAVSVVDSSGAKVVATAVVPDEVERIKDILQKWSDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAM-LSRSAAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKH..... 258
50 2.000e-44UniRef50_Q3A350 Molybdenum cofactor biosynthesis protein B n=181 Tax=root TaxID=1 RepID=Q3A350_PELCD  ali  32  6...................FTIGILTLSDARGEREDLSGQVIREMIAPIG-KVTHYKVVPDDLDTIVETLVEWVDRDEVDLILTTGGTGLSPRDVTPEATARILDWEIPGMAEAMRVASMQKTPHAM-LSRAKVGVRRRSMVINLPGSPKGVRENLEVVMPALGHGLSKLKGDPSDCA..... 164
51 2.000e-44UniRef50_A0A2U3QIV7 Molybdopterin adenylyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2U3QIV7_9BACT  ali  31  2...................ITAAVLTLSDSRGEREDLGGPAIMEIVKKIGVSIEHYEIIADEKELIKEKLIDYS--KKVDLIITTGGTGLSPRDVTPDATLDVIDREIPGIAEAMRMEGLRKTNRAM-LSRAVAGVRGNTLIINLPGSPKAIKEGLEAVLDVIPHAVEKIKGSMEDCA..... 159
52 2.000e-44UniRef50_A0A249D178 Molybdenum cofactor biosynthesis protein B n=75 Tax=Proteobacteria TaxID=1224 RepID=A0A249D178_9GAMM  ali  40  3...........QKHNAFIPLKIAVLTVSDSRTVADDSSGDYLVSALAESGHQLAGRALCPDNLFRIRAQVSDWIADEGVQVVLINGGTGFNEQNRVPEAVGVLFERTVQGFGELFRQLSFADIKGAAMQSRALAGLANRTLICCLPGSTGACQLGWEKLIRDQLDARTKPCNFVSHL...... 168
53 2.000e-44UniRef50_A0A1V5E7U0 Molybdenum cofactor biosynthesis protein B n=50 Tax=root TaxID=1 RepID=A0A1V5E7U0_9DELT  ali  32  1................MSAIRAAVMTVSDSRSERVDQSGPAVAELLLGAGMTVACTAVVPDERDRIEALLVEWSDVEKFDLIVTTGGTGVSPRDVTPDATLAVIDREIPGMGEAMRRESAAKTPHAVI-SRATAGIRGSSLILNLPGSPKGARENLLVVLPALKHAVEKIKGDDRDCA..... 163
54 2.000e-44UniRef50_A0A1I7IHN1 Molybdenum cofactor synthesis domain-containing protein n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I7IHN1_9BACL  ali  29  2...............AHDQARAAVITVSDSRGLRTDIGGQRAEEALARMGFAVAVRVAVPDEREEIAALLCRLADEEGIRLIVTTGGTGLGPRDVTPEATLDVVDRIVPGIAEAMRAESLKKTPFGMI-SRQVAGTRGQTLILNLPGNPKAVDECLAVVAPVLRHTLDLLAGRTQH....... 163
55 3.000e-44UniRef50_A0A163W9N4 Uncharacterized protein n=2 Tax=Candidatus Fermentibacteria TaxID=1729712 RepID=A0A163W9N4_9BACT  ali  28  16....................NAGILTVSDSCGEREDLSGPALVEALVEAGLQPVRYAVSPDDRAAITEKLVSWCDDGSCDLVVTTGGTGLSPSDFTPEATMDAIERQVPGIPELMRQKSAETVQTS-WLSRSVAGIRGRTLIVNLPGSRKGAVECFGHIRPLLGHALEIAGGRVSRC...... 173
56 3.000e-44UniRef50_A0A2E8AI75 Molybdenum cofactor biosynthesis protein B n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E8AI75_9RHIZ  ali  52  32..................PINISVLIVSDSRTKDTDVSGNLLINKIKKSGHNLINYEILKDNKELIESKILEWSKNKNINAIITSGGTGLTGRDVTPEALERLFDKKIDGFSSIFHMISFQKIKTSTIQSRATAGIIKNTYIFCLPGSPGAVKDAWDEILIXQLXIRHKPCNLIEIIERLEE. 195
57 4.000e-44UniRef50_B2VBW6 Molybdenum cofactor biosynthesis protein B n=150 Tax=root TaxID=1 RepID=B2VBW6_ERWT9  ali  40  4............SSSDFIPLNVAVLTVSDRHSVDSDSSGSYLHEALTEAGHQVLDRAIVPDNRYRIRAVVSSWIASRDVQVVLINGGTGFNDKNCTPEAIGPLFDREVEGFGELFRMISWEDIATSTVQSRALAGIANGTLIFAVPGSTGACQLAWERIIQPQLDARTRPCHFVSHLKK.... 170
58 5.000e-44UniRef50_A0A2N0MCM5 Molybdenum cofactor biosynthesis protein B n=114 Tax=Bacteria TaxID=2 RepID=A0A2N0MCM5_9CHLR  ali  30  5......................AVLTVSTSGGTREDASGRAIKELLEGDAFQTVRYEIVPDDRDTIAERLAGWADAADVDLIVTTGGTGMGKRDVTPEACLSVLDKEVPGLAEAMRAKTLEFTPMAM-LSRSVAGIRGSTLIITLPGSPKGVRECLDVVMPVLPHALELLRDTVSEHP..... 162
59 6.000e-44UniRef50_A0A223E7V7 Molybdenum cofactor biosynthesis protein B n=162 Tax=cellular organisms TaxID=131567 RepID=A0A223E7V7_9BACI  ali  36  2.......SVSEHRSKANDPVRCKVITVSDTRTKDTDKSGALIIELLTREQMEIIDYEIVKDEREAIQSAVKEASDE--IDVFLLNGGTGFTKRDVTVEAVKELLDKEMVGFGELFRYLSYKEIGSASMLSRALAGSIGQKVIFCMPGSTNAVRLAMEKLILPELRHL................ 159
60 7.000e-44UniRef50_F9Y897 Molybdenum cofactor biosynthesis protein B n=22 Tax=Proteobacteria TaxID=1224 RepID=F9Y897_KETVW  ali  50  4..............RAFIPLNIAVLTVSDTRALADDRSGDVLVQRLGDAGHTLAARAILPDERAVIADQLRAWCADPAIDVVISTGGTGLTGRDVTVEAHRDVYEKEIDAFATVFAMISFQKIGTSAVQSRATGGVAQGTYLFALPGSPSACKDAWDGILAAQLDYRHKPCNFVEIMPRLDEH 172
61 8.000e-44UniRef50_D8MPX0 Molybdenum cofactor biosynthesis protein B n=307 Tax=root TaxID=1 RepID=D8MPX0_ERWBE  ali  45  10..................PLNVAVLTVSDSRDATSDSSGDYLREALAEAGHQVLDHALVKDDRYRIRAVVSSWIASSDVQVVLINGGTGFNTKNCTPEALLPLFDREIEGFGELFRMISYEDIGTSTLQSRAVAGVANGTVIFAVPGSTNACQSAWERIIQDQLDARTRPCNFVSHVKK.... 170
62 8.000e-44UniRef50_A0A0B7GRT1 Molybdopterin adenylyltransferase n=2 Tax=Treponema phagedenis TaxID=162 RepID=A0A0B7GRT1_TREPH  ali  25  2...................FKVHIITVSDSSYNKKDLTGPALRDFLTEHSFEVCGYDIVPDEINPISNLLIEISDSQKVNLVITNGGTGFNKRDVTPEATLKIADKIVPGFGEEMRRRSLEITPFGI-LSRAVSVIRNHTLILNVPGSPKAAVENLGFIITAIPHALKILTNEKNDCAKVD.. 164
63 9.000e-44UniRef50_A0A060USE8 Molybdenum cofactor biosynthesis protein B n=17 Tax=root TaxID=1 RepID=A0A060USE8_9PROT  ali  46  1MSSA----QQSPESKAFLPLAIAILTVSDSRTPATDKSGDKIAELASQAGHRIAARRISADDTECLRTQLRDWIVDPAIDVIIATGGTGVTGRDVTPEALAPLISKPIPGFGELFRMLSYQEIGTSTIQSRAEAAICDGTIVFLLPGSTGAVRLGMEAIIIPQLDIRHRPCNLSELLPRIHEH 180
64 1.000e-43UniRef50_A0A1F4YCG7 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium RBG_16_53_22 TaxID=1802787 RepID=A0A1F4YCG7_9BACT  ali  28  11..................RFTVAILIASDRAGIRPDSTGPALKKCLEEAGFYVQFYSVVADDEGAISAAIRNWAYEDGVNVILTSGGTGLGPRDVTPEATLKVIGRRVPGLEEAMRHASVKITPNAM-LSRAVAGTAANSLIINLPGSSKGAVENFKVVEPALRHAIELIIGRKP........ 168
65 1.000e-43UniRef50_A0A1V5PMB3 Molybdenum cofactor biosynthesis protein B n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1V5PMB3_9BACT  ali  30  2.......SLEEHRKKSPGSVKVIVMTVSDTRTKETDETGKIIKELLEKNSHVIVDYQIIENDREIITNFIENELTWYRSQAIIFNGGTGISSKDMTVEIVEKLLDKKLHGFGEFFRYLSYKEIGPAAMLSRSMAGVAGSTLIICLPGSPKAAKLAMEKLILSEIGHMVMEIMK.......... 167
66 1.000e-43UniRef50_A0A2H5XJH9 Molybdenum cofactor biosynthesis protein B n=10 Tax=Bacteria TaxID=2 RepID=A0A2H5XJH9_9BACT  ali  39  15...................VRCAVLTISDTRTEETDRSGTLLRNRLQEHGHQVVHYAIVPDEPEMIGALLDELA--GKVDVILTTGGTGISHRDTTYEVVAARLEKTLPGFGELFRMLSFQEIGSGAMLSRAIGGVYRNTLIFALPGSLGAVKLALDRLLLPELRHL................ 160
67 1.000e-43UniRef50_A0A1S9CZR2 Molybdenum cofactor biosynthesis protein B n=11 Tax=Bacteria TaxID=2 RepID=A0A1S9CZR2_9GAMM  ali  47  3..........RDETRAFIALEIAILTVSDTRTPETDKSGRLLVERLQTAGHRLHAKRIVPDDIYKIRALIAGWCADEGVPVVITTGGTGITGRDGTPEAIKPLLDRELDGFGELFRLISYEEIGSSTIQSRALAGVSNRTLIFCLPGSPGACATAWDTIIQHQLDYRTRPCNLAELIPRLAEK 175
68 1.000e-43UniRef50_D5BUG1 Molybdenum cofactor biosynthesis protein B n=129 Tax=root TaxID=1 RepID=D5BUG1_PUNMI  ali  48  8..........IDASVPFVAVNIAILTVSDSRSLADDKSGDLLAARAQGDGHHLADRALVTDDFAAITSQLTQWIAAPNIDVVISTGGTGLTGRDGTPEAFRAVFDKEIEGFGEIFRLVSFDKIGTSTIQSRAVGGVAKGTYLFALPGSSSACRDGWDEILRYQLDIRHKPCNFVEIMPRLRE. 179
69 1.000e-43UniRef50_A0A0A3JNN1 Molybdenum cofactor biosynthesis protein B n=9 Tax=root TaxID=1 RepID=A0A0A3JNN1_9BACI  ali  34  4..........HHHKNDMNKINIMVLTISDTRDKETDKSGQLIIDLLKNTNYRLSIYQIVRDEKEVIKNTIIEGCEDSKIDVIITNGGTGLSKRDVTFETLNEIYEKPILGYGELFRFLSYQEIGSAAMLSRACAGIVKNTVIFSTPGSTNAVKLAMEKLILPEIQHI................ 160
70 1.000e-43UniRef50_A0A1W9W809 Molybdenum cofactor biosynthesis protein n=1 Tax=Desulfobacteraceae bacterium 4572_87 TaxID=1972443 RepID=A0A1W9W809_9DELT  ali  24  1...................MRAGVLTISTAAGLRDDESGDTVQRMLEEQGFSVVRRHIIPDRLQEIADTLMAWADENHLPLIVTSGGTGLSPSDVTPQAMGKVIDYPVPGMAEAMRAESLKKTPHAMI-SRAMVGVRKGSLIINLPGSPKGAGENLSVVLPSLGHGLAKLGGDTTDCA..... 160
71 2.000e-43UniRef50_UPI000B913CF6 uncharacterized protein LOC110979616 isoform X1 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B913CF6  ali  27  14.................RPPLVGILTVSDRCGTHEDSSGPNLKAIVEEQGLAVVKTKIVPDERTQIQDALISWSDEEKLDLILTTGGTGFAERDVTPEATKAIIEKEAPGLALSMLMGSLRVTPLAM-LSRPACGTRGKSLIINLPGSKKGSQECYEFVLPGLRHAIHLLRGDSKEV...... 177
72 2.000e-43UniRef50_A0A1M6NJY8 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Anaerobranca TaxID=42447 RepID=A0A1M6NJY8_9FIRM  ali  28  131..GEIKAGDKIEIVENY---TAAVLTVSDSRGERVDTAGPKIQTLLASLGITTVESTIVPDDYEDIQNVLKDWI-EDEINLIITTGGTGISPRDITPEATLPLIDKQIPGIMEAIRYKTGKIT-SRAYLTRGVAGVSKKSLIINLPGSEKAVTESIEVISEFLIHGLDTLLGKSKDCGR.... 304
73 2.000e-43UniRef50_Q9ZL45 Molybdopterin adenylyltransferase n=990 Tax=root TaxID=1 RepID=MOG_HELPJ  ali  24  1................MQTIHIGVLSASDRAGVYEDLSGKAIQEVLSEYLLNPLHYEIVADERDLIEKSLIKMCDEYQCDLVVTTGGTGPALRDITPEATKKVCQKMLPGFGELMRMTSLKYVPTAI-LSRQSAGIRNKSLIINLPGKPKSIRECLEAVFPAIPYCVDLILG........... 159
74 2.000e-43UniRef50_A0A2H5XDV5 Molybdenum cofactor biosynthesis protein B n=1 Tax=bacterium HR17 TaxID=2035412 RepID=A0A2H5XDV5_9BACT  ali  38  1MAHPPTHETHRAHAERIQCVRCGVLTVSDSRTEATDTGGQLIRSLLVNEGHQVVRYQIVRDDLWQVRAVVTGWLVDDEVDAVITTGSTGISYRDIVAEALLPLLDKRLEGFGELFRQLSYAEIGSAALMSRAFAGIANGKPVFCLPGSPHACHLALHRLILPELRHL................ 167
75 2.000e-43UniRef50_A0A2E7RHL6 Molybdenum cofactor biosynthesis protein B n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E7RHL6_9BACT  ali  45  2...TTKRAHDCHAEREFRPLGIAVLVVSDTRDLRSDKSGLLLAERCQEAGHVLVERIVVLDEADLIQQRVLEWSGMEEVHTILITGGTGVFKRDVTPEAVEPLFDKKMPGFGELFRYFSFEEIGTATLESRATAGIVNKTLVFAMPGSSGACRLAIDKLILPQLDSRTKPCSIAGMLDRL... 178
76 2.000e-43UniRef50_G9YG56 Molybdenum cofactor synthesis domain protein n=11 Tax=Firmicutes TaxID=1239 RepID=G9YG56_9FIRM  ali  26  46..........IEERKENRPYRAAVITLSDSRGERIDESGPVIVGELEKRGFEITETLLLPDDEEQLKKQLVRLSDQRRLDIIITTGGTGFAPTDITPEATLAVADRLVPGIAEAIRAESMRQTKRAIY-SRAVSVLRKKTLIVNLPGSPKACRECLAVFMDTVAHPLDLLRYGASDCA..... 214
77 3.000e-43UniRef50_A0A1C5PPS0 Molybdopterin adenylyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A1C5PPS0_9FIRM  ali  29  3...................YRAAVITMSDSQGLREDTAGDAVVKILEENGWKTVYRTMIPDDMEQIKSELIKCADELAVTLVATTGGTGFSMRDVTPEATLAVVDREVRGIPEAMRAESMKITPMGM-LSRAAAGLRKQTLIINLPGSRKAASECLEAVIKPIKHGVEVLLGESQDCATLH.. 165
78 3.000e-43UniRef50_S6CFG0 Molybdopterin adenylyltransferase n=12 Tax=Coriobacteriia TaxID=84998 RepID=S6CFG0_9ACTN  ali  28  3...................IKFAIITCSDTRTLETDEAGQKLEQLIAEQGWECVRRVVEMDERPFIAGALIDACDNTDADIVLTCGGSGLSLRDVTPEATRDVADREVPGIAEAMRAHSVAITPFAM-LSRAICAQRGHTLIINLPGSTKAATENWEGIVEALPHAVKMMAGE.......... 155
79 4.000e-43UniRef50_F6TGF7 Gephyrin n=15 Tax=Euteleostomi TaxID=117571 RepID=F6TGF7_XENTR  ali  28  15...................IRVGVLTVSDSCFLAEDRSGINLKDLVQDLGGTISAYKIVPDEIDDIKESLIDWCDEKELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRD........... 171
80 4.000e-43UniRef50_A0A2N2LTY8 Molybdenum cofactor biosynthesis protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-8 TaxID=2013731 RepID=A0A2N2LTY8_9CHLR  ali  25  1................MINLTASILTISDRAGTRPDSAGPKIIELLKTKNIAIINYAIVPDEIDLITKKLSEWINEGSSRIIFTTGGTGFAPRDNTPEATKLVIEKETPGISEYIRKKSAEITPHAI-LSRGISGISKTTLIINLPGSPKAACESIEFIINVLPHAVELIM............ 156
81 4.000e-43UniRef50_Q1IHK1 Molybdopterin adenylyltransferase n=20 Tax=Bacteria TaxID=2 RepID=Q1IHK1_KORVE  ali  30  4....................TASVITVSDRRREREDLSGPAVAQMLRDAGFTIKSTQVLPDDQKQISSALRLCADRDHVSLAVTTGGTGVAKRDLTPEATMAICDKIIPGVAEVMRSEGLKKTPMS-PLSRAVCGIRGSTLILNLPGSPSGAVESLSAVMPLLQHAIELLAGNTEH....... 160
82 4.000e-43UniRef50_Q8EKM7 Molybdenum cofactor biosynthesis protein MogA n=705 Tax=cellular organisms TaxID=131567 RepID=Q8EKM7_SHEON  ali  26  1................MSKAKIGIVTVSDRAGIYEDISGKAIIDTLNDYLWEPI-YQVIPDEQDVIETTLIKMADEQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMRAESLKFVPTAI-LSRQTAGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEG........... 159
83 4.000e-43UniRef50_A0A257UNW9 Molybdenum cofactor biosynthesis protein n=4 Tax=root TaxID=1 RepID=A0A257UNW9_9DELT  ali  29  1...................MRAAVVTMSDRRRERPDASGPVVAEMLRSLPAEIAQQVVIPDETPFIRRALIHFCDALELDLIVTTGGTGVDPRDVTPDATREILDREVPGMAEAMRADSQKRVPTAM-LSRAVAGIRGKTLIVNLPGSPGGARENLAVLLPVLPHAIGKIRGEGGDCA..... 160
84 4.000e-43UniRef50_A0A2H5W6Q7 Molybdopterin adenylyltransferase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W6Q7_9BACT  ali  28  1..........MGRETVWSEIRAGVLTCSDSRGLSDD-SGQWLREVLAAQGSSVICYAVVPDEEDRIAATLLDWVDRQGCDLILTTGGTGLGPRDVTPEATARVIQRAAPSLLEYARWQTGQANPLA-YLSRGVAGVRGHCLIVNFPGNVKAVQEYWHVLKPLLEHGLALLKGY-----RLHPR 169
85 4.000e-43UniRef50_A0A0A9GBG1 Molybdopterin biosynthesis protein, putative n=1 Tax=Arundo donax TaxID=35708 RepID=A0A0A9GBG1_ARUDO  ali  31  72...................VKVAILTVSDTVGAGPDRSGPRAVSVVNSSGATVVATAVVPDEVDTIKGILVKWSDIDCVNLILTLGGTGFTPRDVTPEATKSVIEKEAPGLAFVMLQESLKITPFAM-LSRATAGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQLKGKREKHPRHVPH 242
86 5.000e-43UniRef50_A0A223KLK7 Molybdenum cofactor biosynthesis protein B n=4 Tax=Bacillus TaxID=55087 RepID=A0A223KLK7_9BACI  ali  34  7................YSAIKAAILTVSDTRTIENDRSGQTIKQLLENSNHTVIDYKIVKDDFHDIVTILEDWCNLPDIQAIIVTGGTGFTARDITYEAVTSIFEKEMTGFGELFRMLSFEEIGARAMFSRATAGSKNRTPIYALPGSTNAVKLGTEKLILPSVSH------FIEELHRH... 164
87 5.000e-43UniRef50_UPI000C084889 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI000C  ali  26  3...................FSAAVLVSSDRAGIYEDKSGKILVDLLKEMGFEVKKYQVIADDYEEIKNKLIEYADE-KISLILTSGGTGFSKRDFTADASLEVIEKQTPGITEAMRYEGGKITPLA-YLSRAVAGIRGESLIINFPGSAKACTENFEIIRPFLIHALETIIGIDNH....... 159
88 5.000e-43UniRef50_A0A0A8WWU5 Molybdopterin adenylyltransferase n=4 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0A8WWU5_9DELT  ali  31  1...................MKAALLILSDRRGERADASGPALEQWLKLQGVATARCEVIPDEATLITARLTDWADSDEFDLILTCGGTGVSPRDVTPDATLPVLERVIPGFGEAMRASSLQKTPHAMI-SRAVAGIRGRSLIINLPGSPKGAIENLEAVWQAVPHCVAKIQGDPEECPRT... 164
89 5.000e-43UniRef50_A0A2N0H5H0 Molybdenum cofactor biosynthesis protein B n=2 Tax=Sphingomonadales TaxID=204457 RepID=A0A2N0H5H0_9SPHN  ali  48  3.........GIDSSLTFHPLGMAVLTISDTRTTETDTSGALLCERLTGAGHVLHARAIVRDDIAAIQAQLREWIANPAIEIVLTTGGTGFSPRDNTPEAVKPLLRREMDGFAIAFQTKSLQTVGVAAMQSRAFAGQAGDSFIFCVPGSTGACRDAWDGLLELELDSRHKPCSIAGALPRLR.. 174
90 7.000e-43UniRef50_A0A2E5HXE5 Molybdenum cofactor biosynthesis protein n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A2E5HXE5_9CHLR  ali  29  10...................PTVAVLTVSDRSGLRKDLSGPAVVQSIHSLGWDCTEIDIVSDDVNEISAKLSSWADDDKINLIITTGGTGMSIRDVTPEATLTVIAREAPGLMEAVRAASLSITPYAM-LSRAVAGIRGHSLIINLPGNPKAVNEALTVLATALPHALDLISDHH......... 166
91 7.000e-43UniRef50_A0A1T4JVK3 Molybdenum cofactor biosynthesis protein B n=124 Tax=Bacteria TaxID=2 RepID=A0A1T4JVK3_9FIRM  ali  28  2...................IKVGVITASDSKGEREDKSGQVIQDMVAEIDGKVVSYQIVPDEKELLKCKMLEMMTQEGVELLLTTGGTGLGPRDVTPDATLELIDKEVPGIAEAMRMESLKVTNRAM-LSRAIAGIADKTLIINLPGSPKAVNECLEVVLSALPHAIDLIRDEVEDCAR.... 162
92 8.000e-43UniRef50_I0GK82 Molybdopterin biosynthesis protein n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GK82_C  ali  26  5..................KLKVAVIIASDTRGINKDETIPLLKQFIEESGWEMVDASIVPDERDLLREKMIYYADTMKVDLILTSGGTGPAKRDVTPEATKDVIEKELPGFSEAMRMGTFKTVKTAI-LSRGISGIRNDTLIINLPGNPRGAIESLFVIKEAIPHCIEIMQGK.......... 160
93 1.000e-42UniRef50_A0A1V5YJS4 Molybdopterin adenylyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V5YJS4_9CHLR  ali  32  2...................ITVGVLTISDRRGETQDQSGPLLQQIARERLAQVTVTACVPDDREQIAFTLRDWCDNARADLILTTGGTGFSPRDVTPEAMADVIEREAPGLAEAMRRETARITPHAM-LSRAVAGIRRSTLIVNLPGSARAVAENLEAILPALPHGIEILKG........... 156
94 1.000e-42UniRef50_A0A1F9YHR1 Molybdenum cofactor biosynthesis protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F9YHR1_9BACT  ali  31  3...................PVVAILTVSDRAGERPDAGGPALRAVVERRGWRVAEVRVVADESATISSAVRDWCDGLEIRLVLTTGGTGLSPRDVTPEATRAVLDKELPGFGELMRLRGLETTPTSV-LSRALAGSRGSALVVNLPGSPKGAVESFEAVADLIPHALAMLSGADHAPAR.... 163
95 2.000e-42UniRef50_A0A1J4YSX9 Molybdenum cofactor biosynthesis protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1J4YSX9_9BACT  ali  26  141............EIINHGKISAGILIISDRRGERKDESGIIIVNELKKIDGDAVRYKIIPDDTVIISSTLKDWSGINGLDLIVTSGGTGFSPRDVTPEATKKILQKEAPGLSELMRMKSGIKNERA-YLSRGVAGIRGETLIINLPGSPRAVGECLEILFPVLAHAIEVMKGEVKDC...... 306
96 2.000e-42UniRef50_G4D3J4 Molybdenum cofactor biosynthesis protein B n=2 Tax=Peptoniphilus TaxID=162289 RepID=G4D3J4_9FIRM  ali  31  2...................YSVFILTVSDSGYQKADFSGPEIVDLMKENGYEVVGTGMVPDDRELIK---KELIKNASANLILTTGGTGLGMRDITPEATKDVIDREVPGLSELMRMKSYEVVKSGI-LSRQVCGTIGSCLVVNLPGSPKAAKENISFILSPLKHALKMLNTEKSNCA..... 158
97 2.000e-42UniRef50_K9Z7J7 Molybdenum cofactor biosynthesis protein B n=11 Tax=Cyanobacteria TaxID=1117 RepID=K9Z7J7_CYAAP  ali  35  5...........HPDKKFISVNCAIITVSDSRTVVNDESGQIMQELLIKSGHKIVNYIIIKDNKELIEITLKNIAKNDNVHCLIFNGGTGISNRDHTYDVLANLLDKTLSGFGEIFRFLSYQEIGSRAIASRALAGVYQGKLVFSLPGSTGAVKLGLEKLILPELNHL................ 160
98 2.000e-42UniRef50_A0A1V5IPY0 Molybdopterin adenylyltransferase n=48 Tax=Bacteria TaxID=2 RepID=A0A1V5IPY0_9ACTN  ali  33  153...................IRAAVLTVSDSRGERVDTSGDALEEALRELGVADVERAIVPDERDLIAAELRRWADETAVNLVLTTGGTGMTSRDVTPEATLAVLERQAPGFAEAMRAGSLAVTPHAM-LSRAVSGIRGATLIINLPGSPRACREQFAMIAAALPHGVEKLLDLGADCA..... 312
99 2.000e-42UniRef50_A0A2H0XWM6 Molybdenum cofactor biosynthesis protein B n=16 Tax=Bacteria TaxID=2 RepID=A0A2H0XWM6_9BACT  ali  32  1...................MKLGIITVSDSKGEREDLSGPAIRASLKADAYE---YQIVPDEVKDISEAIVNFVDEKKCDLVLTTGGTGLSLRDVTPEATKQVLDREIPGIAEIMRSESYKIKKTA-LLSRAIAGHRKKSLIINLPGSPKAVKECLKIVEPIIKHAL................ 146
100 2.000e-42UniRef50_Q5WJM3 Molybdenum cofactor biosynthesis protein B n=42 Tax=Bacillales TaxID=1385 RepID=Q5WJM3_BACSK  ali  36  1..........MHHTHDVPVVKVAVLTLSDSRSEAEDKSGQTIQSLLEEH-HQVVRYKLIADDAEKLHQTVTEWAQAVDIDAIITNGGTGLSKRDITIQTVYPLLDKEMKGFGELFRVKSYEQIGAKALLSNALAGVRENTAIFCLPGSKNAVAFAMEAFIVPILSHLAG.............. 158
101 2.000e-42UniRef50_R6PQC2 Cyclic pyranopterin monophosphate synthase n=2 Tax=Clostridiales TaxID=186802 RepID=R6PQC2_9CLOT  ali  25  148.....KKGGKSGHFRRENNMRVAIITASTYKGEREDKSGPYIKKVVENAGFEVKVMKVLPDDRRILGEVMKRLADSNIVDLIITTGGTGFSESDVTPEATLDIVERQVPGIPEAMRAYSMQFTKRAM-LSRAAAGIRKQTLIVNFPGSPKSLKESLEYILPELIHGVEILQGIAKECA..... 321
102 3.000e-42UniRef50_Q9K8I4 Molybdenum cofactor biosynthesis protein B n=647 Tax=Bacteria TaxID=2 RepID=MOAB_BACHD  ali  33  2.......SVEQHRKEAPKTVRCMILTISDTRTYDTDKSGALIRELLEAKGHQVTEYQIVKDEYSQIQHWLKVAAGRADIDAILLNGGTGIALRDTTYEAVRDSLDKEMPGFGEIFRLLSFQEIGTAAILSRAIAGVRDGKAIFSMPGSTGAVKLAMTRIIIPELGHVMR.............. 164
103 3.000e-42UniRef50_B6JF25 Molybdenum cofactor biosynthesis protein B n=275 Tax=Bacteria TaxID=2 RepID=B6JF25_OLICO  ali  55  5...........DESKPFIPLNIAVLTVSDSRSFADDKSGSILADRITAAGHKMAAREIVTDDIEKVQAQLKRWIADDGIDIVVTTGGTGFTGRDITPDAVEPLFDKRMDGFSIAFHMLSHAKIGTSTIQSRVTAGLAGTTFIFSLPGSPGACRDGWDGILAHQLDYRTNPCNFVEIMPRLDEH 176
104 3.000e-42UniRef50_A0A2N2N701 Molybdenum cofactor biosynthesis protein n=3 Tax=root TaxID=1 RepID=A0A2N2N701_9CHLR  ali  28  3...................IKVSVLTVSDRAGERKDLSGPALYETIEKLGWTLINHGLVPDERPLISNFLLDGSSSGKINLILTTGGTGFAPRDVTPEATLAVIEKKAHGLVELIRSESAKIN-ANAYLSRAEAGICHKTLIINLPGSPKGAVESLLIVAPLIPHALELLEDQSGDIHQFSSR 167
105 4.000e-42UniRef50_A0A2H6EUQ6 Cyclic pyranopterin monophosphate synthase accessory protein n=13 Tax=root TaxID=1 RepID=A0A2H6EUQ6_9BACT  ali  26  131.....KKGGKSDFRETFRPLRASVLVISDSAGTREDKSGKIIREFLQDQPVKVEIYDVLPDDETRLKNRLLKLTDQEKMDLIFTTGGTGLGPKDVTPEATRQVIDKEVPGIAEAIRRHGKDRTPYAM-LSREVVGVRRHTLIVNLPGSSRGAKESLEAIFPGLLHAFPMLWGGG---HKLQE. 306
106 4.000e-42UniRef50_A0A1B0D7M8 Uncharacterized protein n=2 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0D7M8_PHLPP  ali  29  1................MSELVFLVITVSDTCAEAHDRSGPALREKLLELFPACVENVICPDEQEKIENILTSGCNNSAYHAIFTTGGTGFAPRDVTPEATRKVIEKEAPQLAQAMLISSLAVTPMAS-LSRAVCGVRKSTLIVNLPGSPKAVKECLDAVSRVLPHAISLLRNDSKTVARDH.. 167
107 4.000e-42UniRef50_E4PK66 Molybdenum cofactor biosynthesis protein B n=215 Tax=root TaxID=1 RepID=E4PK66_MARAH  ali  46  5............PSTEMKPLNVALLTVSDTRGPEQDTSGQFLEDSVVEAGHNLVARRILPDDVYLVRALLSGWIADSQVHAVIITGGTGLLERDSTPEAVRPLLDKTIEGFGEEFRRLSAAEIGSSTVQSRAMAGMANHTVIFCLPGSTGACRTGWEGILLSQLDSRHTPCNFAGLVLRKPEK 175
108 4.000e-42UniRef50_L8NSM4 Molybdenum cofactor biosynthesis protein B n=75 Tax=Bacteria TaxID=2 RepID=L8NSM4_MICAE  ali  34  6...........HPDTTPLHLTCAVVTVSDTRTPETDRSGQIIQELLTRSGHDIGLYLIIPDEPLQIQAILPEISNQNQIKVLILNGGTGIAPRDTTYDALVPLLRITLPGFGELFRYLSYQEIGSRAMASRAIAGVYQNLLVFSLPGSTNAVKLALEKLILPEILHLFKQIN........... 166
109 5.000e-42UniRef50_A0A072ZFF5 Molybdenum cofactor biosynthesis protein B n=1501 Tax=root TaxID=1 RepID=A0A072ZFF5_PSEAI  ali  48  9................FQPLNIAILTVSDTRTLETDTSGQTLADALLAAGHRLHQRSLKTDDIYQIRAVVSAWIADPEVQVGLITGGTGFTARDNTPQAVGPLFERDVEGFGELFRQVSQREIGTSTIQSRALAGLSNGTLVCCLPGSPGACRTAWNEILLAQLDSRTRPCNFVPHL...... 169
110 5.000e-42UniRef50_Q816R0 Molybdenum cofactor biosynthesis protein B n=392 Tax=Bacteria TaxID=2 RepID=MOAB_BACCR  ali  40  2.......SVTEHKKQAPKEVRCKIVTISDTRTEETDKSGQLLHELLKEAGHKVTSYEIVKDDKESIQQAVLAGYHKEDVDVVLTNGGTGITKRDVTIEAVSALLDKEIVGFGELFRMISLEDIGSSAMLSRAIGGTIGRKVVFSMPGSSGAVRLAMNKLILPELGHI................ 162
111 6.000e-42UniRef50_H8FGG3 Molybdenum cofactor biosynthesis protein B n=1598 Tax=root TaxID=1 RepID=H8FGG3_XANCI  ali  49  6...............DFIPLRLCVLTVSDSRTLADDRSGDYLADVLTHEGHALHERALCPDDRYRMRAIVSGWIADAQVDGILITGGTGFTGRDSTPEAITPLLDKVMPGFGEMFRAISVEEIGTSSLQSRAFAGLANHSFVFCLPGSTSACRTAWEKIVRAQLDARTKPCNLATLRPRLGE. 172
112 6.000e-42UniRef50_A0A1G1NTT0 Molybdenum cofactor biosynthesis protein B n=1 Tax=Omnitrophica WOR_2 bacterium RIFCSPLOWO2_02_FULL_50_19 TaxID=1801865 RepID=A0A  ali  28  2...................IKVGIVTISDSCSKKEDESGPMIKKMVEAKGLKVERHEIVPDEREAIKSAVINMVDVMKLDMVLTTGGTGIGPRDVTPEAVKPLLDKELPGVSEQIRRIGAQNSPRAI-LSRGLAGVRRQSLIVNLPGSPRGVEESLNAILDVLIHSVDMIHGK.......... 156
113 6.000e-42UniRef50_A0A094J3I2 Molybdopterin adenylyltransferase n=5 Tax=root TaxID=1 RepID=A0A094J3I2_9BACT  ali  27  3...................FNAAVVVCSDARGERVDTSGEYIREFLQEKKFNVIEKVIITDDIDTIKNKLIYYADEMKVDLIISTGGTGFSPRDNTPEATKEVIYRDVPGIGEMLRAESYKVTPRA-YLSRGVSGIRNRTLIINLPGSLKAVKENLSFLGDVLNHGLKIL............. 154
114 7.000e-42UniRef50_A0A1G8N1T7 Molybdenum cofactor biosynthesis protein B n=1 Tax=Natribacillus halophilus TaxID=549003 RepID=A0A1G8N1T7_9BACI  ali  32  1..........MHHERDASSVRAGILTMSDTRTKDDDKSGALICSYLEGHNHDISEYRVIKDDRDAIQSVLADWTSDDDLDVIITNGGTGISAKDVTHQVVAGMLEKEIEGFGELFRMKSYEEIGAKAMLSRALAGVIAQTAVYVLPGSSNAVRLGMNKLILPVLPHVVG.............. 159
115 8.000e-42UniRef50_A0A2E6J8Z1 Molybdenum cofactor biosynthesis protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E6J8Z1_9CHLR  ali  31  2...................YTFAVLTCSDTAGKRDDTSGKILVAAFEALGFALTHHEITPDDPDIIATKLSSWSD-DSINLILTTGGTGLSERDVTPEATMSIADQQVPGIQEAIRAYGQTKTPFAI-LSRGVCVIKRKTLIINLPGSEGGVRDGIEVLEPIISHALGQLTNH.......... 155
116 1.000e-41UniRef50_C7N1E6 Molybdenum cofactor biosynthesis protein B n=21 Tax=Bacteria TaxID=2 RepID=C7N1E6_SLAHD  ali  32  13..................KPVFAIITCSDTRSKKEDTAGAALEELIAAKGWSCIERVVVTDDRPVIAAEIARLADMDEVDIVLTCGGSGLSLRDVTPEATRDVCDREVPGIAEAMRAYSMQFTNRAM-LSRAIAAQRGRTLVINLPGSEKAARENWAGIEGALAHAVSMMAG........... 165
117 1.000e-41UniRef50_A0A0P9XFI7 Molybdenum cofactor biosynthesis protein B n=6 Tax=Pseudomonas TaxID=286 RepID=A0A0P9XFI7_9PSED  ali  51  84..EAMKA----KADTPFVPLNIAVLTVSDTRTRETDTSGQMFVDRLTEAGHGLIERVLLKDDLYKIRAQVATWIADEQVQVVLITGGTGFTGRDSTPEAVACLLDKQVDGFGELFRQISVPDIGTSTIQSRALAGLSNGTLVCCLPGSTNAVRTAWDGILAEQLDSRFRPCNFVPHL...... 254
118 1.000e-41UniRef50_A0A2E6J8T2 Molybdenum cofactor biosynthesis protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6J8T2_9CHLR  ali  33  1...................MNICVLTISDSRGXRKDFSGDAVQKYVEDAGHSVVQRSIVPDDPSAIRTILEKWADSTGVDVIFTTGGTGLSTRDNTPEATIDVTEYLIPGIAEVMRLKTFDLTPYSI-LSRAVAGVXSGSIIINLPGSVSGVKQCIEVVFESVIHAVQIVQDTKPH....... 158
119 1.000e-41UniRef50_R6IG01 Molybdopterin biosynthesis mog protein n=2 Tax=Firmicutes TaxID=1239 RepID=R6IG01_9FIRM  ali  25  3...................YKAAVITVSDRCGEKVDKSGPAVAQMLEEAGFPVIYRGLVPDERHEISAEFIKCAYELGADLIVSTGGTGFGKRDITPEATRDVISREIPAIPQAMLHYSLGLTPRAM-LTRGVAGIRGKSLILNLPGNEGGAKQNLSAVLGVLEHALQMI............. 154
120 1.000e-41UniRef50_A0A1B6EFW7 Uncharacterized protein n=2 Tax=Clastoptera arizonana TaxID=38151 RepID=A0A1B6EFW7_9HEMI  ali  29  7..................KILFGILTVSDRCYKNEDESGPALKKILARCGFKTEVMLCVPDDITTIERVLRMWSDEKMLHVILTTGGTGPAPRDVTPEATQNVIEKKLPGMALAMAKGSLEKTPMAM-LSRAICGIRNQTLIINLPGSKKGCTECLEFVIQSIPHAVGLIRNEVSQTHHLLQ. 177
121 2.000e-41UniRef50_A0A2N1QMB3 Molybdenum cofactor biosynthesis protein n=1 Tax=Synergistetes bacterium HGW-Synergistetes-2 TaxID=2013843 RepID=A0A2N1QMB3_9BACT  ali  30  5.................RPISVGILTVSDSRGEREDLSGPALARSVKPLGMFVEEVAIVPDEIGIISDTLTKWSDTGRVNLILATGGTGLSKRDVTPEALLSVAEKHVPGIGETMRSVSMKITSKAM-LSRGCAVIRGETLIIALPGSEKAAEECFAAIAPALRHGIEILCG........... 160
122 2.000e-41UniRef50_W2EEY1 Molybdenum cofactor biosynthesis protein B n=128 Tax=Bacteria TaxID=2 RepID=W2EEY1_9BACL  ali  29  2..................SWKVAILTASDRRGEREDTSAQVIRELVEEEIQGEIIYRVVPDEMDEIMAALIEMTDYHKADLILTTGGTGLGPRDVTPEATVSVIDREAPGFAEAMRMKSVEKTPRAM-LSRAVCGIRGNTLIVNLPGSPKGVHENLAVIIEQLPHALGILSGREGDH...... 162
123 2.000e-41UniRef50_A0A2H5ZW40 Molybdenum cofactor biosynthesis protein B n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2H5ZW40_9BACT  ali  36  1MSS---ESVRQHRKQGRGPVRCAVLTVSDTRTLETDQGGSLIVEMLRSAGHQVVRRGLVPDEPEQVRTWVQEALEDPAVQAVLTTGGTGIAPRDRTYEVVSGLLDKRLDGFGELFRMLSYQEVGPAAMLSRAVGGVAQGKVLLAMPGSPAAVRLAMEKLVLPELGHL................ 164
124 2.000e-41UniRef50_A0A1Y4CQS7 Molybdenum cofactor biosynthesis protein n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Y4CQS7_9ACTN  ali  23  4..................KYRAIVITVSDRAGVYEDGTGPAVAALLTERGYAVIETRVVPDERADIEAALVEAA-EKDAALVLTCGGTGFSPRDVTPEVTEAVCERRVPGLPEAMRAASARITDRA-WLSRATAGIRGRTLIVNLPGSPRAAVENLEAAVGPLAHGLDILRGGPATCAR.... 164
125 2.000e-41UniRef50_F1MSE4 Gephyrin n=13 Tax=Gnathostomata TaxID=35060 RepID=F1MSE4_BOVIN  ali  28  15...................IRVGVLTVSDSCFLAEDRSGINLKDLVQDLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRD........... 184
126 2.000e-41UniRef50_D5A585 Molybdenum cofactor biosynthesis protein B n=170 Tax=Cyanobacteria TaxID=1117 RepID=D5A585_ARTPN  ali  35  3MSSSIP-----HPDSGSLSVNCAVLTVSDTRTESTDKSGDLIKQMLQDSGHHLGNYVIIKDEPDLITQALNQCCGDAKIEAVIVNGGTGIAPRDTTYDAIEGLLEKTLPGFGELFRFLSYNEIGSRAIASRATAGVYRETLLFSVPGSQGAVKLAMEKLILPELVHL................ 164
127 2.000e-41UniRef50_A0A287BNN6 Gephyrin n=8 Tax=Euteleostomi TaxID=117571 RepID=A0A287BNN6_PIG  ali  28  15...................IRVGVLTVSDSCFLAEDRSGINLKDLVQDLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRD........... 184
128 3.000e-41UniRef50_A0A0M3V2A7 Molybdopterin adenylyltransferase n=218 Tax=cellular organisms TaxID=131567 RepID=A0A0M3V2A7_9PROT  ali  27  2..................KAKIGILTLSDRAGTYEDKSGPAIKEVLDSWIVSEREYEVIPDEFELIKERLVYMVDVLGCDLVLTTGGTGPAVRDVTPEATEAVCEKMMPGFGELMRAASLKYVPTAI-LSRQTAGIRGHALIINLPGQPKAIKECLEPVFPAVPYCIDLIEG........... 158
129 3.000e-41UniRef50_A0A2J6X444 Molybdenum cofactor biosynthesis protein n=2 Tax=Caldiserica TaxID=67814 RepID=A0A2J6X444_9BACT  ali  26  5..................KLKVAVIIASDTRGVNKDETIPMLKKFIEESNWVSIDASIVPDERELLKEKMIFYADILKVDLILTSGGTGPSKRDVTPEATRDVIQKELPGFSEAIRMESFKTVKTAI-LSRGISGIRNDTLIINLPGNPKGAIDSLTVIKEAIPHCIEIMQGK.......... 160
130 3.000e-41UniRef50_A0A0M6WF30 Molybdopterin adenylyltransferase n=33 Tax=Bacteria TaxID=2 RepID=A0A0M6WF30_9FIRM  ali  21  2...................YTVGIITISDAAGRREDKSGPKIRQMLPKDEYEVVSYKIIPDERKQIADELVRLSDDMKCNLVLTTGGTGFSPRDITPEATMDVAQRNAPGIAEALRAYSMSLTPRAM-LGRGVCVIRKNTLIVNLPGSVKAVSESMDFLMGNIEHGLDILLQYDSECGR.... 162
131 3.000e-41UniRef50_A0A2P5K5Z3 Molybdopterin adenylyltransferase n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K5Z3_9EURY  ali  38  20..........IHKKSAPRSARFAVITVSTSRFESDDISGKLMIELLKSSGHEVSRYSLLPDNKDEITQLVSGLSDSD-INAIVISGGTGLASDDVTLEAVEPLFNKTIPGFGELFRQKSLNEVGTAAMLSRASAGIVNKCIVFCLPGSPAAVKLGLNELVIPEVTHI................ 185
132 3.000e-41UniRef50_A0A1G1Q6Y3 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_38_17 TaxID=1801873 RepID=A0A1G1Q6Y3_9BACT  ali  25  2..........RHDLDSFKDIKIGVLTVSDSRTFDNDFSGKSIAAFLKNEGYEVVFYEIVSDESSQIIDKLNSALKEKKTDLILTVGGTGFGPRDNTPEATLKVVERVIPGLSECIRAEGAKKTK-AAYLSRGVAGIKGQTIIVNLPGSLKGAEESIGAISGLITHAIAMIKGE.......... 163
133 3.000e-41UniRef50_A0A2E4HXY8 Molybdenum cofactor biosynthesis protein n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E4HXY8_9BACT  ali  29  12..................PMRIVVLTVSDGCGKRQDRSGKVITDWIATSGYILVEKDVVPDEKDVIADKLKSCADSGLADVILTTGGTGFSLRDVTPEATKMIIEKDAPGLANVLQNHGMKKTPFA-XLSRGLVGTRGHTLIANFPGSPGGVQDCLEAVEMFLPHIVDLLNGHTQEHP..... 172
134 4.000e-41UniRef50_A0A2D6TLD0 Molybdenum cofactor biosynthesis protein B n=19 Tax=Bacteria TaxID=2 RepID=A0A2D6TLD0_9PROT  ali  50  2..................KVNIALLTVTDTRTLATDKSGAILVKKIKEQNHKLVDRKIVKDNKSEIVKILSDWIKNNKLDVIITTGGTGLTGRDITPEAIKEVADKEIPGFGELFRELSYKTIGTSTMQSRACAALANGKYIFALPGSSGGVRDAWDMILKYQLDINHKPCNFVELIPRL... 163
135 4.000e-41UniRef50_A0A1Z4QFI7 Molybdenum cofactor biosynthesis protein B n=6 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4QFI7_9NOST  ali  35  2MSQPHPDSAGIT-------VNCAVVTVSDTRSPQTDKSGQLIQQLLLCANHTVAAYKIIQDEPAQIQEQIELLGKSANLDAVIFNGGTGIAPRDTTYDAIEQLLEKTLPGFGELFRFLSYQEIGSRAIASRAVAGVYQNKLIFSLPGSSNAVRLAMEKLILPELPHL................ 161
136 4.000e-41UniRef50_UPI000364A1A5 MOSC domain-containing protein n=1 Tax=Succinimonas amylolytica TaxID=83769 RepID=UPI000364A1A5  ali  30  394...........SPVSVRTPFRAAVVTLSDRRGECRDESGPFIAARLAAAGYEILETVLLPDDEDRIRLELIRLADAAGADLIVTTGGTGFSERDVTPEATLAVATRNVPGIAEAIRAESLKITRRAM-LSRAVSVIRNRTLIVNLPGSRRAVEECLDVIMTELWHGLGILLGRDGDCGRH... 563
137 4.000e-41UniRef50_A0A2E7HXD5 Molybdenum cofactor biosynthesis protein B n=8 Tax=Bacteria TaxID=2 RepID=A0A2E7HXD5_9CHLR  ali  29  2...................IRVAVLTVSTSKGSRDDLSGPKISEVLDDSEYQQVKYGIVEDDIDKIXNILCEWSDDGSVDIIVTTGGTGVARSDVTPDACLRIIDREVPGMSEAIRSHSLSFTPMAM-LSRSIVGIRKCTLIITLPGSPKAIDQCLEVVKPVLPHVVELL............. 153
138 6.000e-41UniRef50_F9MUJ6 Molybdenum cofactor synthesis domain protein n=1 Tax=Peptoniphilus sp. oral taxon 375 str. F0436 TaxID=879308 RepID=F9MUJ6_9FIRM  ali  25  2...................FNYAIVIASDTRGENKDLCIDTIQKILKEPHYQCVYENILPDDKDRLKEELIHLADQEKVNLVITSGGTGLAPRDVTPDATLEVIHRQVPGISMAMLLASKEKTPMWM-LSRAVAGVRNQTLIINLPGSPKAVEECLTAILQALFHGLEIINNIVKQH...... 160
139 7.000e-41UniRef50_A0A1H0P509 Molybdenum cofactor biosynthesis protein B n=34 Tax=Bacteria TaxID=2 RepID=A0A1H0P509_9BACI  ali  36  6...........HKQDSPRIVKCKIITISDTRTKETDKSGQLMSSLLKEVGHEVVEYKIVKDDKRAIYDEVTKGCETEGIDAVLTNGGTGIAKRDVTIETVLSLLDKEIVGFGEIFRMLSYEDIGSSAIMSRAVAGVSNDTAIFSTPGSTGAVRLAMEKLILPELGHVVG.............. 164
140 7.000e-41UniRef50_A0A174S9U8 Molybdopterin adenylyltransferase n=6 Tax=Clostridiales TaxID=186802 RepID=A0A174S9U8_9FIRM  ali  25  148.................APLRAAVVTLSDAAGQRVDESGPAAVELLEQAGYEIIETLILPDEQKRIETELIRLSDGRQADLVVTTGGTGFSARDCTPEATLAVATRNAPGIAEAIRAESARHTDRAM-LSRGASVIRGGTLIVNLPGSPRAVRESLACILPALGHGVRILKGTAFECAR.... 310
141 7.000e-41UniRef50_A0A1S3CUA1 molybdenum cofactor synthesis protein cinnamon-like n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S3CUA1_DIACI  ali  29  2..............SVKPSLTFAILTVSDRCFESEDKSGPLLAQLLQEDFHAHILKTCVPDEMEEIKDKLKYWVDQSKVDLIFTSGGTGMSPRDVTPEAMNHLIDKKVPCIEHIIQTEGLKVTPLAM-LSRSTCGVRGKTLIMNFPGSSKAVKENYSAVSSYLPSIVKTL............. 159
142 7.000e-41UniRef50_UPI000BBBAFB3 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Ureibacillus thermosphaericus TaxID=51173 RepID=UPI000BBBAFB  ali  34  8..................PIHAAILTVSDTRTKDDDLSGQKIKSLLEGASFHVADYQIVKDEPSEIASHIQNWCEHESINAIIVTGGTGFTPRDQTYETIVPLLEKEMTGFGELFRYLSYEEIGAKAMFSRATAGCRNQTAIYLLPGSQNAVTLAMTKLILPTVQH................. 155
143 8.000e-41UniRef50_A0A1L3GKJ2 Molybdopterin adenylyltransferase n=27 Tax=cellular organisms TaxID=131567 RepID=A0A1L3GKJ2_9DELT  ali  28  8....................NIGIVTVSDRRGEYEDRGGPAIVDYLQQVLSSEYRLRVIPDESTTIEQTLRTLCDEQNCCLVITTGGTGPAVRDITPEATEAVCDKMMPGFGELMRKVSLEKVPTAI-LSRQTAGIRGRSLIVNLPGQPKAIAECLDAVFPAIPYCIDLLGG........... 162
144 9.000e-41UniRef50_I3XXL3 Molybdopterin adenylyltransferase n=12 Tax=Bacteria TaxID=2 RepID=I3XXL3_SULBS  ali  26  2..................KAKIGILTVSDRAGVYEDLSGKAIMDVLGEYLWERV-YEVIPDEQSLIEEALKDMADVQECSLIVTTGGTGPALRDVTPEATEAVCEKMMPGFGELMRQVSLKYVPTAI-LSRQVAGIRGKSLIINLPGKPKSIRECLDAVFPAVPYCIDLIGGAYLTCH..... 164
145 9.000e-41UniRef50_A0A146P4B5 Gephyrin n=2 Tax=Percomorphaceae TaxID=1489872 RepID=A0A146P4B5_FUNHE  ali  27  16....................RVGILTVSDSCFKAEDRSGVNLKDLVHDLGGVIAAYKIVPDEIDEIKETLLEWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAVDLLR............ 170
146 9.000e-41UniRef50_A0A1J0H0K2 Molybdenum cofactor biosynthesis protein B n=17 Tax=Bacteria TaxID=2 RepID=A0A1J0H0K2_VIRHA  ali  32  5...........EHKQNNQSVNCMIITVSDTRTIDTDKSGNLMKELLEQAGHHVVMREIVPDEYSLIQKAVKAGCEHPYIEVVLTNGGTGIAGRDVTIEAVTEIFEKDIPGFGELFRYLSYKEIGSAAILSRAAAGVLGQTAIISTPGSTGAVKLAMNRLIIPELSHISQ.............. 163
147 1.000e-40UniRef50_A0A2D7I0A1 Molybdenum cofactor biosynthesis protein B n=3 Tax=Bacteria TaxID=2 RepID=A0A2D7I0A1_9DELT  ali  37  1MTEEPKPSHKKHHHRKEEAVDVAVITVSDTRTLETDTGGAVVEELLRAAGHTVVAREIVPDDREAIQSALRECLKKEGLRAVILTGGTGVAPRDVTPESVAPLLEREVPGFGELFRALSYEDIGSAALLSRALAGLSQGRVIFVIPGSRGAVRLAMEKLILPELGHLA............... 171
148 1.000e-40UniRef50_F2LXK7 Molybdenum cofactor synthesis domain protein n=4 Tax=Hippea TaxID=84404 RepID=F2LXK7_HIPMA  ali  25  1................MSDYRFALVVMSDSRNPEEDRVRPIVDEILKANGFKLVRYDIIPDEFDLIKEKLIELSNDSDVDVVITSGGTGLYKRDVTPDATKEILDYEIPAIPQAILYNALTKTKRAM-LSRMVAGVRNFTLIINLPGSPKAVKEDLEYIIDVIEHAVDKLKGDNTPC...... 162
149 1.000e-40UniRef50_Q7UN99 Molybdenum cofactor biosynthesis protein B n=14 Tax=Rhodopirellula TaxID=265488 RepID=Q7UN99_RHOBA  ali  37  11.........GCPDVDPAQGIRVAVITLSDTRGKAEDRSGDRIVSLLEEAGHSVAKRMILKDDSEPLAKLLRDLAEDDALDAVITTGGTGIAPRDMAVDVIESVLDVTLPGFGEHFRAISIAEIGPKAMLSRATAGRMKSKVIFALPGSTGAVTTGMSQCVLPILRH................. 167
150 1.000e-40UniRef50_UPI000C7841CA MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Dorea sp. Marseille-P4003 TaxID=2040291 RepID=UPI000C7841CA  ali  25  2...................MKAVVIVASTSLGQREDKSGPTLKARLENMGFTVPEILLLPDDRRKLSEAMRELADEQKVELIVTTGGTGFAKDDCTPEATLDIVERRADGIPEAMRAYSSQFTDRAM-LSRAAAGIRGETVIINLPGSVKAVEECMDCVENSLIHGIEILTGKTGECGR.... 162
151 1.000e-40UniRef50_A0A2H6A3C1 Molybdenum cofactor biosynthesis protein B n=8 Tax=Bacteria TaxID=2 RepID=A0A2H6A3C1_9BACT  ali  32  1...................MRVAVLTVSDSAGKRQDRSGDVIVEWARARGLEVTAREVVPDESDVIAQALARLADEDRADLILSTGGTGLAPRDVTPEATRAVIEREAPGIAEAIRAAHREAVPRSM-LSRGVAGVRGSALIVNLPGSPKAVSEALAVLDPVVQHAVDLLKG........... 154
152 1.000e-40UniRef50_A0A1Y4K1V4 Molybdenum cofactor biosynthesis protein n=3 Tax=Olsenella TaxID=133925 RepID=A0A1Y4K1V4_9ACTN  ali  25  22......ASAG-EKNPASAARTAAVVTVSDRAGVYEDATGPAVSALLAERGYEVVRALVVSDERAEIESALVHAA-ERDVALVVTCGGTGLSPRDVTPEATAAVCERMVPGIGEAMRAASMQVT-SRACLSRATAGIRGRTLIVNLPGSPQAATENLEAVIDPIGHGLDTLRGGPMSCAR.... 193
153 1.000e-40UniRef50_A0A1V4SA64 Molybdenum cofactor biosynthesis protein n=1 Tax=Desulfobacteraceae bacterium 4484_190.1 TaxID=1956167 RepID=A0A1V4SA64_9DELT  ali  27  4..................KIRVGILTISDSKGLRRDESGEIIAKILNEQGFILEKKEIIPDDIRLIVDKLIAWVDKDRLSLIVTSGGTGMSPSDVTPEAMKEIIDYDVPGMAEAMRATSLKKTPHAM-LSRAIVGVRHACLIINVPGSPGGSRDNLLVVLPTLNHALLKLAGDTSDCA..... 179
154 2.000e-40UniRef50_UPI000B45E8D0 uncharacterized protein LOC110458405 isoform X1 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45E8D0  ali  28  7.................RRIKVGVLTVSDSCGNAEDKSGSNLCHLIDQAG-NVSVKDIVPDDIEKIKKTLKEWCDVKKLDLVLTTGGTGFAPRDVTPEATKSILEKEAPGMTIAMLKKSLEVTDLAM-LSRLTCGTRGHTLVINLPGSTKGSEECFRFALPGIPHAVDLLRGRERSVKDTHAK 176
155 2.000e-40UniRef50_A0A2N2EZS3 Molybdenum cofactor biosynthesis protein n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2EZS3_9BACT  ali  29  11...................VKAAVLTCSDSRGLRRDTAGPAVESRLQSSGLDVTARLILPDERKQIGAMLKKWCDTGIADVIFTVGGTGMGPRDCAPEATRDVMDKLCPGIPELIRWESFKITKHAA-LSRATAGIRKKTLIINLPGSQKAARQTSAALLAILPHAVELLRGHTEH....... 173
156 2.000e-40UniRef50_Q6D3C8 Molybdenum cofactor biosynthesis protein B n=103 Tax=Proteobacteria TaxID=1224 RepID=Q6D3C8_PECAS  ali  42  8................FVSLNLAVLTVSERRTAEDDTSGDYLREAAQSAGHRIVASAIVKENLYQIRAQISAWIASDEVQGILINGGTGFTAGDVVPEAIGVLFDREIEGFGELFRMVSYEDIGTATLQSRALAGLANQTVIFAMPGSTRACRTAWERIIQEQLDARQKPCNFYPHLKK.... 170
157 2.000e-40UniRef50_A0A121XAR4 Molybdopterin adenylyltransferase n=103 Tax=Bacteria TaxID=2 RepID=A0A121XAR4_LISMN  ali  24  2...................FKVGIVTLSDRCGLAADQSGPLIREQLP-VLYQVTKQTILPDEENQLVELLLEWSKT--CDLILTTGGTGLSERDRTPEATLRVAERIIPGISEGLRQLSLEKTPFAM-LSRGVSVQRGRTLIVNLPGSPKSVTEHLHFLLPVLPHALDLITNKK......... 154
158 2.000e-40UniRef50_A0A2V9I6B9 Molybdenum cofactor biosynthesis protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9I6B9_9BACT  ali  33  43...........HQKKARGRASVAVITLSSSRSVDNDQSGELIESLLQENGHDVAVRKVIADSRNVLRATVRELVRQKNVQAIITTGGTGLSPTDITIETVRGMLEKELPGFNSLFMLLSYPEAKSASMLSRATAGTIKGKAIFCLPGSPRACKLAIESLILPELGHILMLLGD.......... 204
159 2.000e-40UniRef50_A0A0T5ZVQ4 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MogA n=8 Tax=root TaxID=1 RepID=A0A0T5ZVQ4_9BACT  ali  29  131.....KRGGKSEWKQHFKPLKAAVLVLSDSVGKKEDKSGKAIIEKLKKEPVEVIEYKIFPDDFETIRRELIRLTDVEKVDLILTTGGTGLSPRDITFEATKTVIEREVPGISEATRIYGFQRTPYAM-LSREVAGVRGKTIIINLPGSSRGAAESMDALFPWVLHVFHILKG........... 299
160 2.000e-40UniRef50_S5PPM3 Molybdopterin adenylyltransferase n=218 Tax=cellular organisms TaxID=131567 RepID=S5PPM3_9PROT  ali  27  7....................KIGIVTTSDRAGIYEDLSGRAIIDTLNDYLWEPI-YRCIEDDKTTIENTLKELVDDEKCCLVVTTGGTGPSLRDVTPEATEAVCDRMMPGFGELMRSVSLQYVPTAI-LSRQTAGLRKNSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEG........... 161
161 2.000e-40UniRef50_I8RIP0 Molybdenum cofactor synthesis domain protein n=9 Tax=Firmicutes TaxID=1239 RepID=I8RIP0_9FIRM  ali  22  142...........DEIEVWQGIPVGIITASDAIGEREDTSAKEIEKLVPNINGQVIDYRILPDDQNVLVEAMIEMVDQLGVGLLLTTGGTGFSPRDVTPEATLRVIERAVPGLPEAMRRESAAISPRAM-LSRAVAGIRGKCLIVNLPGSPKAVRECLEIILPVLPHALEILHGTGGEC...... 308
162 3.000e-40UniRef50_A0A1F5VV02 Uncharacterized protein n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5VV02_9BACT  ali  25  2...................YKAVIITINDSCGQKEDTSGKLLMRLLTEENFEIISKVITPHDKEQIEKHLNVYLASDNLSFIATVGGTGIGYKDYTPDITRNLIEKEIPGVAELMRMKG-AETYPSALLSRAVAGIKNKILIINFPGNPKAVQESFDAIKELIPHIISMLKGEPR........ 158
163 3.000e-40UniRef50_A0A0V8HRB5 Molybdenum cofactor biosynthesis protein B n=9 Tax=Bacilli TaxID=91061 RepID=A0A0V8HRB5_9BACI  ali  33  5...........HRKASTKKVTCKVITVSDTRTKETDKSGGLLMELLQRSGHEVADYEIIKDEKTLINASLEKAIHNNQIQAVLLNGGTGISNRDVTIEAVKALLDKELVGFGEIFRFLSYRDIGSAAILSRAIAGISNNTIIFSMPGSSGAVKLAMEQLIIPEIGHIA............... 162
164 3.000e-40UniRef50_U3QUK0 Molybdenum cofactor biosynthesis protein B n=8 Tax=Proteobacteria TaxID=1224 RepID=U3QUK0_RALPI  ali  41  1MSSPAPEKGQIAPLDRLLSLSCAVLTVSDHRTPATDTSGDLLVRHLEAAGHRCIRRDMSVDNVYAIRRILSDWIVAGDVKVILTNGGTGFKPGNSVPDAVVPLLDREIDGFGELFRMVSYREIGSAAMQSRALAGVANSRIIFCLPGSEGSCNLGWEHLIRPQLDSRTRPCNFA......... 174
165 3.000e-40UniRef50_R7KC27 Putative molybdopterin biosynthesis mog protein n=1 Tax=Acidaminococcus sp. CAG:917 TaxID=1262688 RepID=R7KC27_9FIRM  ali  26  2...................FTAAVITVSDSAFTREDTSGGEVKNILQQNGFEVIAATVVPDDVKKIAKAIKGFCKQG-INLVATTGGTGFSSRDVTPEATARVADRQVPGVAEAMRLNSMQYTSKAM-LSRGICAIKDKTVLLNLPGSPKACVENLSYVIEPLKHGIEVLLGNVKECAR.... 161
166 3.000e-40UniRef50_A0A1I7RT61 Uncharacterized protein n=1 Tax=Bursaphelenchus xylophilus TaxID=6326 RepID=A0A1I7RT61_BURXY  ali  28  244.................RQMRIGILTVSDTCSEEKDKSGPILLENLQTSIIPVFSTAIVADDKDKIKKQLILWA--KDHHVIITTGGTGFAPRDVTPEATREVIQKPCPGIVVALIQEGLKFTPMAA-LSRPEAGICGQCLIVNLPGSPKACQQSLPVLEPLLNHAVQLLRPE.......... 401
167 3.000e-40UniRef50_A0A2E5EN53 Molybdopterin adenylyltransferase n=83 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2E5EN53_9BACT  ali  27  1................MAKIKVGVITVSDRAGEYEDLGGPAVRKAAEGHGWEVISETIVGDDKEAIQRAIREAIA-KDCGLVLTTGGTGIAPRDVTPEAIREISDRELPGFGEAMRMESLKITP-NAILSRNLAATVGNALVIALPGKPKGAVECLGFVVGAIPHCV................ 151
168 4.000e-40UniRef50_A0A2A9BT66 Molybdenum cofactor biosynthesis protein B n=20 Tax=cellular organisms TaxID=131567 RepID=A0A2A9BT66_9BACI  ali  34  1.......MLEEHRKSSVKIVSCKVVTVSDTRTKETDKSGKLLMEYLQQWGHAVTEYEIVKDDISTITAAIEKAIHNQEIQAVLLNGGTGISKRDVTIEAVKPLLDKELVGFGELFRFLSYRDIGSAAILSRAMAGVTGDTIIFSMPGSSGAVKLAMEQLIIPEMGHIA............... 162
169 4.000e-40UniRef50_UPI0009FC0DAB MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Aminiphilus circumscriptus TaxID=290732 RepID=UPI0009FC0DAB  ali  27  41..........SQKLLPLRPLSVGILTISDSRGERIDTAGPALEELVLDIGGIVRQRGIVPDERDMIAGTIKQWIDEDDCHLVLTTGGTGLATRDVTPEALLSVASRVVPGIGEAMRALTWQNAPRAI-LTRGLAVTRGESLIVSFPGSERGARECFGAVAPVLRHAVEILRN........... 203
170 4.000e-40UniRef50_A0A2N1QX06 Molybdenum cofactor biosynthesis protein n=3 Tax=Synergistetes TaxID=508458 RepID=A0A2N1QX06_9BACT  ali  29  46..........SSQVSIWKAIRAAILTVSDSRGERIDTAGPELERLIAAQGAVVEDKKIVPDEKEEIACTVRSWCDEG-YDLVLTTGGTGLSLRDVTPEALLGIAEKVVPGFGEMMRSKTLEFTERA-FLTRSVAVICKNTLVIAFPGSQRGARQCFEAIVPALRHGIETLAG........... 207
171 4.000e-40UniRef50_Q4FU36 Molybdenum cofactor biosynthesis protein B n=28 Tax=Proteobacteria TaxID=1224 RepID=Q4FU36_PSYA2  ali  48  2..........SKPAAEFIPLSIAVLTVSDSRTLAQDTSGQYLVDQLMSAGHQLADRQLITDDIYHIRAVISGWIADPNVHAVITTGGTGFYIRDSMPEAVNVLFDKSIDGFGEMFRLISKDDIGMSTVQSRAVAGMANGTGIFCLPGSSGACRTGWEGILKDQFDSRTRPCNFVPHFMRI... 171
172 4.000e-40UniRef50_A0A1G6IUZ5 Molybdenum cofactor synthesis domain-containing protein n=1 Tax=Olsenella umbonata TaxID=604330 RepID=A0A1G6IUZ5_9ACTN  ali  30  209..................SFSVEVITVSDRRGERPDASGPALVELVERHGYRVVATRLVPDEREQIEAELRDAAARG-VALVLTTGGTGFSPRDVTPEATAAVCERMAPGIPEAMRAASLAITP-KACLSREVAGIVGRTLVVNLPGSPKAAVENVSAVIGPIAHGLGILRGEA......... 364
173 4.000e-40UniRef50_S4R6K6 Gephyrin n=2 Tax=Vertebrata TaxID=1261581 RepID=S4R6K6_PETMA  ali  22  17.....................CGVVAVSDSCFKVEDRTGLNLKDLVEDLGGIVSAYKIVPEEMEDIKESLLEWCDDKELNLVLTSGGTGFAPRDVTPEATRDVIEREAPGMALAMLMGSLNVTPLAM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAVDLLRD........... 171
174 5.000e-40UniRef50_A0A0T6AWK1 Uncharacterized protein n=1 Tax=Oryctes borbonicus TaxID=1629725 RepID=A0A0T6AWK1_9SCAR  ali  28  3...................IKFAVITVSDTCYEKEDKSGPALEKSILTLFPETIFKKIVPDEVDVIEAELLELC-SKQYNIVLTTGGTGFAKRDVTPEATKRVIEKEAPGISIAMVTRSLQSTDMAM-LSRAVCGYRGQTLIINLPGSVRGAIECLSFIKGSLIHVVHLLIDKVEDIQRTHNH 167
175 5.000e-40UniRef50_A0A2V9JE81 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JE81_9BACT  ali  33  118...........HQKKARGRASVAVITLSSSRSVDNDQSGELIESLLQENGHDVAVRKVIADSRNVLRATVRELVRQKNVQAIITTGGTGLSPTDITIETVRGMLEKELPGFNSLFMLLSYPEAKSASMLSRATAGTIKGKAIFCLPGSPRACKLAIESLILPELGHILMLLGD.......... 279
176 5.000e-40UniRef50_A0A2N2EVI8 Molybdenum cofactor biosynthesis protein n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-2 TaxID=2013764 RepID=A0A2N2EVI8_9BACT  ali  23  4..................KITAAVLTVSTGAGTRKDTSGLALCKLCGNNGFNVIAHDIVDDSKAQIMRKLKFYADKLKADIVLTTGGTGFGPEDITPEATAAVLERNAPGIPELIRMAGFKKTKTSV-LSRGIAGIRKKSLIINLPGSPKGAEESFEAAAGLLSHAVKMLKG........... 158
177 5.000e-40UniRef50_A0A1Q8TTB5 Molybdenum cofactor biosynthesis protein B n=37 Tax=cellular organisms TaxID=131567 RepID=A0A1Q8TTB5_BACPF  ali  32  6...........HKMEAPKSVNCMIITVSDTRTLETDKSGGLIKELLEKNGHIVTEYQIVKDEYAEIQSLLKRAETRADVDVVLLNGGTGIALRDTTYEAVKDLLHKEMPGFGEIFRYLSYAEIGTAAILSRAVAGVYGSKAVFSMPGSSGAVKLAMSRIIIPELGHVVR.............. 164
178 5.000e-40UniRef50_A0A2V3JF95 Molybdenum cofactor biosynthesis protein n=1 Tax=ANME-1 cluster archaeon TaxID=2056316 RepID=A0A2V3JF95_9EURY  ali  35  6..........RHREGARQYYKCAILTISTSRHKNRDISGSVARSLVTERGHEVVYYDVIPDIEERIYKGIMNAQDSG-AEFIVTTGGTGLSKDDVTIETVSKLMDKELPGFGELFRLKSYEQIGTAAILSRAIAGVIGSNAVFCLPGSPDAVRLALAEIILPEIPHIMR.............. 166
179 5.000e-40UniRef50_A0A1U9K9H9 Molybdenum cofactor biosynthesis protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1U9K9H9_9BACL  ali  29  6....................RVGVVTVSDRCGERKDEAGPLLKERVKRMDGEVSEYTVVPDEVDAIERTLITLADAEQCDLVITTGGTGFALRDVTPEATKRVIRRNVPGIPEMMRMETRKKTIMSA-LSRSVAGIRGRTLIVNFPGNPQAIEECFDVI........................ 145
180 5.000e-40UniRef50_A0A1V6BUW7 Molybdopterin adenylyltransferase n=1 Tax=Spirochaetes bacterium ADurb.Bin133 TaxID=1852909 RepID=A0A1V6BUW7_9SPIR  ali  23  1...................MTILVLTVSDRRGEKEDLTGPELVKYLKNKGDNSVYYDIVPDEKDAIKEKILSYIKERKIRVVLTCGGTGFAKRDVTPEATRELIEKEAPGVAEFMRIENFKNNK-NSFLSRGVCGVLNDTVIVNLPGSPNGALESYKIIEKLLSHCLGLINGDIKNCA..... 160
181 6.000e-40UniRef50_I1DV52 Molybdenum cofactor biosynthesis protein B n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=I1DV52_9GAMM  ali  37  9................FYPLNIAVLTVSDSRNTNNDSSGDLLCQLLQSADHQLVARSLLPNNKYQLRAALSQWIASDNIQVVLINGGTGFHHTNCTVEALTPLLDTPVPGFGELFRQLSFNQLGSAAMQSGALAGLANGTLLFAMPGSGGACTLAMQQLILPQLDSKTGPCNFVAHV...... 169
182 6.000e-40UniRef50_A0A2M9VGP9 Molybdenum cofactor biosynthesis protein B n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A2M9VGP9_9PSED  ali  48  8...............AFVPLNIAVLTVSDTRSFDTDTSGELLASRAMEMGHRLVARELLKDDLYKIRAQVAGWIAEDDVQVVLITGGTGFTGRDSTPEAVACLFDKHIDGFGELFRALSILDIGTSTVQTRALAGLANGTLVCCLPGSTGACRTAWEGILAEQLDARHRPCNFVAHL...... 169
183 7.000e-40UniRef50_A0A0K2GB33 Molybdenum cofactor biosynthesis protein B n=10 Tax=cellular organisms TaxID=131567 RepID=A0A0K2GB33_NITMO  ali  35  4......PSHKEHKHRAPKSVSCMVITCSDTRTPETDTSGQLIQKLLKENGHTVAAYHLVKDEPAQIKDRIAEGTANDTVQAIIINGGTGISRRDSTFEAVDALLEKRLDGFGEVFRYLTYQEIGSPAIMSRATAGIIKGRVLFSTPGSENAVRLAMEKLILPELGHLVK.............. 166
184 8.000e-40UniRef50_A0A1F8T8R1 Molybdenum cofactor biosynthesis protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F8T8R1_9CHLR  ali  29  1...................MRAGVITASTARGERLDESGPAMREMLEASGAEVVSSALVVDDVNAIASAIRGAIA-KGANVVLTTGGTGLSPNDVTPEATRKVIEREVPGIAEAIRARSLAKTPHGMI-SRGIAGSVGSTLVVNLPGSPRAVRESLEVLLPVLPHAVELLAGESGE....... 157
185 8.000e-40UniRef50_A0A2V8U2E9 Molybdenum cofactor biosynthesis protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8U2E9_9BACT  ali  29  2...................IRVAVVTISDSAGTREDRSGPALRQRAAELGWNVAETRVVSDDASTISSTLRALADADTVDVVLTTGGTGVSARDVTPEATRAIADRDVPGFGELMRSEGRKLTRMA-PLSRGGAVTRAATLILNLPGSPRGAVDSLNIVVDLIPHVVDLLHGHTGHHAKL... 163
186 8.000e-40UniRef50_A0A1Q7E6I7 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium 13_1_40CM_66_11 TaxID=1805195 RepID=A0A1Q7E6I7_9BACT  ali  30  1...................MRIGILTISDAVGQRADTSGDAILDWAAEHGYEVVVRSVVSDETDRIAGKLARWADSNEVDVVLTTGGTGLTERDVTPEATATILEREAVGIAEALRAASGPGFPRA-WLSRGRAGTRGKTLIINLPGSTNGVNEGLAILAQFLDHAIELLTG........... 154
187 1.000e-39UniRef50_A0A2A6RGG0 Molybdenum cofactor biosynthesis protein B n=1 Tax=Chloroflexi bacterium Kir15-3F TaxID=2024553 RepID=A0A2A6RGG0_9CHLR  ali  36  6.......HEERAKAERSGALPCGVLTISDTRSPETDTSGSAIRAALTAAGHDVVRYGVVHDEPDVIVTLVKSYAAEG-CKLVITNGGTGIARRDSTIDAIETLLDKRLPGFGEIFRMLSYAEIGPAAMLSRATAGVHQGALIFCLPGSLAAVQLALEQLLIPQLDHL................ 164
188 1.000e-39UniRef50_A0A1F9LI63 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F9LI63_9DELT  ali  26  131.SGSVEPGDAIAMAPDLDQVHVAVVTLSDRRGEREDLSGPAIEEALEQHGHAVVTRIVMSDDRKTLEKKLIDLCEDDLCDLILTTGGTGLSSRDMAPEATRAVIDREIPGMAEAIRAKGLAHTHRAM-LSRAVCGQRGPTIIVNLSGSPKAATEQLGVILPVLSHAIQTASGIPQDCAR.... 313
189 1.000e-39UniRef50_A0A2V9VGC1 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9VGC1_9BACT  ali  23  246...................LTAAVVTVSDSRGEREDLGGPAVAAVLEKKGFRIVARQIVADDEPAIRDLLIRLCSQARF--VVTTGGTGIAPRDFTPEATRAVCDRVLEGVAERMRSEGAKHTKFAA-LSRSVCGIRGQVIILNLPGKPSGAVESLEAVVDLIPHALQLVSGDTSH....... 401
190 1.000e-39UniRef50_A0A1Z8MQ77 Molybdenum cofactor biosynthesis protein B n=2 Tax=Planctomycetaceae bacterium TMED10 TaxID=1986833 RepID=A0A1Z8MQ77_9PLAN  ali  36  17....................KVAVVTLSDTRTEKNDTGGDIIVELATKSGHQIVKRTLLKEDPQQITEAVQQLAIDPSVEVILMTGGTGISRRDNTYEIIAGMLTRQMPGYGELFRTLSYQEIGPAAMLSRAQAGLLEQTLLFTMPGSPGAVRLAMEKLILPELGHLLQ.............. 165
191 1.000e-39UniRef50_A0A2E5F5U7 Molybdenum cofactor biosynthesis protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E5F5U7_9CHLR  ali  29  4.....................AAILTIXDSQGKREDLSGLTIKRLLVEVGYDVVATAVVADEXXSISEILRXWADXXXVDLILTTGGTGLGARDVTPXATNNVLDWQVPGIAEAMRWATFQXTDRSI-LSRAVSGVRGHCLIVNLPGSPNGVEQCLQVILPSISHAIAVLSGNQGH....... 159
192 1.000e-39UniRef50_A0A2E7N575 Molybdenum cofactor biosynthesis protein n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E7N575_9CHLR  ali  35  34......................AVLTSSDTAGKRVDTSGDXVVEIMDXAGHSLVDRVMLXDDVDQLGQQILNWCDSEDVDIVLTTGGTGLSSRDLMPEVTRELIDLEIPGMAEAMRAESLKVTPMAMI-SRNVVGARGSTLIINLPGSTGGVRDNLXVVLPVIEHAVEVLQDRHSGEH..... 190
193 1.000e-39UniRef50_A0A0N9Y0Z9 Cyclic pyranopterin monophosphate synthase accessory protein n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A0N9Y0Z9_9ARCH  ali  25  144.................KKLEAAVITISDSRKKDQDESGKLIINTLTSNGFDIIDYKIIPDEIKLIEQELIYYSDKLKVNIIITTGGTGVGPRDVTPEATKKIIEKEVLGITENLRDYGQSRTPLSM-LSRGVSGIRGNTLIVNMPGSTTAVSQSISALFPGVMHIFRMIAGHGHH....... 301
194 1.000e-39UniRef50_A0A1S3ILQ0 uncharacterized protein LOC106165239 isoform X1 n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3ILQ0_LINUN  ali  27  4..........SSEMEHGTKIKIGILTASDSCGKAEDKSSANLKILIEDKKIKVVVQSCVPDDIEQIKEKLTIWSDALKLDLILTTGGTGFAPRDVTPEATKSILHKEAPGMTIAMIKASLDVTPLAM-LSRLVCGTRGSTLIINLPGSKKGSQECLEFVTPAIPHAVDLLQGNKENVVTTHTH 180
195 1.000e-39UniRef50_A0A1V4R5P9 Molybdopterin adenylyltransferase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1V4R5P9_9PROT  ali  28  2...................INIGIITTSDRRGTYEDISGKAIKQCIDSFNDIQYYYEVIEDEQTTIEKTLLDMADNIGCDLIVTTGGTGPAKRDVTTEATLNVCEKILPGFGELMRSTSLQYVPTAI-LSRQTAGTRGSSLIINLPGKPKSIKECLDVVFPAVPYCIDLIGG........... 157
196 1.000e-39UniRef50_R6WHT3 Molybdenum cofactor synthesis protein n=3 Tax=Bacteria TaxID=2 RepID=R6WHT3_9CLOT  ali  28  4....................TVAVLVASDSCGEREDKSGKAIVEIMKAANYKIESYDVVSDDLTAISAKLNEYV-NREINLVLTTGGTGFSSRDNMPEATKAVIDREAPGIAEAIRFSSFAITKKAM-LSRAVSGIKDKTLIINLPGSEKAVRESIDVILSPVEHGLDILLGLAHNC...... 160
197 2.000e-39UniRef50_I0XTH0 Molybdenum cofactor biosynthesis protein C n=23 Tax=Bacteria TaxID=2 RepID=I0XTH0_9LEPT  ali  25  150....................KAGILVCSDSQGKREDSSGKAILNLLKEHDVETVKSEILPDEPEQIRHRILEWSK-LGLDLIITTGGTGLGPRDNTPEAIKEILEQEIPGIAEAMRSFGQDRTPFAM-LSRSIAGRIGKTLVVSVPGSTNGATESLQAILPAVFHAKKMMRGE.......... 302
198 2.000e-39UniRef50_A0A142Y643 Molybdenum cofactor biosynthesis protein B n=1 Tax=Pirellula sp. SH-Sr6A TaxID=1632865 RepID=A0A142Y643_9PLAN  ali  32  1MSE----STNQHRRTAGEQVTVAILTVSDTRSLETDGGGQLIEDLCHARGFPVCNRRIVKDERDAIRQAVLELLAERDCEAVLITGGTGLAARDCTVDAVEGIYDSAIPGYGELFRMLSYQEIGSASMLSRASGGRIGTKIVLTMPGSTAGVRLAMEKLILPELPHLVMHAGK.......... 169
199 2.000e-39UniRef50_D3PL90 Molybdenum cofactor synthesis domain-containing protein n=8 Tax=Meiothermus TaxID=65551 RepID=D3PL90_MEIRD  ali  25  2...................IRVGILTISDRRGESEDHAYAALRESLALGPYEIANYEIIPDEPAQIKRVLRLWADRDGLDVILTLGSIRLSNRDHAPEATREMLEKEAPGIAELIRMETYKKNPLAA-LSRGVAGVRGKTLIINLPGGPQGSKDSLEVILPLIPEAVQRITGRP......... 157
200 2.000e-39UniRef50_A0A1T4K5Y2 Molybdenum cofactor synthesis domain-containing protein n=1 Tax=Cetobacterium ceti TaxID=180163 RepID=A0A1T4K5Y2_9FUSO  ali  23  2...................IRTAIITLSDKKGEREDLTGKVLREYIENHKYKMEYYRLLPDDYNNIVRELEFLADNDMVDLVITNGGTGFSKRDVTPEATIIAMEREVPGVAEYMRMKSMEITPKGM-LSRGVCGIRKNTVFLNLPGSPKGAMENLSFVIDTLIHGIEILKGEASECAEPME. 166
201 2.000e-39UniRef50_A0A2E8SDT7 Molybdenum cofactor biosynthesis protein n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8SDT7_9CHLR  ali  30  7...................YKFGVLTISDSSGSRKDVSGDLAVKVMISLGYKPVYRDIVPDQIDLISSKLIEWADSGEVDAIITTGGTGVSPRDRTPEATKLVIDYEIPGIPEAIRIVTREFTEMSM-LTRGLAGIRSKCLIVNLPGSPKGVEQGLEVISQVMRHAIA-LCQDTDQMH..... 165
202 2.000e-39UniRef50_Q1I6J3 Molybdenum cofactor biosynthesis protein B n=79 Tax=Bacteria TaxID=2 RepID=Q1I6J3_PSEE4  ali  49  3..........VKPDAVFVPLNIAVLTVSDTRTFDNDTSGELLATRSVQIGHRLVDRVLLKDDLYKIRAQVATWIADEQVQVVLITGGTGFTGRDSTPEAVDCLLDKRIDGFGELFRALSILDIGTSTVQSRALAGLANGTLVCCLPGSTGACRTAWEGILAEQLDARHRPCNFVAHL...... 169
203 2.000e-39UniRef50_A0A0C9SC32 Putative molybdopterin biosynthesis protein (Fragment) n=2 Tax=Ixodidae TaxID=6939 RepID=A0A0C9SC32_AMBAM  ali  28  1....................RTGILTVSDRCGQAEDTSGRNLEEIVNSINGLVAIRQCVPDDAELIKRTLVSWSDVEKLDLILTTGGTGFSARDVTPEATRAVIMKEAPGITIAIIQKSLSVTPMAM-LSRLVCGIRSQTLIINLPGSRKGAQECFEFASPAIPHAVDQLQERKAKTDKLH.. 165
204 3.000e-39UniRef50_A0A2H5XPX8 Cyclic pyranopterin monophosphate synthase 2 n=1 Tax=bacterium HR19 TaxID=2035414 RepID=A0A2H5XPX8_9BACT  ali  30  131.....KKGGKSDFIEVSDDFRVGVLVVSDSAGKKEDKSGKIIVEKLKEFGVKKIDYKIVPDEKDMIYNEVKKWCD-DGYDLVITTGGTGLSPRDTTPEAVEPLIEKEIPAIMESARAYGQERTPYSM-LSRGIAGVHRKTLILTLPGSSRGAKESMDALFPYIFHIYPMLRG........... 300
205 3.000e-39UniRef50_I2CRJ2 Gephyrin (Fragment) n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=I2CRJ2_NANGC  ali  32  38..GATLPS-GLLPAPSPIEITVALLTVSDRAGVYEDKSGPAMAHVLTSEAFRVVQSDIVPDDIPQIQQKICIWADELKVDAIFTSGGTSFAPRDLTPEAVRPLIDKEAPGMVWRIMEVGTKHTPFAV-LSRPVAGVRGGTFIVTLPGSPKAVKENLDTLLPLLP................... 206
206 3.000e-39UniRef50_A0A1X9SMU5 Molybdopterin adenylyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A1X9SMU5_9PROT  ali  29  2...................IKIGVLTLSDRAGVYADESGIAIQNILKEWGEINFTYRVIPDEYDLITANLIQMC-EIGCDIIFTTGGTGPALRDVTPEATEKVCQKMLPGFGELMRSVSLKYVPTAI-LSRQSAGIRDKSLIVNLPGQPKAIKECLEPIFPAIPYCLDLI............. 154
207 3.000e-39UniRef50_D4HZH1 Molybdenum cofactor biosynthesis protein B n=99 Tax=Bacteria TaxID=2 RepID=D4HZH1_ERWAC  ali  39  6..............SDFIPLNVAVMTVSDRHSADSDSSGSYLQEALAAVGHQVLDRAIVPDNRYRIRAVVSSWIASTDVQVVLINGGTGFNDTNATPEAIGPLFDREVAGFGELFRMISWEDIATSTLQSRALAGIANGTLIFAIPGSTAACQLAWERIIQHQLDARTRPCHFVSHLKKT... 171
208 3.000e-39UniRef50_A0A2C9KKV6 Uncharacterized protein n=3 Tax=Panpulmonata TaxID=977775 RepID=A0A2C9KKV6_BIOGL  ali  26  9...................INVGILTISDSCGSATDRSGENLKHLVETIKGTVVTKDIIPDELDQIKAKLLHWSDHLKLDLILTTGGTGFAHRDVTPEATKAVLEKEAMGLTVAMLKGSLDITPMAM-LTRLVCGSRGSTLIINLPGSTKGSSECFQIASVAIPHAVDLLRGHKYQVERTH.. 174
209 4.000e-39UniRef50_D5EEI1 Molybdenum cofactor synthesis domain protein n=1 Tax=Aminobacterium colombiense (strain DSM 12261 / ALA-1) TaxID=572547 RepID=D5EEI1_  ali  26  58..........SSEIETWRSLRVGVLTVSDKAGLRDDTAGPALSRAVILIGGIVEEQSIVPDEKETIEKKLRHWVDQKDLHLILVTGGTGLSERDVTPEALEAVAHRKIPGIGEFMRSRTVYYTPRSI-LSRGLAVTRGKSLIIAVPGSQKGALECFEAVVPVLRHGVEILRDWEKEC...... 225
210 4.000e-39UniRef50_A0A2E3RBU5 Molybdenum cofactor biosynthesis protein B n=2 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E3RBU5_9PLAN  ali  32  14.................RRGNVAVVTLSDTRTEHNDSGGDTIVELTTRSGHLIVNRLIXKEDPVQMKQAIEQLADDPTVQVILITGGTGISRRDHTYETIAEMLTRHLPGYGELFRMLSYQEIGPAAMLSRAQAGLLGQTLLFTMPGSPSAVRLAMEKLVLPELGHLLQ.............. 165
211 4.000e-39UniRef50_Q11VG4 GTP cyclohydrolase subunit MoaC n=27 Tax=Bacteria TaxID=2 RepID=Q11VG4_CYTH3  ali  29  146.....KTGGKSGQKYFNTPPKCAVLVCSDSTGKREDRSGKKIIEILNEHGITAAAYDIVPDERIHIQEKIRAWV-NEDYAYIFTTGGTGLGPRDKTVEAVKELLERDADGIAEAMRVYGQMRTPLAMM-SRAVAGAINETLIVTLPGSSNGVRECLEAIMPAVFHARKMMKG........... 312
212 5.000e-39UniRef50_A0A2D6NAL9 Uncharacterized protein n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6NAL9_9CHLR  ali  27  4..GHAHKGHQHGHGEQRSGVAVGILTCSDRRGERADVGGPTIHNVVLDRGAKVAQYKVVPDDREQISSTLAAWADDERLDLILTTGGTGLAPSDVTPEATHAVIDRAVPAFSMAMLFESLRVTPYAM-LTRAAAGIRGKTLIVNLPGNPKAIQENLDAIIEVLPHAVQVVRGEDTH....... 180
213 7.000e-39UniRef50_A0A2V7KUA9 Molybdenum cofactor biosynthesis protein n=4 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7KUA9_9BACT  ali  30  17...................IRIGILTISDAVGQRADTSGDAILDWASERGYDVVVRSVVADETDRIAGKLARWADSNEVDVVLTTGGTGLTARDVTPEATAAILEREAEGIAEAIRAASGPGFPRA-WLSRGKAGTRGKTLIVNLPGSTNGVKEGLTVLDKFLDHAVDLISG........... 170
214 7.000e-39UniRef50_A0A2E7D7T4 Molybdenum cofactor biosynthesis protein B n=5 Tax=Bacteria TaxID=2 RepID=A0A2E7D7T4_9PLAN  ali  36  11.....RAAGGVQ------ALGFAIVTLSDTRDESSDKSGQAIREMIEQQGHQVVQYAVVKDDRELVEAELQRALNNLDVAIIVTNGGTGISLRDSAFEAIAGRLDKTLDGFGELFRMLSYEEIGAAAMLSRAVGGIANGKVVFSLPGSTKAVRLGMEKLILPQAGHLYHELHKHQQ....... 175
215 8.000e-39UniRef50_Q4FML7 Molybdenum cofactor biosynthesis protein B n=331 Tax=root TaxID=1 RepID=Q4FML7_PELUB  ali  50  3...................VNIALLTVTDTRTFENDKSGAILVKKIEEAKHKLIDRKICKDNKDDIIKILKDWINQSEIDVVITTGGTGLTGRDITPEAVNEIADKHIPGFGEVFRTISLKTVGTSTIQSRACAVLANGKYVFALPGSSGGVTDAWDGILKHQLDINHKPCNFVELFPRLKEK 166
216 8.000e-39UniRef50_A0A1Q2KUR9 Molybdenum cofactor biosynthesis protein B n=13 Tax=cellular organisms TaxID=131567 RepID=A0A1Q2KUR9_9BACL  ali  39  9.................RALRIAVLTVSDTRNEQTDKGGPLVQELALAAGLEIGAYEIRKDDTTAIREVLAEWLQREDLDAVVTTGGTGIANRDVTIEAVRPMLQKELDGFGELFRFLSYAEIGTKALLSRALGGTAAEKAIFVLPGSTGAVRLAMERLILPEIHHIMKELTKHRQ-PRV... 171
217 8.000e-39UniRef50_D8K021 Molybdenum cofactor biosynthesis protein B n=9 Tax=Bacteria TaxID=2 RepID=D8K021_DEHLB  ali  31  6...........HKEASPTSVSFGIVTVSDSRTEDTDESGRYLTDVLLEHGHSVNGYQLIKNNGEAIHRVIEKFIGHPEIQIIIFTGGTGISHRDLTVETITPLFKKQIPGFGELFRYLTWQEIGTASIMSRAIAGVIDNKVFLCLPGSLNAVKLALESIILPEAGHLIREA............ 165
218 8.000e-39UniRef50_A0A284VMM7 Molybdenum cofactor biosynthesis protein B n=2 Tax=Candidatus Methanoperedenaceae TaxID=1392996 RepID=A0A284VMM7_9EURY  ali  31  7...........HKENLPSSYRCAILTISTSRYEAEDVSGKLIWGMLQVQGGQIVHYELIPDNIEMIRDALKN-CLYSEADVIILNGGTGISPQDVTIEAVMPFFEKEMPGFGELFRYKSLEQIGNAVILTRAIAGVARQKAIFCLPGSPNAVKTALELVLPEMGHIIKHAKG........... 176
219 8.000e-39UniRef50_A0A1B6J1L7 Uncharacterized protein (Fragment) n=1 Tax=Homalodisca liturata TaxID=320908 RepID=A0A1B6J1L7_9HEMI  ali  28  4..................PYSIGILTVSDRRGETEDESGPYLRRAIEELNSPIFVLKCVPDEVSEIEGTLKEWADVRKLDAVFTTGGTGFAPRDVTPEATRNVIEKEAPAIPSAILYQSLAKTKMAM-LSRAVCGVRKKCLIINFPGSKKAVGECLDVVIDCVPHALALLRDNT......... 163
220 9.000e-39UniRef50_A0A136L0W2 Molybdenum cofactor biosynthesis protein B n=7 Tax=Bacteria TaxID=2 RepID=A0A136L0W2_9CHLR  ali  30  4........AEHRRLAGNAPVTIAIVTVSDSRTPETDTNYHYLKRRCDELGHMVAGYRLIKDEPDQVEAALRDFAAMPAVRLILFNGGTGISPRDTTYDVISRMLEKTLPGFGELFRILSFNEVGAAAMLSRATAGVFQSTLVFSTPGSPNAVEVAFERLILPEINHLA............... 163
221 9.000e-39UniRef50_J9YZH6 Molybdenum cofactor biosynthesis protein B n=3 Tax=unclassified Pelagibacteraceae TaxID=1655516 RepID=J9YZH6_9PROT  ali  44  2..........INESIPFKQINISVITISDTRNKDTDKSGAYLVKAIKEKNHKCEDYEIINDDPDGIIKTISEKSINKNIDVIITTGGTGLTGRDNTVHSVKSIAEIEIPGFGELFRQLSYQKIGTSTIQSLASAFLVNKKYVFCLPGSVSAVKDAWNDILFYQLDIRHKPCNFIELIPRLDE. 173
222 1.000e-38UniRef50_A0A218QLM8 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Tolypothrix sp. NIES-4075 TaxID=2005459 RepID=A0A218QLM8_9CYAN :_  ali  32  71..................SVTCAVVTVSDTRTSETDKSGQLIQQLLFNANHGVGAYTIIKDEPAQIQEQIQLLGKNANLDVVIFNGGTGIAPRDTTYDAIEKLLSKTLPGFGELFRFLSYQEIGSRAIASRAVAGIFEDKLIFSVPGSSNAVRLAMEKLILPELVHLVTQMGK.......... 225
223 1.000e-38UniRef50_A0A1F9YT40 Molybdenum cofactor biosynthesis protein n=1 Tax=Euryarchaeota archaeon RBG_13_57_23 TaxID=1797977 RepID=A0A1F9YT40_9EURY  ali  36  2.......GVEEHKSKSPKSVKFAVLTVSNTRVDADDFSGKVIIELLTSAGHKLARKVIVKDDIQGIQQALRDFIEDSSVQAIIVNGGTGVAKADVTLEAVAHFEEKQLPGFGELFRTLSHQEIGSAAMMSRASAFVSEGKPVFCIPGSEKAVRLAVTKLIEPELGHL................ 161
224 1.000e-38UniRef50_A0A0A8HMW1 Molybdenum cofactor biosynthesis protein B n=93 Tax=Bacteria TaxID=2 RepID=A0A0A8HMW1_STAHY  ali  40  2..........HTNVNIGRAIRCAVLTVSDTRTTETDKGGQLVLQLLGEHNTHVTEYKIVKDDISAIQSQVTTWLDEG-VEVIITTGGTGIAQRDCTIEAVKPLLQKEIEGFGELFRYLSYAEVGSRALLSRAIGGSIGTQLVFCLPGSTGAVTLGMKKLILPELNHLIHELNK.......... 166
225 1.000e-38UniRef50_A0A1W6BKH0 Molybdenum cofactor biosynthesis protein B n=1 Tax=Staphylococcus lutrae TaxID=155085 RepID=A0A1W6BKH0_9STAP  ali  41  9.................RAIRCAVLTISDTRTVETDKGGQCVQDLLKTIDCEIEHYTIVKDEQKAITQQLEKWL-TEEIDVIVTTGGTGIAPRDVTIEAVVPLLDKEIEGFGELFRYLSFEDVGTRALLSRAVAGTSNKKLIFCLPGSTGAVKLALNRLILPELTHLVYEMNK.......... 166
226 1.000e-38UniRef50_H5SML8 Molybdenum cofactor biosynthesis protein B n=2 Tax=Candidatus Bipolaricaulota TaxID=67810 RepID=H5SML8_9BACT  ali  34  4.........HSGAEHTVKSVVCWIITVSDTRDESTDTSGKLIRERLESAGHRVALYRIIKNDPAQITEMVEQLKTDTHVQVVIFHGGTGISRKDQTARTLKKLYDEELDGFGELFRMLSYHEIGPYALLSRASAGIISKKLVFSLPGSEHAVRLALEKLILPVLHAVRQL............. 165
227 1.000e-38UniRef50_D2Z8P7 Cyclic pyranopterin monophosphate synthase n=3 Tax=Dethiosulfovibrio TaxID=47054 RepID=D2Z8P7_9BACT  ali  24  157........DGLERNGDLPEITVAVLTVSDKQGEREDRSGPALCRAVEELGYTVQDRAIVPDEKDVIADRIVKWVDEEDVHMVLITGGTGLSSRDVTPEAVMSIADREVPGLGERMRSYSLNFTDRAV-LSRGLAVTRGGSLILAMPGSVRGAIQCFQAVESVIGHGLETLRGRSGDC...... 326
228 1.000e-38UniRef50_A0A0A1NFE5 Putative Molybdenum cofactor biosynthesis protein gephyrin n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0A1NFE5_9FUNG  ali  28  3...................YTVGVLTVSDTASNDADKSGPTIVEILSKDKYSVEKQLIVPDEIRDIQKTIETWTDQYNLNLILLTGGTGFAERDRTPEAIKPLLTRETPGITHLLLSSSLSITPFAA-LSRPVTGIRNKSMIITLPGSPKACKENMEAVLKVLPHALDLLSN........... 156
229 2.000e-38UniRef50_F8D564 Molybdenum cofactor synthesis domain protein n=31 Tax=Euryarchaeota TaxID=28890 RepID=F8D564_HALXS  ali  34  10.......STDDHGHDVIDPLCVGIVTVSSSRAQADDPGGDTIRECFEDEGHEVQERVLVRDDYSAIRTAVRGLVARRDIDVVLTTGGTGVTADDVSPEATSSLFERELPGFGELFRSLSWEEVGTRAMASRATAGIAVDTPVFCLPGSKSACRTACEELIVPEAPHLAGLA............ 178
230 2.000e-38UniRef50_A0A101EUV3 Molybdopterin adenylyltransferase n=4 Tax=Thermotogaceae TaxID=188709 RepID=A0A101EUV3_9THEM  ali  24  1...................MRVAILVVSDRVGQMIDKNAEIVKRLMGQIGGTIEVEWIVPDEVDLIKEKLLKLC-EAQFDVVITCGGTGVSPRDVTPEATMNVIEKRLYGLEMAMMLEAMKHTP-AAVLSRAVVGVRKETLIINLPGSPNAVEQNLKAILPAIPHGLEKIKGSTRDCHQEGER 164
231 2.000e-38UniRef50_A0A0F5X5K3 Molybdenum cofactor biosynthesis protein B n=37 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0F5X5K3_STACC  ali  36  2..........HTNVKLDRNIRCAVLTVSDTRDYETDKGGKLVKELLSTLNVMITHYKIVKDEQTVITEQLKHWLAED-IDVIITTGGTGIAQRDVTIEAVSSLITKEIEGFGELFRYLSYEDVGTRALLSRAIAGTVNNKLIFSIPGSTGAVKLALNKLIKPELNHLVQ.............. 162
232 2.000e-38UniRef50_K1QYH1 Gephyrin n=2 Tax=Crassostrea TaxID=6564 RepID=K1QYH1_CRAGI  ali  25  9..............DKRPAIHIGILTVSDRCFEAIDESSKNLYTLIQDLQGNVVVTKIVPDEGDQIKSTLVEWSDQRGLSLILTTGGTGFSPRDVTPEATKAVLEKEALGMTLAMLKQSLEVTPLAM-LSRLVCGIRGRTLIINLPGSVKASEECLRFVCPGIPHAIDLLKDKTEEI...... 175
233 2.000e-38UniRef50_A0A1G1LR13 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=6 Tax=Bacteria TaxID=2 RepID=A0A1G1LR13_9BACT  ali  28  131.....KKGGKSDYKEVPGGFKAAILVTSDHKGIRADKSGKLIQERLESFGIQLL-YEILPDEKELIRAKLVKWC-EEGVRLILTTGGTGLGPRDVTVEATREIMEREIPGIMEAGRAYGQNRTPYAM-LSRGLAVQRGNTIIINLPGSSNGVRETLNAIFPAILHAYPMMGG........... 297
234 2.000e-38UniRef50_A0A2H6GJ45 Molybdopterin adenylyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H6GJ45_9BACT  ali  27  3...................IKGGVMTLSDRRGEYEDLSGPAIIEGMSSLNIRWGKSVVLPDEESLIAATLTDWSDEAGLDLILTTGGTGPSPRDRTPEATRAVLDFEIPGIPESLRAAARDRVPTA-CLTRGIAGVRGRTVIINLPGSPKAVRESMAVLLPFLLHLIEEVKGDPTKC...... 161
235 2.000e-38UniRef50_C7NNK1 Molybdenum cofactor synthesis domain protein n=3 Tax=Halobacteria TaxID=183963 RepID=C7NNK1_HALUD  ali  39  1........MGDHHHHDRRAVDVAVLTISTSRSLDGDDSGDAIVAAIEDAGHTVTARDLVGDEIGVIRERVETFADREDVDVISTTGGTGVTDDDVTIEALRPLFERELPGFGERFRARSVEEAGPHAMLTRATAGIVDDVPVFCLPGSESAAAFGTAELVTPMLGHLVGLLSEPE........ 167
236 2.000e-38UniRef50_A0A127MUG4 Molybdenum cofactor biosynthesis protein B n=63 Tax=Proteobacteria TaxID=1224 RepID=A0A127MUG4_9PSED  ali  46  3..........VKPNAEFVPLNIAVLTVSDTRTFDNDTSGELLASRSMEIGHRLAARVLLKDDLYRIRAQVAAWIADDDVQVVLVTGGTGFTARDSTPEAVTCLLDKQVEGFGELFRALSILDIGTSTVQTRALAGLANGTLVCCLPGSTNACRTAWEGILAEQLDARHRPCNFVAHL...... 169
237 2.000e-38UniRef50_A0A136M2D2 Cyclic pyranopterin monophosphate synthase accessory protein 2 n=5 Tax=Bacteria TaxID=2 RepID=A0A136M2D2_9BACT  ali  29  131.....KKGGKSAWKEKFTPPRGAVVVMSDTAGKKSDTAGLAIVDRLKKDGVEVIDYRIIPDEPEQIKQLLIKYSDADQLDLVITTGGTGLSPRDFTPEATAEILDREAPGIIQAAIAYGNERTPRAM-LGRGKAGARGKTLIINLPGSRKGTEESLDALFPSVLHALKMIAG........... 299
238 2.000e-38UniRef50_A0A1F2ZLI3 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=2 Tax=root TaxID=1 RepID=A0A1F2ZLI3_9PROT  ali  31  154.SHTVLKAIQPQIEQVLSGRKSVVITLSDRRGEYEDQSGVILKEILLSYGAEISDYAVIPDDKETIKSKIQSSIKSLTPDLIICTGGTGVSKRDVTPEAVGELFEKKIPGVGELIRSDGAKYT-TLSWSSRAVAGIVGKTLIVTLPGNPKAVREAMSALMPKLIPHLIKIT............ 324
239 2.000e-38UniRef50_UPI0009A9E0B8 LOW QUALITY PROTEIN: molybdopterin biosynthesis protein CNX1 n=1 Tax=Zea mays TaxID=4577 RepID=UPI0009A9E0B8  ali  29  264...................VKVAILTLSDTVGAGPDRSGPRAVSVVNSSGATVVAPAVVLDEVDKIKDILIQWSDIDHVNLILTLGGIGFTPRDITPEATKTVIHEEAPXLTFVMHQESLKITPFAM-LSRATAGIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGKREKHPRHTPH 434
240 3.000e-38UniRef50_A0A0S3QRC9 Molybdenum cofactor biosynthesis protein C n=17 Tax=Aquificae TaxID=200783 RepID=A0A0S3QRC9_THET7  ali  29  139.......GGKSEWFDDLKGLKAAVITVSDSAGKTKDLSGPAVSQLLEKYGATIIGKVTVPDDKERIKEAILQFTD--KANIIVTTGGTGVSPRDVTPEASSELIEKELPGLSEATRIFGVKSTPRA-LLSRAKAGIINNCILINLPGSVRGATESLQIAIPLIKHALKMARGEK......... 305
241 3.000e-38UniRef50_A0A101FMX2 Molybdenum cofactor synthesis domain protein n=1 Tax=Synergistales bacterium 54_24 TaxID=1635272 RepID=A0A101FMX2_9BACT  ali  29  112..................PITAGVLTVSDSRGERIDTAGPALAKLLPRIGARAIERAIVPDEIEEITSVLREWSSGSKVDLILVTGGTGLSPRDVTPEALMSVGDRVVPGLGEYMRWATSLSAPRSI-LSRGIAVTKDKSLIMALPGSEKGATECFKVLMPVLRHAVEILSGRGGECA..... 272
242 3.000e-38UniRef50_A0AHG1 Molybdenum cofactor biosynthesis protein B n=52 Tax=Listeria TaxID=1637 RepID=A0AHG1_LISW6  ali  36  2............EQKAFIKVTCSILTISDTRNLTTDTSGRLIQSQLELAGHQVISRVIVPDDAALIKQKMNDLATNGSFCLI-TNGGTGIARRDITYEALFATIQQEIPGFGEIFRMLSYEEVGSRAMVSRAFAGFSNGLLIFALPGSSNACKLAMEKLIIPELPHL................ 156
243 3.000e-38UniRef50_UPI0005590284 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Deinococcus misasensis TaxID=392413 RepID=UPI0005590284  ali  39  6...........HQQQAPRVVRVAVITISDTRTLENDHSGNHLVAEIEKQGHQVVGRTIVKDEKDQIQAAFERF--MPEAQVIISSGGTGITGRDVTIPVVESLIDKPMPGFGELFRMLSYQQVKGAAMLSRAVGGLAGKTLLFALPGSLNAVQTGWEGLLRDELAHLA............... 160
244 3.000e-38UniRef50_B5Y839 Molybdenum cofactor biosynthesis protein B n=4 Tax=Coprothermobacter TaxID=68335 RepID=B5Y839_COPPD  ali  27  8...................ITCSILICSDRRGEREDKTGPVLKETLERLGYHVHDVKVVPDELDVIVDQLKEWV-RLGMDLIITSGGTGVGPRDVTPEATIKVIEREIPGMSFAALMLSLQKTPHAV-LSRAKAGVAGTTLIINLPGSTKGAQEIIEYLDPALKHAVPIIHGEV......... 162
245 3.000e-38UniRef50_A0A1T4WIM6 Molybdenum cofactor synthesis domain-containing protein n=5 Tax=Desulfovibrionales TaxID=213115 RepID=A0A1T4WIM6_9DELT  ali  26  85.TDLVLPKGEISCPCTKEGFSVAWIILSDSRGEREDKCGPLIADAVRQLDLSLMQGYLIPDDEAQLRQLLSELAHLQKFDLILTSGGTGVGPRDISPEATLKVLDKRLPGYERAMTLASLQKTPHGAI-SRAVAGTIAQSLVVNLPGSPKAVAENLEAVLPTLKHTMEKLQGDPSDCARL... 265
246 3.000e-38UniRef50_A0A2D7PJE0 Molybdenum cofactor biosynthesis protein B n=4 Tax=Bacteria TaxID=2 RepID=A0A2D7PJE0_9DELT  ali  37  9.AGGPKPGHHSHPHRKQAFAEVAVVTVSDTRTLETDTGGALVADFLKEAGHPIAGRSIVADEPDQIASALQAALADEKVRAVVLTGGTGVAPRDVTPDTVEPLLERIIPGFGELFRQLSYEDIGSAALLSRAVAGLCRGRVVFVIPGSRGAVRLAMEKLIIPELGHLAGEA............ 180
247 3.000e-38UniRef50_A0A174B8Y6 Molybdopterin adenylyltransferase n=31 Tax=Actinobacteria TaxID=201174 RepID=A0A174B8Y6_9ACTN  ali  29  3...................LKISIVTCSDTRDLLQDEAGAALEELIEAQGWTVASHVVVRDDVSEIGDAIVEAADECHANVVLTCGGTGLSMRDVTPEATRAVCDRDVPGIAEAIRAYSMTKTRRAM-LSRAVCMQRGHTLVINFPGSTKAARESWEAVSDQLEHAAQMTAG........... 154
248 3.000e-38UniRef50_A0A2H6JVT1 Molybdenum cofactor biosynthesis protein B n=1 Tax=archaeon BMS3Bbin15 TaxID=2005738 RepID=A0A2H6JVT1_9ARCH  ali  35  10...........HRALAPEKLNAAVVTVSDSKGEIKDESGRLLIDGIEKAGNEVVFYSIIPDHKELIKALVDFIVERYSPDFIVTTGGTGISPRDVTIEAIMELYDKNLEGFGEYFRARSFDDIGSAALLSRAGAGVYNGCLIFSLPGSPNACKFGMKIIAREASHLVKHVR............ 187
249 3.000e-38UniRef50_A0A2V2RJH2 Molybdenum cofactor biosynthesis protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V2RJH2_9BACT  ali  28  3...................YNVVVITVSDHAGQRDDKSGPALVTALQAVKLHVLASAVVPDDEQAIIDVFQKYTEQEDVHLIVTTGGTGFGPRDVTPEATRHVIDRPAPGIAELLRQAGAQQTQL-TWLSRAEAGIAGNKLIINLPGSPKAMEHSIRTLQPILFHALDLLNGAKPH....... 160
250 4.000e-38UniRef50_A0A1W9LGH3 Molybdenum cofactor biosynthesis protein B n=3 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1W9LGH3_9DELT  ali  33  2.......GVNEHKKNTPGRIRIGVISVSTTRSEENDESGDWIKKTAIKEGHDIVFYKVVPDDVYGITETIGKAIHDRNAQALLLTGGTGITGKDVTIEAVRPLFEKELTAFGPLFCQLSFEEIDSAALLSRATAGVIGKTIVFCMPGSLKACKLACKNLIFPELGHLVKHVFEE......... 168
251 4.000e-38UniRef50_O34457 Molybdenum cofactor biosynthesis protein B n=249 Tax=Bacteria TaxID=2 RepID=MOAB_BACSU  ali  35  2.......SVQEHKQEAPDIVRCKVITVSDTRTDETDKSGKLMISFLEEAGHHIAAYEIVKDEKDALQRSVLAGCMDEQTDAVLLNGGTGIADRDVTIEAITPLFSKELPGFGEIFRMLSYEDIGSAAIMSRATAGVIQHTAVFSTPGSSGAVKLAMNKLIIPELAHVVR.............. 164
252 4.000e-38UniRef50_Q6W4C2 Cinnamon (Fragment) n=5 Tax=Cyclorrhapha TaxID=480117 RepID=Q6W4C2_DROME  ali  30  1...........................SDTCWQEPDTSGPILRQLIGETFANTVIGNIVPDEKDIIQEELRKWIDREELRVILTTGGTGFAPRDVTPEATRQLLEKECPQLSMYITLESIKQTQYAA-LSRGLCGIAGNTLILNLPGSEKAVKECFQTISALLPHAVHLIGDDVSLVRKTHA. 157
253 5.000e-38UniRef50_UPI000852D40C MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852D40C :_  ali  37  7..........MHKELGPKTANFFIITVSTSRYPYTDESGDTAEAMVKESGHRVVGRELIKDDIEMIRNLVRSLASRGDVDVIVLTGGTGLARSDVTIEALRPLFEKEMEGFGDIFRYVSYSKIGTGAIMTRATAGVINGKLVVALPGSPDGVKTGLEIILQELPHILYIIR............ 174
254 5.000e-38UniRef50_A0A218P8U9 Molybdenum cofactor biosynthesis protein n=1 Tax=Thermococcus pacificus TaxID=71998 RepID=A0A218P8U9_9EURY  ali  41  2.......GAEEHKRKALRRFKFAVVTVSDTRGEKEDKSGKFLVEELEKNGHEKVYYAVVPDEKMEIVGAVIS-AFRAGADVVVTSGGTGIAQRDVTIESIRPLFDKELTGFGEIFRLLSYEEIGTAAVMSRATAGIIKSSVVFCLPGSLGAAKTGIKIILNEAGHVL................ 166
255 6.000e-38UniRef50_A0A2D5WB57 Molybdenum cofactor biosynthesis protein B n=3 Tax=Planctomycetes TaxID=203682 RepID=A0A2D5WB57_9BACT  ali  34  2.......GLEQHRNEAPLALGFAVITVSDTRDETTDRGGAYLAAGLEAAGHRVVRREIIKDDAQAIVDAVRRAVGDSQVDLVLTTGGTGISVRDVTFDTLRGLFDSEIPGFGELFRWLSREEIGSATILSRAVGGLLERKVVLALPGSPKALRLALEEIVLPEAGHLVGQA............ 165
256 6.000e-38UniRef50_A0A2M6ZSQ7 Molybdenum cofactor biosynthesis protein n=1 Tax=Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_38_7 TaxID=1973971 RepID=A0  ali  28  6...................LKIVILTVSDRASKYEDLSGPTARESLEKIFAHIFELKIVPDELNMIKESLTDYV-ERKFDFVFTTGGTGIGPRDVTPEATRKVIDKEIDGISEAMRSYSLQITKNAM-LSCATAGISKDTLIINLPGSPKAVHEIIDYLGNTLKHAYYMMCG........... 161
257 6.000e-38UniRef50_D4H3M7 Molybdenum cofactor synthesis domain protein n=2 Tax=Deferribacteraceae TaxID=191394 RepID=D4H3M7_DENA2  ali  22  147...................FSVAVITLSDSKGERVDETGPAVVKLLEDLNVAFTRTEILADEQAKLEETLKYYADLQKYDLVVTNGSTGVSPRDIAPDATLNVIDKRIPGFEEAMRAESMKVTDRAMI-SRAVVGARKNTMIVNVPGSPKGAIENLQVILKTIPHCIEKLQGSKEDCAR.... 308
258 6.000e-38UniRef50_A0A254X4P8 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254X4P8_9CYAN  ali  33  1...................MKAAVITISDTRGRATDESGPAAQAALNSLGFDASHLVLVPDEAGEIQSLVKSLA--GVFPLIVTSGGTGAGPRDVTPEAISPLFDKTLPGFGEIMRIGSFEKTPMSII-SRGGAGVIGQCLVVMLPGSPRGVRECLD-LVGPAIKHLMKAIQGGGQCH..... 157
259 6.000e-38UniRef50_F9DRM9 Molybdenum cofactor biosynthesis protein B n=10 Tax=Bacillales TaxID=1385 RepID=F9DRM9_9BACL  ali  42  13.................KSIAVAVLTISDSRTEADDKSGKIIREKLEDAGHQVKEYAICSDEGEQIVQHLTDWLADSSIQAMIFTGGTGIGARDITVETVAPYFTKPLDGFGELFRFLSYEDVGSKALLSRAAAGAIGLQVVFLLPGSSKAVALAMDKLILPELPHIAH.............. 165
260 7.000e-38UniRef50_A0A1G3L9E6 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_27_13 TaxID=1802173 RepID=A0A1G3L9E6_9SPIR  ali  22  1...................MKIALVIASDRRGERDDLTGPLVIEYLKKDKNEV-FYQIIPDEKDIIKQTLLDFV-GKNVNLILTSGGTGFAKRDVTPEATKEVIEKEAPGIAEYMRAENAKNSK-NSFLSRGICGIKNETLIINLPGSPNGALECYKIVEPLLNHAIQLLTNSIKDC...... 157
261 7.000e-38UniRef50_A0A2M8NDB0 Molybdenum cofactor biosynthesis protein B n=8 Tax=Bacteria TaxID=2 RepID=A0A2M8NDB0_9CHLR  ali  33  13.................TPVTVAIVTVSDTRTPETDGNKQYLEARLTELGHRIAAYRLIKDEPDQVETVLDELAEMPTVQIILFNGGTGIAPRDTTYDVVSRKLTKVLPGFGELFRMVSYDEVGAAAMLSRAIGGVYGDKLVFCMPGSTNAVQTAMEKLIIPQMNHLA............... 163
262 7.000e-38UniRef50_A0A1Q9N6G3 Molybdenum cofactor biosynthesis protein B n=1 Tax=Candidatus Odinarchaeota archaeon LCB_4 TaxID=1841599 RepID=A0A1Q9N6G3_9ARCH :  ali  31  5.........EMHKQGAPSKISFAIVIVSDSRYTIDDATTPLIKDLIYKNGFTVHSTHYIPDERSEITKKLIQLL-SSNVNVILFSGGTGLAKRDVTVETLEPLFEKKIPGFGELLRNLSYEKISSAAMLTRSTAGILKDKIIFCLPGSPDAVKLALEKLILPECGHILK.............. 170
263 7.000e-38UniRef50_A0A1M3DSW7 Molybdenum cofactor biosynthesis protein MoaC n=1 Tax=Alphaproteobacteria bacterium 43-37 TaxID=1895707 RepID=A0A1M3DSW7_9PROT :_  ali  30  184....................KAAILVMSDRAGVYADESGSYLKKLLADAGAEVMAYEVVPDHKDSIAQAIVDICKSSKPDLLLASGGTGPGPRDVTPEVLASISDRMLDGLGDILRAESLHYTDTA-WLSRMTAGMIGATLLIALPGSPKAVRECWEILSPFLSDALEKI............. 334
264 7.000e-38UniRef50_A0A291P7E0 Molybdenum cofactor biosynthesis protein B n=13 Tax=Bacteria TaxID=2 RepID=A0A291P7E0_9GAMM  ali  53  1................MIPLSVAVLTVSDTRTEETDRSGQALVERLTAAGHRLAEKRIVPDDVYRIRAVVAAWIADPAIQVVLTTGGTGFTGRDSTPEAVSVLLDKRIEGFGELFRQLSWHEVGSSTVQSRCLGGLANATVVFCLPGSTGACRTGWDGILAEQLDSRHKPCNFANLV...... 161
265 7.000e-38UniRef50_A0A0G2ZFI0 Cytoplasmic protein n=5 Tax=Kosmotoga TaxID=651456 RepID=A0A0G2ZFI0_9BACT  ali  27  1...................MRYFILVLSDKAGLRKDECIEAVKSVFNNANFELIGAEILPDELEQIKRKLEELADSGKADLIITSGGTGVSPRDVTPDATLKVIEKRIQGMEYAMIMEALKHTPMGSI-SRAVVGIRSKTLIVNLPGSPKAVKENLNAIINAIPHAIEKLKGAEGDC...... 159
266 7.000e-38UniRef50_UPI0003609ABA MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Coprothermobacter platensis TaxID=108819 RepID=UPI0003609ABA  ali  30  11.................SSLSCCILICSDRRGEREDKTGPLLVAKAEELGYAVKELRILPDERQLIAEQIRRWCELP-VDLILTSGGTGVGPRDVTPEATMDVVDREIPGIPLMALMFSLKSTPNAA-LSRAKAGVIQQTIVVNLPGSPNGASDIFQLIDPALKHAI................ 160
267 8.000e-38UniRef50_UPI000C319F6A gephyrin-like isoform X1 n=2 Tax=Amphiprion ocellaris TaxID=80972 RepID=UPI000C319F6A  ali  30  16....................RVGILTVSDSCYKAEDRSGVNLKDLVHDLGGVISAYKIVPDEIDEIKETLLEWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQ.............................. 152
268 8.000e-38UniRef50_A0A143PHT6 Molybdenum cofactor biosynthesis protein B n=54 Tax=cellular organisms TaxID=131567 RepID=A0A143PHT6_9BACT  ali  35  31...........HRAASPTSVRCAILTISDSRTLETDTGGAAIVSLLEAHGHTVVARGLVKDDPSAVQDWIQHQRSRDEVDAILTTGGTGVAQRDNTHEAIMAMLDKPIPGFGELFRMLSFQEIGAAAMLSRACAGVSQCRVVIALPGSEHAVRLAMDKLVLPEIGHLVREA............ 190
269 9.000e-38UniRef50_A0A0G2ZUG1 Molybdenum cofactor biosynthesis protein MoaB n=10 Tax=Cystobacterineae TaxID=80811 RepID=A0A0G2ZUG1_9DELT  ali  36  65.......SGPVAEHKAHAPVHVSVVTCSDSRDESKDESGRVLRELLEAEGHSVSGYRVIKDEPESIRAMLKE-AQESGARAVIFNGGTGIGRRDSTVETLQGLFEKTLPGFGELFRMLSFQEIGSAAMMSRATAGTYQGMILFSLPGSPKAVRLALRKLILPELHAVRELT............ 230
270 9.000e-38UniRef50_A0A1P8W8Q8 Molybdopterin adenylyltransferase n=84 Tax=root TaxID=1 RepID=A0A1P8W8Q8_9PLAN  ali  30  1................MRAAAIGILTVSDRRGEYEDRGGPAIRDYLTDVLASTGIPVVVSDEQPDIEAALRKLAAEG-CGLIITTGGTGPAARDVTPEATEAVCEKMMPGFGELMRKVSLEKVPTAI-LSRQTAGILGSSLIVNLPGQPKAIAECLDAVFPAIPYCIDLIGG........... 158
271 9.000e-38UniRef50_A0A1S0TJS1 Uncharacterized protein n=2 Tax=Loa loa TaxID=7209 RepID=A0A1S0TJS1_LOALO  ali  25  1...................MRIAILTVSDSSGTREDISGPLLRQLIFDSNIISVKNFLVSDEKQEITNMLINLCKT--FDVIISAGGTGFSPRDVTPEATQSVIEKKCGGLETALHIRSLQATPFAA-LSRLCAGIRGSTLIVNLPGNPKAVKECFEVLEKILPHAVELLN--TEDVHNVTKH 164
272 9.000e-38UniRef50_A0A2A4RN34 Molybdenum cofactor biosynthesis protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2A4RN34_9BACT  ali  28  3................PSAFRCAVLTVSDRAGEYEDKSGPALATFINDSLHQVVESACIPDEEDQIAEQLQRWVDTPTIDLILTTGGTGLSPRDHTPEAAMRVIDRPHPGLLELARSKTAEITELA-YLSRGVAGAAKNTLIITLPGSPKGAIEQIEAIQTVLVHALKTLQGDRTLH...... 166
273 9.000e-38UniRef50_A0A0H2RAU2 Molybdenum cofactor synthesis domain protein n=1 Tax=Schizopora paradoxa TaxID=27342 RepID=A0A0H2RAU2_9HOMO  ali  30  2..................SFRVAVLTVSDTASKRADKSGPLIRDLIQPHSFVVADSRIVPDNESVVKAVVATWCSSGNIDWIITTGGTGFGEHDRTPEAIKALLEREAPGLVHLLLSSSISHTPLAA-LSRPVAGSIGRTLVVTLPGSTKAVRENLTCLLESGILRLGQLI--PDHSPR.... 161
274 1.000e-37UniRef50_A0A0B6ZCH0 Uncharacterized protein (Fragment) n=5 Tax=Bilateria TaxID=33213 RepID=A0A0B6ZCH0_9EUPU  ali  24  27...................IKVGILTVSDSCGTAIDRSGENLKHLVESGKHTVVTKDILPDEFDQIKAKLLHWSDHLKLELILTTGGTGFSLRDVTPEATKAVLERESLGMVVAMLKGSLDITPLAM-LTRLACGTRGRTLIINLPGSMKGSAECFQIVCTGIPHAVDLLRDHKSGIVKTHN. 193
275 1.000e-37UniRef50_A0A2T2WGA1 Molybdenum cofactor biosynthesis protein n=2 Tax=Sulfobacillus TaxID=28033 RepID=A0A2T2WGA1_9FIRM  ali  27  2...................MRIAILTSSDARGEREDLSGQKLIQWARQLG-DVEDVKLLPDEPELLEEQLWQWV-RRGFDLVLTTGSTGLGPRDVLPEVTRQVIDREIPGMAEAMRAESLKHTPFGM-LSRQVVGLAEKTLIINFPGSPQAIDELWPVVSPVVPHIVDLINGHTRH....... 157
276 1.000e-37UniRef50_A0A1I8B836 Uncharacterized protein n=2 Tax=Tylenchoidea TaxID=33284 RepID=A0A1I8B836_MELHA  ali  26  1...................MKFCVLTVSDSSSQNPDKSGPLLVELLLNSSAQLIDYKIVPDDKKEISDYLQ--INTTKADCILTTGGTGFAKRDVTPEATKEVIERECPGIVTSLLVGGLRSTPFAA-LTRLAAGITGNCLIINLPGSPKAVQEGFIILEEILPHAISLLKEDFNEIKKTHE. 167
277 1.000e-37UniRef50_A0A2E5LWA7 Molybdenum cofactor biosynthesis protein n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E5LWA7_9CHLR  ali  31  3....................RIAILTVSDTTGTRIDHGGDLIEGRCSKAGHDVVIRAALPDDPEAISTQLAAWCDTNITDVILTTGGTGLTPRDLTPEATRAIAERDVAGIPLAIAQQGLKQTPYAI-LSRGLAVTRGSTLIVNLPGSPNGVADGLEVLFPLLSHIAELLAGPVEH....... 159
278 1.000e-37UniRef50_UPI000DCE9031 molybdopterin adenylyltransferase n=1 Tax=Helicobacter sp. 15-1451 TaxID=2004995 RepID=UPI000DCE9031  ali  30  1................MDTIKVGILTCSDRAGTYQDESGKAIEECLRRYIRNPIFYIVCRDELEQITKHLCAFSDEQHCDLIVTTGGTGPAKRDVTPEAMEHVCDKMLPGFGELMRQISLLSVPTAI-LSRQTAGVRDCSLYVNLPGKPSSIQECLEAVFPAIPYCIDLIGG........... 159
279 1.000e-37UniRef50_A0A286RA85 Molybdenum cofactor biosynthesis protein MoaB n=1 Tax=Thermogutta terrifontis TaxID=1331910 RepID=A0A286RA85_9PLAN  ali  30  3.................TPFRVAVLTCSDRRGESEDRSGPALVQFVREWSAEVLAAACLPDDADLICRQILTWAEAPPPDLILTTGGTGLGPRDVTPEATRRILDRPWPAILELARLRCLPQTPLA-YLSRGEAGVVRRSLVINLPGSPRGALETLAAIADVIPHAIAMLHGEGHE....... 164
280 1.000e-37UniRef50_L0HP30 Molybdenum cofactor synthesis domain protein n=1 Tax=Aciduliprofundum sp. (strain MAR08-339) TaxID=673860 RepID=L0HP30_ACIS0  ali  34  2.......GVKEHKKHSYR-LKIGVITVSSTRNEETDESGKIIMDEVEKHGHEVCEYAVVKDSKLEILHALLNFL--PKCDAIVLNGGTGMSRKDVTVDSIEGILDKKLPGFGEIFRLKSYEEIGTAAMMSRALAGVCCGKLIFAIPGSKGAAKTGCQVIFSEINH.................. 156
281 1.000e-37UniRef50_A0A2D7H2A2 Molybdenum cofactor biosynthesis protein B n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D7H2A2_9BACT  ali  38  1..........MSHSASNTQASVAILTVSDTRSIEEDASGAIAIEQLKDAGHCIVHREIARDEVDEITRFVLKWASDRQVDAIFVTGGTGPSTRDVTPDALVPMMSAILPGFGELFRQLSYEEIGSASMLSRAEAGWIDRTPVFLLPGSPNAVTLAMSKIIVPQLGHLLDVCSLEP........ 169
282 1.000e-37UniRef50_A0A2K3UUU3 Molybdenum cofactor biosynthesis protein n=3 Tax=Deinococcus TaxID=1298 RepID=A0A2K3UUU3_9DEIO  ali  40  43....AQASAQQHRDAAPRSARVAVVTISDTRTAETDTSGQYLMEQLRAGGHEVVGYRVVKDDAVEIRAALVQYA--REAQIVLSSGGTGITGRDVTVPVVESLLTKQIPGFGELFRMLSYQQVGGAAMLSRAVGGLCRGAAVFAMPGSLNAVKTAWEGILRDELSHL................ 203
283 1.000e-37UniRef50_A0A136K986 Molybdenum cofactor biosynthesis protein B n=10 Tax=Bacteria TaxID=2 RepID=A0A136K986_9BACT  ali  30  1...................MRIAILTISDTRLLEDDASGERLAELAAGI-ASSVTRDVVTDDLEAIVEKLRELCDSGEVDCILTTGGTGIASRDNTPEATRAVIERESPGIAEAMRRETAAKTPFAM-LSRAVSGIAGHTLIVNMPGKPNAVEECFEVIRPVLKHAVELLHGRTAH....... 155
284 2.000e-37UniRef50_UPI00082C1A4D bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=1 Tax=Rufibacter roseus TaxID=1567108 RepID=UPI00082C1A4D :_  ali  30  156.................SAPVCAVLVCSDSAGKREDNSGKIIKEMLQEANAQVKYYQVLPDEKKQIQQQIRAWVAED-VQFIFTTGGTGLGPRDNTVEAVRELLERDADGIAEAMRAYGQMRTPLAMM-SRGVAGSIGQSLVVTLPGSSNGARESLEAILPAVFHARKMMKG........... 310
285 2.000e-37UniRef50_A0A060LWP9 Molybdenum cofactor biosynthesis protein B n=4 Tax=Bacillus TaxID=55087 RepID=A0A060LWP9_9BACI  ali  32  1..........MHHSNDVVHATIAIVTLSDTRTVAEDKSGQLIRQLIDDR-HKVGSYTLIPDDPQLLTSNLLELVADPEIDVILCNGGTGMSKRDYTYATIKPLLDKELVGFGEQFRQQSYKEIGVKGLFSNAIAGTINETALFALPGSSNAVKLGMETFILPMLPHLLG.............. 158
286 2.000e-37UniRef50_A0A2V8BFP9 Molybdenum cofactor biosynthesis protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2V8BFP9_9BACT  ali  36  50...........HKALAPQFVRCFIVTVSDTRTEETDSSGRAIADLLAAAGHEVAGRAIVRDDPDLVRRTIERQLANPLVQVILTTGGTGITSRDSTYETVSALMQKRLDGFGELFRMLSYEQIGPAAMMSRACAGLVAGRIVVSLPGSEAAVRLAMERLLIPELGHLVQQA............ 209
287 2.000e-37UniRef50_A0A1F9VD02 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_12_FULL_39_28 TaxID=1797951 RepID=A0A1F9VD02_9BACT  ali  28  17...................IRVGILSCSTSRGPKEDISSKVLQEILKSKGFKISCYSLVPDKKEKISSVLKTWADQKKCDLIFTTGGTGFSQSDCTPEATDSVIEKEAPGLSELMR---LKSKSPFAYCSRGICGIRKKCLILNLPGSPKGVEESVKTVLPILPHSIEL.............. 174
288 2.000e-37UniRef50_H0UFE6 Molybdenum cofactor biosynthesis protein Mog n=29 Tax=Bacillales TaxID=1385 RepID=H0UFE6_BRELA  ali  24  1................MSGWKIGIITASDSIGEREDDRIQLVRGLVKQHLHENIIYRCLPDDMEELKEHMIELVDREKCDILITTGGTGLSPRDVTPEVTSWVIDRPVPGLAEEMRRAGLKQSRRAM-LTRAVAGTRGNSLIFNLPGNPKGVEVCFIAIADMLPDAVHILQGSEE........ 161
289 3.000e-37UniRef50_Q96Y52 Molybdopterin biosynthesis protein MoaB n=43 Tax=Archaea TaxID=2157 RepID=Q96Y52_SULTO  ali  34  1MSHA----HKKHKENAPKSLNFYVITISTSRYEIVDESGDIIKQLLIENGHKIIGYSLVPDDKIKILKAFTDALSIDEVDVIISTGGTGYSPTDITVETIRKLFDREIEGFSDVFRLVSFPEVKAAAYLTKASAGIIGKKIVYLLPGSPDAVKLALKELILPEVGHL................ 172
290 3.000e-37UniRef50_A0A0P9FYF6 Molybdopterin adenylyltransferase n=16 Tax=Archaea TaxID=2157 RepID=A0A0P9FYF6_9ARCH  ali  30  1MSDTAR----RHKAEAPKSLNFAVIVCSSSRYQEEDPSGDLIVKKLQKAGHTVVFREIVPDDKVLIRKYVSRALGSEGVDSIILCGGTGISPKDVSIEAVRPMLVKTLPGFGGLFRKLSFDEIGSAAVLSRALAGVADGKAVFCIPGSPQAVRLVLEKLILPEAGHILKHAREKQ........ 179
291 3.000e-37UniRef50_A0A164CHG1 Molybdenum cofactor biosynthesis protein B n=34 Tax=Bacteria TaxID=2 RepID=A0A164CHG1_9SYNE  ali  48  20...................LSIALLTISDSRTLENDPSGDLLQQRLIDAGHHLQTRAICPDDRYRIRALVSQWIVDSAVDVVITTGGTGLTGRDGSPEAIGPLLDKTIDGFGELFRMLSFQTIGTSSLQSRCLAGVANGTFIFVLPGSQDAVTTAWERLISAQLNSETRPCNLVQLRSRLKE. 182
292 3.000e-37UniRef50_A0A1F9U2K0 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_01_FULL_54_10 TaxID=1797945 RepID=A0A1F9U2K0_9BACT  ali  29  138...........HHLDGLSGKRAVILTLSDRRGIYQDLSGPVAREALKKIGFELAHCEIIPDELDLIAERLLNFCENLAPDLILTLGGTGLSHRDVAPEATERVIDRKIPGIAEMLRAQSFAKHPTSSFLSRAVAGLKSKTLIVNLPGKPAAVSENLNLLIPAFDHIFRMISGEGHESKALGQ. 310
293 3.000e-37UniRef50_A0A147K1H6 Probable cyclic pyranopterin monophosphate synthase n=1 Tax=Hadesarchaea archaeon YNP_N21 TaxID=1776333 RepID=A0A147K1H6_9EURY :_  ali  34  149...........HKKGAPERLNVAVITISDTRGKDEDVSGQLIEKKLREAGHTTT-RKIVPDEADQIKSTLEGFTSDPGIDCVITSGGTGITKRDVTIETIAPMFQKELPGFGEAIRKHGYERIGGAALLTRCAAGLINRKPVFCLPGAPNAVEVAMDIIIPELGHIVRHAR............ 314
294 3.000e-37UniRef50_G7VA23 Molybdenum cofactor synthesis domain protein n=4 Tax=Synergistales TaxID=649776 RepID=G7VA23_THELD  ali  32  106..........SESFEKWEPVNVAVLTVSDSRGEREDTSGPALGEAVVDIGGILQDRAIVPDEPKDILKVLRSWI-SRGYELILITGGTGLSPRDVTPESLADLEGKDVPGIGEYMRWRTSYYTLRSI-LSRCMAKVVERSLIIALPGSRKAALECFFAVSPVIRHAIEIVTGKATECA..... 273
295 3.000e-37UniRef50_I4BW49 Molybdenum cofactor synthesis domain protein n=2 Tax=Acetomicrobium TaxID=49894 RepID=I4BW49_ACEMN  ali  29  99..........SSEYEEWFPISLGVITVSDRRGELIDTSGPALENLARSIGAICQEYKIVPDDIDEIRRVVCDWCDKKSLNLILLTGGTGISQRDVTPEALLPLSDKIVYGIGEYMRWSTSLSNPMSI-LSRGIAVSRGKTLLVALPGSERGAIECFSAVSFSLRHAVEVLTDRHVHH...... 266
296 3.000e-37UniRef50_Q8ZY31 Molybdenum cofactor biosynthesis protein (MoaB) n=3 Tax=TACK group TaxID=1783275 RepID=Q8ZY31_PYRAE  ali  37  2.......AHEHHRRQGPSTARFYIITVSTSRYRERDESGDLAVEMAREAGHEVVGRDLIPDDMYVIRRRILELVSRDDLDVIVLTGGTGLTKTDVTIEAVRPLFEKEIEGFGDVFRYFSVQEVGAAAFLTRATAGVINGKAVFLLPGSPNAVKTGMKIILQEISHLLYLI............. 171
297 3.000e-37UniRef50_UPI000C08A903 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C08A9  ali  29  1..........MHHLHDVNHATVAILTLSDSRSKTEDKSGQLIQQLLEDH-HKIASYLLIPDDPQLLTSNLRSLEENHAIDVIICNGGTGISKRDNTHATIKSFIDKELHGFGEQFRQRSFEQIGVRGLFSNAIAGVVNNTAIFALPGSSNAVKLGMEEFIIPMIPHLLG.............. 158
298 3.000e-37UniRef50_A0A0F7JJ66 Molybdopterin-binding protein n=9 Tax=Deinococcus TaxID=1298 RepID=A0A0F7JJ66_9DEIO  ali  40  19.......SAGSHRGAAPQQVRVAILTVSDTRTPETDTSGQFLRAEIEAHGHEVVAYRVVKDDAVQIRSALV--AFTREATVVLSSGGTGITGRDVTVPVVESLITKPIPGFGELFRMLSYQQVGGAAMLSRAVAGLVRGAVVFAMPGSLNAVQTAWNGILKDELGHLA............... 177
299 3.000e-37UniRef50_P65406 Molybdenum cofactor biosynthesis protein B n=215 Tax=Terrabacteria group TaxID=1783272 RepID=MOAB_STAAM  ali  39  1.......MGEHQNVKLNRTVKAAVLTVSDTRDFVTDKGGQCVRQLLQADDVEVAHYTIVKDEKVAITTQVKKWL-EEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYEDVGTRALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHL................ 162
300 4.000e-37UniRef50_UPI000B542DBE bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=1 Tax=Francisella halioticida TaxID=549298 RepID=UPI000B542D  ali  28  180................FDKISCVSITISDRASAYEDKSGKVLSSILESQGAAMLEKKIIPDEKEIIKNTIINIVDQKNPNMIITTGGTGVSPRDVTPEAIGDICELQIPGVTELLRKDGEKYTPLS-WASRAVAGIYKKTLIVALPGNPNAVEEGLEAL-KHLLPHLVRTMNK.......... 336
301 4.000e-37UniRef50_A0A1B9ENS3 Molybdopterin adenylyltransferase n=51 Tax=Actinobacteria TaxID=201174 RepID=A0A1B9ENS3_9ACTN  ali  27  22.TGAALPSGGPEPTGALSPYTALVVTASNRAGVYADKGGPLIAEALTGLGFTVDGPQVVPDGDPVEAALRAGVAA--GYDVIVTTGGTGISPTDATPEATRRVLDHEIPGIPEAIRAEGLAKVPTAA-LSRGLAGVASRTLIVNLPGSTGGVKDGLAVLGRLLVHAVDQLRGGDHPRP..... 199
302 4.000e-37UniRef50_K0NDR3 Molybdenum cofactor biosynthesis protein B n=9 Tax=Proteobacteria TaxID=1224 RepID=K0NDR3_DESTT  ali  33  2.......STHLHKKDAPNHIKIAVISVSTTRGLSEDKSGAWIKKQAKKEGHEVVIHQVVTDEIEAIRELTEHITQKICPDAIIMSGGTGISPKDVTIEAVKPLFKKELTAFGPLFAQLSFEEIDSAAILSRATAGIIQQSIVFCMPGSIKACKLACNELIFPELGHLLK.............. 163
303 5.000e-37UniRef50_A0A1D8JJS0 Molybdenum cofactor biosynthesis protein B n=1 Tax=Lysinibacillus sphaericus TaxID=1421 RepID=A0A1D8JJS0_LYSSH  ali  35  5...........HEYSKDQPLALAVLTVSDTRHLENDRGGNTIRQMLESEGHQILESSICKDEKQEIEEVIEKWLENPNVQGIVTTGGTGLGFRDITPETIEPYFTKHIKGFGELFRMLSYEDVGSKSLLSRAEAGIVEDKVIYILPGSVKAVELAMKKLVLPELHHV................ 161
304 5.000e-37UniRef50_A0A239P439 Molybdenum cofactor synthesis domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A239P439_9ACTN  ali  32  1...................MRALVITASNRAGIYEDKSGKLLVELLAEAGCDVEGPRVVPDGAPVESALWSGVA--EGYDVIVTTGGTGLTPADLTPEMTARVIDREIPGIAEAIRQVSRDKVPTSI-LSRGLAGQTGNTLIVNLPGSSGGVRDGMAVLSPVLRHAVDQIRG--GDHPR.... 157
305 5.000e-37UniRef50_A0A2E5JWN8 Molybdenum cofactor biosynthesis protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5JWN8_9CHLR  ali  28  7...................YTVGILTISTSSGNRVDKSGPTLRDMISSEDFNVTLEKIIPDDFELITATLINWS--ELTNLILTTGGTGFGKDDVTPEATEKILDRKSIGLSELMRRETYKFSPMSS-LSRGISGTLGSCLIINLPGSPQGAKESLSVIQNLIPHILETM............. 156
306 5.000e-37UniRef50_A0A2L2YLI1 Gephyrin (Fragment) n=3 Tax=Entelegynae TaxID=74971 RepID=A0A2L2YLI1_PARTP  ali  25  1...................YSVGVLVISDTVGEKIDLSGNNLLQLLKSFPVSTILEECVPDDLDKIQEKMKQWVDSKNIDLILSVGGTGFSIRDVTPEATKGIIDREAPHLASRMILGCCEKTPFAV-LSRSVCGMRGQSLILNLPGSKKGSQECFEMIANVLPHALDQLKGKIKKVMKLH.. 166
307 5.000e-37UniRef50_A0A2A4VHY2 Molybdenum cofactor biosynthesis protein MoaC n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2A4VHY2_9PROT  ali  32  182...................LKAGVLVMSDRAGDYEDKSGAVLVEILKRAGAELASYEVIPDDAQTIAEKLHSICKTYQPDLLIASGGTGPGPRDITPEVLTEVCDRMLDGLGDYMRAESLHFTDTA-WLSRMSAGMCGSTLVIAFPGSPKAVKECWDIIAPFIGDALAKI............. 333
308 5.000e-37UniRef50_D2RV30 Molybdenum cofactor synthesis domain protein n=3 Tax=Halobacteria TaxID=183963 RepID=D2RV30_HALTV  ali  35  14...........HGHDIIDPLYVGIVTVSSSRAQADDPGGDTIQECFEDAGHEVQERLLVRDDYSAIRTAVRGLVARRDIDIVLTTGGTGVTADDVSPEATASLFERDLPGFGELFRMLSWEEVGTRAMASRATAGIAVDTPVFCLPGSTSACETACEELIVPEAPHLAGLA............ 178
309 5.000e-37UniRef50_A0A0L7LT49 Uncharacterized protein n=1 Tax=Operophtera brumata TaxID=104452 RepID=A0A0L7LT49_9NEOP  ali  28  5.....................VAVITISDTCFKSKDTSGPAIADFIKDLFPEALHTIIIPDEKEIIERELKYFSDT-NLDLVLTTGGTGLSSRDVTPEATKAVIHREVPAISVAITLAGLKNTPMAM-LSRSVAGVREKTLIINFPGSKKAVIECFEVVKPVLAHAISLIHDELNEVRSIHN. 166
310 5.000e-37UniRef50_A0A0W1KKX5 Molybdenum cofactor biosynthesis protein B n=5 Tax=Actinomycetaceae TaxID=2049 RepID=A0A0W1KKX5_9ACTO  ali  30  2..................SISAAVITISDRAGKREDISGPTAVRYLEEAGVKVVTATVVHDDVRAIAEAVQTAV-YDEVDVVITTGGTGISPQDYTARAMDPLLRFDIPGIPEAIRYHGIKKGSPSAVLSRSRAGVRNRTLVVNLPGSVGGVTDGMEVIIPILPHAVDQMRG........... 160
311 6.000e-37UniRef50_A0A0Q9TR24 Molybdenum cofactor biosynthesis protein n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0Q9TR24_9BACL  ali  30  4....................KVAILTASDRRGEREDTSAQVIRELIEEEIQGEIIYRVVPDEMDEIMASLIEMTDYYQADLILTTGGTGLAPRDVTPEATLNVIDRVAPGFAEAMRMISMQKTRKAM-LSRAVSGIRGRTLIINLPGSPKGVQENLMAIIDQLPHALGILTGKEGDH...... 162
312 6.000e-37UniRef50_A0A1Q3MJD3 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MJD3_9BACT  ali  33  1...................MKIGVITISDTRSFEDDLSGPAVVNALREAGYTNFATAIVADDVGQIRQAIRHFA--EECNAIFTTGGTGFSPRDVTPEATVALLDRRADSLCELMRLKGLDHTPYS-HMSRGVAGTIGNTLVVNLPGSPSGATQGIEALSAVLVPILSNLAGD.......... 151
313 6.000e-37UniRef50_A0A0F7PCB5 Molybdenum cofactor biosynthesis protein MoaB n=11 Tax=Halobacteria TaxID=183963 RepID=A0A0F7PCB5_9EURY  ali  33  28......ATQHDHHAHDKTELGVGIVTVTSSRSLDADPSGDAIESALSGAGHGVVTRELVRDSRDVIQSVVDNLVGRSDVDLVVTTGGTGVSPDDVTVEAVGPLFEKDLPGFGEVFRSLSYEEIGTKVVGTRTTAGIANGVPVFALPGSENAVTLATEEIILPEASHLAGLRGREEDEH..... 201
314 6.000e-37UniRef50_A0A2N2JLV3 Molybdenum cofactor biosynthesis protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-14 TaxID=2013741 RepID=A0A  ali  48  116..............PTPRPVRIAVLTVSDTRTEATDRSGALLIERLTSAGHTLHSRRILPDDMTVLDSAVMALRADPTCEVVLATGGTGITGRDVTVDVFERHYTKPIVGFGELFRHLSYADIGASTIQSRASGGLAGTTLLFALPGSPSACALGWDQILAHQLDARSKPCNLVALMPRFDE. 283
315 6.000e-37UniRef50_M1WPX4 Molybdenum cofactor synthesis domain protein n=1 Tax=Pseudodesulfovibrio piezophilus (strain DSM 21447 / JCM 15486 / C1TLV30) TaxID=1  ali  24  101......................AWVTLSDAAGKREDKSGPLIAKLVEKLDLAFVQGFIIPDDPRQLKGLLADLALVQRFDLILTTGGTGVGPRDITPEATLSLIEKRLPGYERAMTEASLSKTPHGAI-SRAIAGTLSETLIVNMPGSPKAVAECLEPLLPTLKHTLEKLQGDSADCASL... 260
316 6.000e-37UniRef50_A0A094PLR3 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A094PLR3_9ACTN  ali  32  6.......................VITVSDRAGVYKDLSGELLAHGLIELGYEVTGRCTVKDDIPQITEALLSAV-QLKTNLIITTGGTGVSPKDLTPEATRPLIKIDIPGFSEALREFSRSKTPTA-DLTRGVAGINGNSLIVNLPGSPNAVRDGLVIVKRLAQHIHDQLAG........... 154
317 6.000e-37UniRef50_A0A2V2UE68 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2V2UE68_9A  ali  27  146.................RKLRAGVLVTSDSRRKRQDQSGRLLVDRLKKEGFDVTYYKVVPDNIGTIKTELTMLCDELKVDLVLTSGGTGIGSRDVTPDATSTILEKNLLGVAEILRAHGQRRTPSSM-LSRGVVGVRAKTIIVNLPGNVKGVSESLDSLFPGINHTFEVLENHK......... 301
318 6.000e-37UniRef50_A0A075FVD1 Molybdopterin adenylyltransferase (MogA) n=106 Tax=cellular organisms TaxID=131567 RepID=A0A075FVD1_9EURY  ali  31  10....................RFGVLTASDRAGDYEDLSGPAIERFLSEAPWEVVRC-LVPDEQALIEASLEELVDGDGCSVVVTTGGTGPAPRDVTPEATEVVCERMLPGFGEQMRAVSLRHVPTAV-LSRQTAGIRGSCLILNLPGSPRSIREILDEVFAAVPYCVDLIGG........... 164
319 6.000e-37UniRef50_A0A2H6HTM2 Molybdopterin adenylyltransferase n=9 Tax=root TaxID=1 RepID=A0A2H6HTM2_9BACT  ali  24  142........VEISRLVERKTIQAAVLTVSDSCGKATDTSGPAVSELLRELDAHVGWSGIVADEEKDISSILKDL-PSRKFDLIVTTGGTGFGPRDITPEVTRKIVDRDVPGFAEAMRAASARITDHA-WLQRGVCGIYRSTLIINLPGSKKGAVENLKSIINLIPHAIRHLRGDTHDH...... 311
320 6.000e-37UniRef50_A0A136LC83 Cyclic pyranopterin monophosphate synthase accessory protein 2 n=1 Tax=Armatimonadetes bacterium OLB18 TaxID=1617424 RepID=A0A136  ali  29  145..................SYRAGIVVASDRAGQYEDLSGPAAEERLLEFNIRTQSYTVVQDEVEAIRQSVVSMSDAEKLDIILIIGGTGVAPRDVTPEAVSPLLQVELPGIAEAIRSYGAERNPYAI-LSRSLAGIRGKSLIVCLPGSPHAVRESLLAVFPASLHVLDLL............. 297
321 8.000e-37UniRef50_UPI0008338B1F molybdenum cofactor biosynthesis protein MoaB n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI0008338B1F  ali  39  3...........TEHIKPIEITAVVITVSSTRTEENDTSGKAIRDLLTAGGYRVVFSVIVKDDRQAIRAALVTAL--GKADAVVLNGGTGLTPDDCTIEAVEPFFEKRMEGFGELFRMLSFDEIGTSALLSRATAGIVGGRAVFCLPGSTGAVTLATGKIIVPELRHI................ 156
322 8.000e-37UniRef50_A8XUF1 Protein CBR-MOC-2 n=5 Tax=Caenorhabditis TaxID=6237 RepID=A8XUF1_CAEBR  ali  27  4....................NFKIISVSDSAGTRVDESGPKLVELVDKATVNVGSPTVVPDDVKEIRKALLEKCKNSD--VIITTGGTGFSKRDVTPEATLEVIERRCNGMEIAMHTGSLKVTPMAA-LSRAIVGIRGGTLIINMPGSVKAVKECWEILEPVLNHALDLLKD........... 159
323 8.000e-37UniRef50_A0A0P7GDG1 Molybdopterin adenylyltransferase n=33 Tax=Halobacteria TaxID=183963 RepID=A0A0P7GDG1_9EURY  ali  35  20......PGTHDHHSHDRDELGVAVLTVSSSRTLDDDAGGDRIVDAMETAGHEVTTRDLVPDDYDKVQATVQRFVDRGDVDIVITTGGTGVTPDDVTVEAIDPLLAKELPGFGELFRRRSYEEIGTMVVATRATAGVADGVPVFAIPGSENAAALGAELIVSSAGH-LAGLAG........... 184
324 9.000e-37UniRef50_A0A2M7YYX3 Molybdenum cofactor biosynthesis protein n=1 Tax=Nitrospirae bacterium CG_4_9_14_3_um_filter_51_5 TaxID=1974062 RepID=A0A2M7YYX3_  ali  27  2...................IRVAVVVISSKIGQIPDENRKSLERILTNHQLTLLSYEVVADDRQTISRQLATLCEATAPQLILTIGGTGVRPTDWAPEATRDVIEKEIPGIGEAMRAASLKKVRTAM-LSRGTAGIKGNTLIINLPGSVKGVQENLDIVLPLLEHMVEKIGNMAAH....... 159
325 1.000e-36UniRef50_A0A136PBK8 Molybdopterin adenylyltransferase n=1 Tax=Chlorobi bacterium OLB7 TaxID=1619898 RepID=A0A136PBK8_9BACT  ali  22  7.......................IITVSDRAGERADLSGPEAAALLDEELFDIQRIDIIPDEMEKVIRAL-EGCVREDIALVLTTGGTGFAPRDITPEATLTVIDRRADGLTAAMRTASLKKTPFAA-LSRAVCGIARRTLIVNLPGSPKAVTECLAAIIPVLPHGLKLLRD........... 155
326 1.000e-36UniRef50_Q9ZIN3 Molybdenum cofactor biosynthesis protein B n=116 Tax=cellular organisms TaxID=131567 RepID=MOAB_STACT  ali  39  5...........EHVNVKRDIQCAVLTVSDTRTPETDKGGNLAKELLSEINVEIEHYAIVKDDKQAITEQLQQWLAED-VDVIITTGGTGIAQRDVTIEAVTPLLSKEIEGFGELFRYLSYAEVGTRALLSRAVAGTVGEQLIFSVPGSTGAVKLAMNKLIKPELNHL................ 164
327 1.000e-36UniRef50_A0A2D9D4V9 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB (Fragment) n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepI  ali  30  28...................LRAAVVVCSDTAGKKEDKAGKEIINKLEKCGVDIHDYQIIADEASLIKEKALSYVKE-NLDLIVFTGGTGLSKRDVTPEALEVLIQRKIPGMEEAIRAYGQERTPYSM-LSRSVAGTINQTLVLALPGSTNGAKESMDAIFPYALHVFAILKG........... 180
328 1.000e-36UniRef50_C1F8A1 Molybdenum cofactor biosynthesis protein B n=7 Tax=Acidobacteria TaxID=57723 RepID=C1F8A1_ACIC5  ali  28  5......................AVITVSDSRGEREDVSGPAVALALAEAGFSVILRRTVPDEVAAIQAELLGCLAQAR--LVVTTGGTGIGPRDVTPDATRPLCDRSLDGVAELMRSEGRQETIFSV-LSRAFCGTAGLSIILNLPGSPRGAVTSLRAVLPLLPHALRLLQGDTQHTARDQE. 165
329 1.000e-36UniRef50_A0A1I0EJ64 Molybdenum cofactor biosynthesis protein B n=11 Tax=Bacillales TaxID=1385 RepID=A0A1I0EJ64_9BACI  ali  36  13...................VHCMILTISDTRNVKTDKSGALMKELLENEGHIVTIHEIVADEQKAIEKQIEAGCKNPKVDVILTNGGTGIATRDVTIETVKPMLDKEMTGFGEIFRLLSYQEIGSAAILSRAIAGVRKSTAIFSTPGSSGAVRLAMERLIIPELHVVHELR............ 166
330 1.000e-36UniRef50_A0A1M7S5M4 Molybdenum cofactor synthesis domain-containing protein n=1 Tax=Desulfovibrio litoralis DSM 11393 TaxID=1121455 RepID=A0A1M7S5M4_  ali  30  107......................AVVTLSDAKGEREDTSGPLIEKLVQDLPLRHSKGYILSDESELLRVLLSDLALIQRYDLIITTGGTGVGPRDITPETMSKVLDCELPGFSVSMLVASLSKTPHAAI-SRAKAGLIGKSLVINLPGSPKAVEETLSVVLPAIKHTIDKAQGDPADCA..... 264
331 1.000e-36UniRef50_A0A2R6A7S8 Uncharacterized protein n=9 Tax=Candidatus Marsarchaeota TaxID=1978152 RepID=A0A2R6A7S8_9ARCH  ali  32  1MSSPQK--HKEEAKKAGIEPKIGIIVVSTSRYELTDESGDLAESLIKNSGFSVLSRKLVSDEKNQIRLALLKQLFEEGCNTCITIGGTGVSKRDVTIEAVRALLDKEIPGFAELFRQKSFESVGVSAITTRSIAGVIEGRAVFCLPGSPDAVRVALPLILQELSHIL................ 172
332 2.000e-36UniRef50_A0A2T2V4Q9 Molybdenum cofactor biosynthesis protein B n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2T2V4Q9_9BACT  ali  33  1MSHAEHPARAASFRE--QPIRCAIVTVSDTRTEETDRSGSLTRKRLRKAGHEVALYKIVPDEPDVIRRGIEQMAGSGEVDVALFSGGTGISRRDRTYDVLSEALDRKLPGFGELFRMRSYEEIGVGAMRSRAIGGVAGGTLFFSMPEALSAVKLALDELILPEL................... 162
333 2.000e-36UniRef50_A0A1I8CJN6 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8CJN6_9BILA  ali  27  2...................YKVSILTISDSCGTNIDKSGTRLTELISESYFQTVHYEVISDDKEAIQEKLINLVDEIKVDLIITTGGTGWSSRDNTPEATKFVIDKECNGLSTALMNMSLIKTPMAA-LSRLVCGIRKNTLIVNMPGKTKAVEECFECLSKVLEHGMAILKDNKSQI...... 163
334 2.000e-36UniRef50_G4RMP4 Molybdenum cofactor biosynthesis protein B n=26 Tax=TACK group TaxID=1783275 RepID=G4RMP4_THETK  ali  38  4........HEEHKAKGPQRASFWVVTVSTSRFEYTDESGDVAVRMIEAAGHRVAGRSLIKDDVVMIRSVLMDLLKRDDVDAVVFTGGTGIARSDVTVEAVRPLLDKEIDGFGDIFRLESYREVGTAAIMSRALAGIINGKLVVALPGSPNAVEVGLRIILPEVPHILYLAR............ 173
335 2.000e-36UniRef50_A9G1Z6 Molybdenum cofactor biosynthesis protein B n=14 Tax=Myxococcales TaxID=29 RepID=A9G1Z6_SORC5  ali  39  3................RSPVRVATLTLSDTRTLDDDEGGQLLGELLKRAGFSVTSHAVLREEPELLRAAIVQIADAGSADAVVTTGGTGIAPRDRTLEALAPLFEKTLDGFGEAFRRLSWDAIGPNAILSRAAAGVARGLVVIALPGSPKAVELAVTQIIGPVLHAVTLASGKGGHHHR.... 166
336 2.000e-36UniRef50_A0A1F5YF99 Uncharacterized protein n=2 Tax=Candidatus Glassbacteria TaxID=1817805 RepID=A0A1F5YF99_9BACT  ali  32  144.................RGLRAAVLVLSDSRGENEDTSGKVISARLAGAGFTLADYRVIPDEPALLRETLVRYADSDRLDLVLTSGGTGLGPRDSTPETTLALLQREVPGIEEAARAFGQRRTPLSM-LSRGAAGFRGQTLIVNLPGSVKAVTDYLDSLL....................... 287
337 2.000e-36UniRef50_A0A2P6TYE5 Molybdopterin adenylyltransferase n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TYE5_CHLSO  ali  25  26...................VRFGIVTVSDRAGVYEDQSGPAILQFFHEASKWQAVYRVIPDERPLIEQTLKDLCDTEGCSLVVTTGGTGPAPRDVTPEATEAVCERMMPGYGEQMRAISLRYVPTAV-LSRQTAGLRGKSLILNLPGKPKSIRETIDEVFVSIPACIDLLEGPYIETH..... 187
338 2.000e-36UniRef50_A0A1C6CQX7 Molybdenum cofactor biosynthesis protein B n=17 Tax=Firmicutes TaxID=1239 RepID=A0A1C6CQX7_9FIRM  ali  40  8.................RPLRAAILTISNSRTFSDDTNGLMIQSALTNRGHQVVDYAIVKDNKEDITRHIHEWVCS--VDVVITSGGTGIAKRDVTLEAIEPLFEKKIPGFSEMLTYFAYRRVGVQAMAYRATAGLVHQCMVFCLPGLPSLIKVGMEKIILPELFHL................ 156
339 2.000e-36UniRef50_Q1D8P7 Molybdenum cofactor biosynthesis protein B n=21 Tax=cellular organisms TaxID=131567 RepID=Q1D8P7_MYXXD  ali  42  7.......................IVTCSDSRDAARDESGQVLREGLEAAGHGIAGTLVVKDDPEAIRGAL-DAAREAGARAVLFTGGTGIGRRDCTVETLRPLFEKELPGFGELFRMLSYRQVGSAAMMSRATAGTYQGMILFALPGSPKAVRLALEALILPELGH................. 148
340 2.000e-36UniRef50_A0A1W9HED2 Molybdenum cofactor biosynthesis protein B n=2 Tax=Nitrospira TaxID=203693 RepID=A0A1W9HED2_9BACT  ali  32  3.....APTVHEHKALAPRSIGCMIITCSDTRIADTDASGQLIQKLLKDRGHTVVGYHLVKDDPAQIQLWIARAVTNEAVQALIINGGTGISRRDSTFEAVDAMLEKRLPGFGEIFRLLTYQEMGSSAIMSRATAGIIKGRVLFSVPGSEHAVRMAMEKLILPELGHLVQ.............. 166
341 2.000e-36UniRef50_C8WZL0 Molybdenum cofactor synthesis domain protein n=1 Tax=Desulfohalobium retbaense (strain ATCC 49708 / DSM 5692 / JCM 16813 / HR100) Tax  ali  27  94...............VRQGISLAWVTMSDARQEREDTSGPSIASILQTLSLSYIQGFVLPDDRDILRGVLHRLSFIDRFDLICTTGGTGVAPRDITPEATLAVLDKRLPGFEQVMTASSLAKTPHGMI-SRAVAGVAGQTLICNLPGSPKGVRENLESILPALQHTLDKIHGDPADCARI... 260
342 2.000e-36UniRef50_A0A1H0EMK5 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Desulfonauticus TaxID=206664 RepID=A0A1H0EMK5_9DELT  ali  22  70.........HSEFIVNRQGFTLAIITLSDKSNLRKDKSGPQIESMVEPLPLSWVKNYILPDNFSSLKYLLIHLAQFLGVDIIITTGGTGVYPRDITPEATLEVIEKRLPGFEQAMLFTSLQKTPHAV-LSRAICGICKKTLILNLPGSPKAVRENLESILPALKHCLEKIHGDPTEC...... 239
343 2.000e-36UniRef50_A0A1Q7X342 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 13_1_20CM_3_68_9 TaxID=1803475 RepID=A0A1Q7X342_9ACTN  ali  27  1...................MRAAIVTVSTSKSQGADESGDRLVELAARVGAQVAGREVIPDDRELISERLRHWADEESCALVMTSGGTGLAPTDVTPEATRAVIDREAPGIPEAMRLASRERARHWM-LSRGIAGIRGSTLIVNFPGSPASIPEAGEAIAGSLPHALALLAGERHPH...... 159
344 3.000e-36UniRef50_A0A0U3CIA0 Molybdenum cofactor biosynthesis protein B MoaB n=14 Tax=Methanobrevibacter TaxID=2172 RepID=A0A0U3CIA0_9EURY  ali  35  9...........HQDESSNNITCGIITLSDSRDKKEDLSGDYIENELKKR-YTVKSREIIKDEKDDLLKSIDEMI-NNNVDVILTNGGTGLSERDITVESVEKLFDKKIDGFGEIFRHQSYIEIGSGALLSRATAGVYKKCCIFSMPGSPNAVKTALNIIIDELPHIVHHA............. 165
345 3.000e-36UniRef50_A0A1U7U1T5 gephyrin-like n=4 Tax=Euteleostomi TaxID=117571 RepID=A0A1U7U1T5_TARSY  ali  26  16................................................LGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRD........... 138
346 3.000e-36UniRef50_E0QKZ1 Molybdenum cofactor synthesis domain protein n=16 Tax=Bacteria TaxID=2 RepID=E0QKZ1_9FIRM  ali  25  133..GIIKEGDEINKVPAKDKFSYAIIIVSDSQGLRQDGCKQKIVNVLKEYVYEMVDYIIVPDEIEDIKAAIKKNIDN-NTSLILTSGGTGFAKRDVTPEATLELIQRQTYGISEYIRAKSLEKTNRAI-LSRAVSGIANNSLIINLPGSPIAVEESLNFIIDPLKHGLEILLAKDAECAR.... 311
347 3.000e-36UniRef50_A0A2E3B0N8 Molybdenum cofactor biosynthesis protein n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2E3B0N8_9CHLR  ali  27  14.......................IITSSDRCGDMHDKSGELIEKIMKSSKFSLHSRVILPDEFSLLENQLIEFFDDERISLILTTGGTGLSKRDVIPEVTEKLIERKIPGISEIMRIESYKNNKMSI-LSRSVSGVKNNTLIINLPGSPNAIQENLNILISSIEHAVEIIMDSH......... 165
348 3.000e-36UniRef50_A0A1S7LK85 Bifunctional molybdenum cofactor biosynthesis protein MoaE/MogA n=2 Tax=Bacteria TaxID=2 RepID=A0A1S7LK85_9BACT  ali  27  192......AHRDHDGVASWPGLRVAILTLSDSRDLSRDKSGDALEGQVMGYGARVASRELLPDDAVAIAKQIKRWAEGGSVDLILTTGGTGPSPRDVTPEATRQVCDRELPGFGELIRSAGLEQTRTAVF-TRGVSAFCGPVLVVNLPGSTRGAVHSLEAVADLVPHALRMAVG........... 356
349 3.000e-36UniRef50_A0A0A1SKQ2 Molybdenum cofactor biosynthesis protein MoaB n=25 Tax=Bacteria TaxID=2 RepID=A0A0A1SKQ2_PAESO  ali  23  2...................FNVSIITLSDSKGEREDITGEKLIKFINNKDYKVKYYNMIPDDKELLKSEIIKLC-NSNIDLILTNGGTGFSKRDVTPEATKEVIEREIPGISEYIRMESSKIVKRAI-LSRGISGIRNNTVIINLPGSPKGAIESIEFVIDIIGHGIEILKGEAVECA..... 161
350 3.000e-36UniRef50_A0A1V5DZA0 Molybdopterin adenylyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5DZA0_9DELT  ali  28  1...................MKVTVITISDRRGIYEDLSGPAIEKILQDNLENIVARIVVPDEKDEILKALRAAASSD---FILTTGGTGLSARDITPEICREYCDRELPGIAEALRSESYKETPHA-LLSRGYAGMKDKTVIVNFPGSVKAVTLCTKILIPVMGHAIKMINNE.......... 153
351 3.000e-36UniRef50_A0A0J0UV19 Molybdenum cofactor synthesis domain n=1 Tax=Actinobacteria bacterium IMCC26207 TaxID=1641811 RepID=A0A0J0UV19_9ACTN  ali  27  67.AGAELASGGSDHVTAQAGPRVAVLTVSDRAGEYEDLTGPAVEAVATSRMATVVLRAVVADDRSEILRILTEWCEGDQVDLILTNGGTGLARRDVTPEATRQILDVEAPGITELMRAAGLEHTPLAA-LSRQVAGRRGRTILLNLPGSVRGATESLEAVVHILGHACETARSGEP........ 249
352 3.000e-36UniRef50_A0A1W2BUW7 Molybdenum cofactor biosynthesis protein B n=14 Tax=root TaxID=1 RepID=A0A1W2BUW7_9DELT  ali  34  6...........HKKETPRNIRLAIVSVSTTRGIAEDKSGIWMKKQIKKEGHETVVHHVVTDEINAIQEMVKHVVNDVEPHVILMSGGTGLSPRDVTVEAVSPLFTKELTAFGPLFAQLSFDQIDSAAIMSRATAGIIGNTIVFSMPGSLNACKLACQSLIFPELGHLVKHLSEAP........ 169
353 4.000e-36UniRef50_A0A2S6XC64 Molybdopterin adenylyltransferase n=202 Tax=Actinobacteria TaxID=201174 RepID=A0A2S6XC64_9ACTN  ali  26  14..................PYAALVVTASNRAGVYEDRGGPLIAEGLRRFGFDVDGPRVVPDGDPVEAAL--RAGAEAGYDVIVTTGGTGVSPTDRTPEATRAVIDYEVPGIAEAIRAYGRDKVPTAA-LSRGLAGVADGTLIVNLPGSSGGVKDGLAVLEPLLKHAVDQLRGGDHPRP..... 172
354 4.000e-36UniRef50_F2JIB2 Molybdenum cofactor synthesis domain protein n=2 Tax=Cellulosilyticum TaxID=698776 RepID=F2JIB2_CELLD  ali  25  17...................FTAGIITTSDASGKEEDESGHLLDFMLKDRGFEIKYYIVIPDEIDRIQEALVMLCDDLKVDLVLTTGGVGFRKRDITPEATQGVLDKEVPGISEALRSYHLQYNSRTM-LSRGVSGIRRNTLIINLPGDVKGVRSSFESIIDTIYEGLEIMA............ 169
355 4.000e-36UniRef50_A0A0W8DRR1 Nuclear pore complex protein Nup54 n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8DRR1_PHYNI  ali  31  61.........................VISDRAGISTDMSGPAMVDVLQQVDKDVVAIKVVPDDVDKIQAVVKDWADSDTVDLILTSGGTGFSPRDVTPEAIKAVLDKYIPGFPIAMLESSLKIT-AKAVLSRPVAGIRKNTLIVTLPGKPKAVVENFSAIAEVLPHALHLVRDVPHEHHR.... 218
356 5.000e-36UniRef50_A0A0N0KU65 Molybdenum cofactor biosynthesis protein B n=1 Tax=Enterococcus sp. RIT-PI-f TaxID=1690244 RepID=A0A0N0KU65_9ENTE  ali  33  3...................VKIGLLTISDTRNERDDFSGQTIMQTVKEEGFIMIHYHLVKDEIPLIQQAYLNLVNTD-CEVIITNGGTGISKRDVTPEALQPFIKRELPGFGELFRWLSFQEIGSHGMASRACAGFNEEQLLFLLPGSVKACQLAMKQLILPEIPHLLKER............ 154
357 5.000e-36UniRef50_I9P1P2 4a-hydroxytetrahydrobiopterin dehydratase n=12 Tax=Bacteria TaxID=2 RepID=I9P1P2_HELPX  ali  25  1................MQTIHIGVLSASDRAGIYEDLSGKAIQEVLSEYLLNPLHYEIVADERDLIEKSLIKMCDEYQCDLVVTIGGTDPALRDITPEATEKVCQKMLPGFGDLMRMTSLKYVPTAI-LSRQSAGIRNKSLIVNLPGKPKSIRE............................. 141
358 5.000e-36UniRef50_A0A2N5ZMS9 Uncharacterized protein n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZMS9_9BACT  ali  22  80...................PRFAVIVLSDSCGSAIDKSGLFITSHLEECGFYPDSAEIIPDEKKNLLSVYKQLLKE-NINLIITTGGTGLYNRDITPDTTRSFVEKEIWGIPQAIINYGLKKTPMAM-LGRIFAGSIGRTLIINLPGSLKAVTEAFEVISPVLRHALEKLAGSKQKC...... 241
359 5.000e-36UniRef50_A0A2T7NY81 Uncharacterized protein n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NY81_POMCA  ali  23  6...........HQETVPKSIRTGILTVSDSCGLATDHSGENIKRLLESFTTQVTVKDIVPDDFQEIKNKLCVWSDNLKLDVILTTGGTGFSHRDVTPEATKSVLEREAIGMVVAMLTSSLGITPLAM-LSRPCCGTRGHTLIINLPGSAKGSEECLRVVSKAIHHAVDLLRGFHGSIQKVHQ. 184
360 5.000e-36UniRef50_A0A0S7HJH2 GEPH (Fragment) n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A0S7HJH2_9TELE  ali  26  1................................................LGGVIAAYKIVPDEIEEIKETLLEWCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLL............. 121
361 5.000e-36UniRef50_A0A2G5WL48 Molybdenum cofactor biosynthesis protein B n=16 Tax=Planococcaceae TaxID=186818 RepID=A0A2G5WL48_9BACL  ali  42  1MEEAHLPQQARKKSVV-----VAVLTISDTRTKADDKSGKIICEKLVEAGHYVRHYEICPDEATRITQQLSAWRSDSAVQAMIFTGGTGIGARDITVETVAPHFTKPLDGFGELFRFLSYEDVGSKALLSRATAGAIGEQVVFLLPGSSKAVTLAMDKLIVPELPHI................ 163
362 5.000e-36UniRef50_G9PWZ2 Molybdenum cofactor synthesis domain-containing protein n=3 Tax=Synergistaceae TaxID=649777 RepID=G9PWZ2_9BACT  ali  29  101..........SERAEIWSPIRTAVLTVSDSQGQRVDTAGPELERLAFAQGCVTEERKIVPDDKEQICETVREWA-GKGINLILTTGGTGLSPRDNTPEALLSVADKTVPGFGEMMRIETLKYTPRS-FLTRSVAVVKDRSLVIAFPGSKRGAGQCFEAITGGLRHAVETLTGSASEC...... 267
363 5.000e-36UniRef50_B0SN79 Molybdenum cofactor biosynthesis bifunctional protein: molybdenum cofactor biosynthesis protein C/molybdenum cofactor biosynthesis pr  ali  26  150....................KAKILVCSDSCGKKQDGSGKIIAELLSNEGVEVLEIKIVPDEPKEIEQTISNWA-NEKIDLIITTGGTGLGPRDNTTDTIKPMLEKEIPGIAEVMRSFGQDRTPFAM-LSRSIAGSIGKSIIIAVPGSSNGSKESMTAILPAVFHAKKMMRGE.......... 302
364 6.000e-36UniRef50_A0A1Q1G3G0 Molybdenum cofactor biosynthesis protein B n=1 Tax=Auricoccus indicus TaxID=1849491 RepID=A0A1Q1G3G0_9STAP  ali  37  1...................MKYAILTISDTRNFDTDKGGQTIKRIMDEHGYNLYDYKIVKDDKEEIEHQINEWKDIEEIQFIITTGGTGISLRDTTFDVVNQLLTKEVRGYGELFRQLSYEEVGTRAMLTRATAGLIDETFIAMLPGSVNAVEVGMNKILIHELPHI................ 149
365 6.000e-36UniRef50_A0A2A2HL25 Molybdenum cofactor biosynthesis protein B n=1 Tax=Methanocorpusculum parvum TaxID=2193 RepID=A0A2A2HL25_9EURY  ali  40  5...........HRETV--SIKTAVITVSTTRTEKTDLSGKIITEAFEQAGIPIVSAVIVKDDISDIRSAVLSALDQANC--IVVNGGTGLTHDDCTIEAVSPLFIKTMDGFGELFRQKSYAQVGNAVILSRAAAGINKGRVIFCIPGSPKAVKLATEEIIIPEITHILTHAN........... 161
366 6.000e-36UniRef50_A0A1Y2K7B9 Putative molybdopterin synthase subunit MoaE n=2 Tax=Magnetofaba TaxID=1472292 RepID=A0A1Y2K7B9_9PROT  ali  24  172..........HDHAISWAGLNVGVLTLSDSRTLAQDASGDALEGMLLNYGAQSIKRALLADEQAAIEAHLRQWADVERLDVILTTGGTGPGPRDCTPEATRTVTNRELPGFAELIRSAGLEQTRTAVF-TRGVSAFRQNCLIINLPGSRRGSAHSLQAVADLVPHALRMALG........... 332
367 7.000e-36UniRef50_A0A1D8AV56 Molybdopterin adenylyltransferase n=9 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1D8AV56_9BACT  ali  29  1...................MKVARITLSDRAGTYADESGPEIERVTASHFTEPLERVLLPDDRAQLEAAFIRLADVEHCPLIITTGGTGPSARDITPEATRAVLEKELPGFGEVMRLHSYEKVKTAI-LSRATAGVRGRSLIINLPGRPRAIGECLPLIVPAIAEALDHIAGFRP........ 159
368 7.000e-36UniRef50_A0A0S8FR31 Uncharacterized protein n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8FR31_9BACT  ali  29  3...................IRAAVLVTSDRIGLEEDRSGKRAAELLGQV-ADVAETRVLPDDVHSIGECLRQWCAEG-MDLIVTVGGTGLGPRDVTPEATLSVLEREAPGISAALLVEGLKSTPRAM-LSRAVAGVNGRTLIVNLPGSTSAVEEGMACLMPVLPHAFEVLRGEPE........ 157
369 7.000e-36UniRef50_UPI0009F639ED MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI0009F63  ali  24  5.........KSSKKESHKRITAGIITASDAKGEKEDESGKILDFMLKDRGFEIKYYIVIPGDVDRIQEALVLLCDDIKVDLVITTGGTGFRKRDVTPEATLGVIDRVAPGISEAIRYYGLQKNP-NVMLSRGVSGIRRNTLIINLPEGVRDVRESFESIIDTIYHGLEIMGGKV......... 171
370 7.000e-36UniRef50_K9D8C9 Molybdenum cofactor biosynthesis protein B n=14 Tax=Firmicutes TaxID=1239 RepID=K9D8C9_9FIRM  ali  36  9.................RPLVLGVLTVSDTRTPETDKGGDTVVQLVEEGGHIVKVRTIVPDDFTRISEVLQRWIAIENLDAVILTGGTGIAKCDVSIEAVKSLCTKIIPGFGELFRYLSFEDIGTRAIASRATAGVSSDVLLISLPGSVGAVTLGITKLVLPEIRHL................ 159
371 8.000e-36UniRef50_A0A2A4TVQ4 Molybdenum cofactor biosynthesis protein n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TVQ4_9BACT  ali  31  1...................MKTVVLTISDRRGEVQDRGGPAVVQAVQGAGWSVIEVEILSDDPDVLSARLRALCDSDSPDLVVTTGGTGLGPRDSTPEATRAVLDKELPGVSERMRREGEKSTPLA-LLSRAVCGARGRSLIINLPGSPKGAVESFEAVRDLLEHASAVLSG........... 155
372 8.000e-36UniRef50_A0A2D7N7G1 Molybdenum cofactor biosynthesis protein MoaC (Fragment) n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D7N7G1_9GAMM  ali  28  18....................KIAVIVMSDRAGTYDDESGQYLVSALTDQGAEVCAYTVIPDDFALIQSTITGISETHDPHVILCTGGTGPGPRDVTPLAIAEHLNPELPGLGEWLRSESAVYTKTA-WLSRMGGGLIGRALVITLPGSLQAVKECFGIFIEGLPKAIMMI............. 168
373 8.000e-36UniRef50_A0A2N1PPH6 Molybdenum cofactor biosynthesis protein n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1P  ali  25  4.......GAHNHEKGCRLPWRSAVIVVSDRCSLDPDSAGAALCAILQQRGHIVAPLTIVADERAQISTILRELAAQ-KYQLILTSGGTGLAPRDVTPEATLDAADRLVPGIPEAMRAASMAITPKG-CLSRGVAVLIGKCLVVNLPGSEKGATENFLALAHAIEHGMEMASGKPSDCA..... 174
374 8.000e-36UniRef50_A0A160VM70 Molybdenum cofactor biosynthesis protein MoaC n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A160VM70_9ZZZZ  ali  32  64........GGKSDHGVEYRPKVGIITMSDGVGKREDKSGEILKNGFKKAGCTVDYKLVLPDGSDELKKSIQTWIDSG-VELIITTGGTGLGPRDLTIQIVEKIFDSRLPGIEQALHAYGRGKIATAV-LSRLAAGVVNSALVICLPGSPGAAQDGLSVLIPTIFHSFHMMKGE.......... 228
375 9.000e-36UniRef50_A0A2D6ZUE8 Molybdenum cofactor biosynthesis protein B n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D6ZUE8_9RICK  ali  41  3..........IDKKKKFISLNFCIAVISDTRSISDDKSGLILEEKIKKSGHNVYSKEFIKDDSKKIISYMKKCLNLKNINMILLTGGTGLTGRDSTPEAVKKIIEKEIPGFGEIFRMISFEKIGASAIQSRAIAGIAKDKFIFAIPGSPSACSDAWENILKYQCDNRFKPCNLVELIPRLLEK 175
376 1.000e-35UniRef50_UPI0009FC9630 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Desulfomicrobium escambiense TaxID=29503 RepID=UPI0009FC9630  ali  29  72.SGAVTAG-ERDCALSRSGFSLAWITLSDSRGERVDASGPCIRDTVAGAMLSLARGVIIPDEPLILKAALVDCCLNHGFDLVFTTGGTGVGPRDITPEATLPLLDKRLPGFERAMTLASLAKTPHAVI-SRAVAGTMGKSLVVNLPGSPKAVRENLAAILPALRHTVEKLQGDPRDC...... 248
377 1.000e-35UniRef50_UPI00094E3E7F MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Acidaminococcus massiliensis TaxID=1852375 RepID=UPI00094E3E  ali  25  2...................YRVCLITVSDSSALKKDLTGPAVAELLAKAGYQIVARTVLPDERELLAEKMRQIADGGRADLLLTLGGTGLNERDVTPEATGEIIEKAVPGFSELMRRKSFEVTPNGI-LSRGISGIRKHCLIINLPGSPRAAVENLSFILQPLAHGLKMLTQSKNDCAHMDA. 165
378 1.000e-35UniRef50_Q82H76 Putative molybdopterin biosynthesis protein n=76 Tax=Actinobacteria TaxID=201174 RepID=Q82H76_STRAW  ali  25  15.................ASYSALVVTASNRAGVYEDKGGPLIAEGLATFGFAVDGPWVVPDGDPVEETLRSGVAA--GYDVIVTTGGTGISPTDRTPEATRAVLDHEVPGIPEAIRAFGREKVPTAA-LSRGLAGVAGGTLIVNLPGSTGGVKDGLAVLEPLLVHAVDQIRGGDHPRP..... 174
379 1.000e-35UniRef50_A0A2V7U1G9 Molybdenum cofactor biosynthesis protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7U1G9_9BACT  ali  26  28.................TPRRATVVTVSDSAGTRPDVSGPEACRLLREAGLEVEGPIVVADERPRIAALLRDAS--ERSALVVTTGGTGLGPRDTTPEATRDVLEREAPGLAELLRAHGLRKTPRAA-LSRGLVGLRGRCLIVNLPGSPTSVSESLEALTPLLAHVFDLIEGRTAH....... 185
380 1.000e-35UniRef50_Q1J0T6 Molybdenum cofactor biosynthesis protein B n=27 Tax=Bacteria TaxID=2 RepID=Q1J0T6_DEIGD  ali  38  18................PRSVPVAILTVSDTRSEETDTSGQYLLAELRGGGHQVVGYRIVKDDALAIRAALTGF--MRDAVVVISSGGTGITGRDVTIPVVESLITKPLPGFGELFRMLSYREVGGAAMLSRAVGGLAGHTLLFALPGSLNAVRTAWEGLLRDELGHLA............... 167
381 1.000e-35UniRef50_E3LUU0 CRE-MOC-2 protein n=19 Tax=Chromadorea TaxID=119089 RepID=E3LUU0_CAERE  ali  30  1...................MRVSVITVSDSAGTRADESGPKLVELVDKAAINAGSPTVVPDEVAAIRDALLENCKNSD--VIITTGGTGFSKRDVTPEATLEVIERRCSGLEIAMHIGSLQKTPMAA-LSRAIVGIRGSTLIVNMPGSVKAVKECWEILEPVLNHAINLLKD........... 157
382 1.000e-35UniRef50_D6SQZ5 Molybdenum cofactor synthesis domain protein n=20 Tax=Deltaproteobacteria TaxID=28221 RepID=D6SQZ5_9DELT  ali  29  93.................RGRSLAWITLSDARGERTDTSGPMIRETAEKLSLTLCRGWVIPDDAYLLRSLLQHLAFNSGFDLIVTTGGTGLGPRDITPEVTGHAVEKRLPGFEQAMMAASLQKTPHAAI-SRAVAGTLDQSIILNLPGSPRGVKENLEAVLPAMEHALAKLQGDVADCA..... 255
383 1.000e-35UniRef50_B9XGK0 Molybdenum cofactor synthesis domain protein n=11 Tax=Verrucomicrobia TaxID=74201 RepID=B9XGK0_PEDPL  ali  28  5.....................VGIITISDRAGLYDDLGGPALKKAALDYGWKVLAESLVPDEKRDIQRAIREQIA-KGCQLILTTGGTGVALRDVTPEAVREIAIRELPGFGEVMRLESMKITK-NAILSRNLAVVVEKTLVICLPGKPSGATECLSFVVGAIPHCVEVL............. 153
384 1.000e-35UniRef50_A0A1V5NKZ9 Molybdenum cofactor biosynthesis protein B n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5NKZ9_9BACT  ali  34  2.......SHQDHEAEAPKSLALGILTLSDTRGEAEDRSGAQLKELLSGAGHRIEAYAVIREDPGLIEATLKDWLAKP-LDAIVTNGGTGLTSRDGTIEVARRLMQKELEGFGELFRFLSFQQIGPAGMLSRSTAGLASGKILVCLPGSTKAVRLAAARLLIPELPHMVREA............ 164
385 2.000e-35UniRef50_I2JX70 Molybdenum cofactor biosynthesis protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JX70_DEKBR  ali  25  3...................FKVGILVVSDTCSKDPDQTGPALISYFQDHNYEVSKTAIVADVASEIQRVLINWSDSEDIRLILTCGGTGFTKHDITPEAVSELITRPAPGXVHAMLTXSLRKTPYAIMA-RPVAGVIGKTLVITLPGSPRGAKENFGAVSSTLCHALAQL............. 164
386 2.000e-35UniRef50_A0A2E0AY19 Molybdenum cofactor biosynthesis protein B n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2E0AY19_9PLAN  ali  33  5........VEAHKASAIDPIRCAVVTVSDTRTVETDTGGQCLIDHLEDAGHVLVERQIVPDEPAVMRPLLERFRDAENVDVVLMTGGTGITARDQTYETVSDMLTKPLPGYGELFRMLSYEEIGAATILSRATGGLMQRTVLLTMPGSRAAVRLAMQKIIVPELGHLVREA............ 167
387 2.000e-35UniRef50_G8T812 GTP cyclohydrolase subunit MoaC n=139 Tax=Bacteria TaxID=2 RepID=G8T812_NIAKG  ali  27  132.....KKGGKSDFKDSYPKLRCAVIVCSDSAGQKEDRAGKVILQKLKQFNLNAGLYMIIPDEAEVIQTKVKQLV-SEGYNLVLFTGGTGLSPRDVTPEAISPLFDRPIPGIMEAARQYGQQRTPYAM-LSRGVAGFIQNTLVITLPGSTKGTEESMDALFPYVFHI................. 293
388 3.000e-35UniRef50_A0A087SKR9 Proteasome subunit beta type-6 n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A087SKR9_AUXPR  ali  28  211....................RFGIVTVSDRAGVYEDASGPAILGFFHDAISTEAEYRCVPDDQPTIEATLKELVDQARCSLVVTTGGTGPSPRDVTPEATASVCQRMMPGYGEQMRAVSLRHVPTAV-LSRQTAGLRGKALILNLPGKPKAIRETIDEVFASIPACIRLLGG........... 365
389 3.000e-35UniRef50_A0A2E5U1F1 Molybdenum cofactor biosynthesis protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5U1F1_9CHLR  ali  30  4.....................FCVLTTSDRCGTMKDISGEIAVKLLLNYGFLLVEKKIVPDDFKKITSTLEKWSLRDEINFIVTTGGTGLSDRDVTPQATLSLLEYQITGIVDYVRLKSAESNKKSI-LSRSVAGVKNHTLIINTPGSPSGVVDTLENILDVINHSLNVLINSTNEH...... 160
390 3.000e-35UniRef50_A0A117SST4 Molybdenum cofactor biosynthesis protein MoaB n=5 Tax=Archaea TaxID=2157 RepID=A0A117SST4_9CREN  ali  36  4........HEEHRARGPKELSFWVVTVSTSRYEYTDESGDAAVSLISRAGHRVVGRSLVKDDLVMIRGVVMDLLRRSDVDVVVLTGGTGVARTDVTIEAVRPLLEKELDGFGDVFRLKSYQEVGTAAIMSRALAGVSNGKLVVALPGSPNAVETGLGIILPEAPHIIYLVR............ 173
391 3.000e-35UniRef50_M4VE63 Molybdenum cofactor biosynthesis protein MoaC n=3 Tax=Proteobacteria TaxID=1224 RepID=M4VE63_9PROT  ali  27  184....................KAGILVMSDRAGAYEDLSGALLKDILCSAGADVCAYDVIPDRQDDIAKVMLDMCHANKLDILIASGGTGPGPRDVTPDVLARISDRVLDGIGDFMRMESLHYVDTA-WLSRMTAGMIGSTLVIAFPGSPKAVQECWEIIGPYIGDALDKIR............ 335
392 3.000e-35UniRef50_A0A1B7X9W9 Molybdenum cofactor biosynthesis protein n=3 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1B7X9W9_9DELT  ali  25  96.............HPVKKELSLAWVTLSDARKQRVDGSGPLIEQLVRDAYLSYSRGFIIPDEELQLRQLLSDLALLQKFDLILTTGGTGVAPRDVTPEATLKVIDRRLRGIEQAMMAASLQKTPHAVV-SRAVAGTLGGSLIINMPGSTKAVAENLEAVLPALGHTIAKLQGDPADC...... 261
393 3.000e-35UniRef50_Q9RUT9 Molybdenum cofactor biosynthesis protein B n=4 Tax=Deinococcus TaxID=1298 RepID=Q9RUT9_DEIRA  ali  40  6.SPTPAAGAAQHRREAPRSVRAAVVTISDTRTPDTDESGRYLAEQLTASGHELVERLIVRDDAVEIRSAVVRL--MRVADVVLTSGGTGIAGRDVTVPVIESLLVKPIPGFGELFRMLSYGQVRGAAMLSRALGGLGRGALVFALPGSLGAVQTAWEGILRDELGHL................ 169
394 3.000e-35UniRef50_A0A0T5XD73 Molybdenum cofactor synthesis domain protein n=3 Tax=Acetomicrobium TaxID=49894 RepID=A0A0T5XD73_9BACT  ali  30  105..................PINLGILTVSDRRGELTDTSGPSLEENSQSIGAVRKKYDIVPDEIEEIQRVVRHWCDDVGLDLILITGGTGISRRDVTPEAILEISDKIIYGIGEYMRWSTSLNNPMSI-LSRGMAVTRGKTVIVALPGSEKGATECFSAVSPTLRHAVEVLTDRH......... 261
395 4.000e-35UniRef50_A0A1Y4CVA7 Molybdenum cofactor biosynthesis protein n=2 Tax=Desulfovibrio sp. An276 TaxID=1965618 RepID=A0A1Y4CVA7_9DELT  ali  26  75......PAGEIALLPEKRGTSLAWITLSDSAGTREDASGPVLASKVRDLDIDYAQGYLLPDNASDLRALLTHLALVEGYDLILTTGGTGVAPTDVTPEATARVLDYELPGFAQAMTMASLAKTPMGAI-SRARAGVIGRSLVVNLPGSPKAVQENLEAVLPCFKHTIEKLHGDSTPC...... 247
396 4.000e-35UniRef50_A0A0P5YPW7 Putative Molybdenum cofactor synthesis protein cinnamon (Fragment) n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5YPW7_9CRUS  ali  25  1..........................VSDRCFQTKDISGSCLRELVDGGFHKVLVEECVPDELEAINTVLTNWCDCLKVNLIFTLGGTGFSPRDITPEATRTVIEREAPGLSLAMIKMSLEITPLAM-LSRPVCGIRKQSLIINLPGSPKAVKECFQMIAPSLQHAVDLITGSKDVTHKIMQ. 162
397 4.000e-35UniRef50_A0A0M0BRR7 Molybdenum cofactor biosynthesis protein B n=4 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0M0BRR7_9ARCH  ali  33  1........MHEHRRDQSAEAACAVLVTSDTRRPGTDETGKRAIQLLEEAGHSVAAYKIVRNDTAQIREALEGFLGDDGIQVVITSGGTGIGAADKTVDAVSELLDKRIEGFGELFRRLSYEEIGGAAIISRAAAGVAGGKLVFCLPGSMNAVELGLRRIILPSLGHM................ 159
398 4.000e-35UniRef50_A0A0N5E5Y3 Uncharacterized protein n=1 Tax=Trichuris muris TaxID=70415 RepID=A0A0N5E5Y3_TRIMR  ali  29  1................MAKINVAILVVSDSCGTREDKSGRTLLEEVNKLLFNGFLWVVVPDDKEDIENALFDLSSADSVQVVITVGGTGFAPRDVTPEATRNIVEKDANGLAIALIAASL----PAGAYSRLGAGVRNSTLIVNFPGSVKAVKECWDVLCPLLPHIVALMCNEVQQFHRDLEK 170
399 4.000e-35UniRef50_A0A2J7RD66 Uncharacterized protein n=2 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7RD66_9NEOP  ali  26  7.................TKINFGILTVSDSCGTAEDRSGTNLAALIIKGNGKVVLQNCVPDEKDCIKRILEEWTDREGVDVILTTGGTGFSSRDVTPEATKEVIHRETSGLTFAMFKKSLDITPLAM-LSRATTGIRYSTLIINLPGSVKGSQECLESVAISLSHAVAVLRDRIAEVKSTH.. 174
400 5.000e-35UniRef50_UPI0009FAA9F5 HAD family hydrolase n=1 Tax=Libanicoccus massiliensis TaxID=1871022 RepID=UPI0009FAA9F5  ali  25  1.......MGHHDHETSAPSFSAAVITVSDRAGLREDATGPAVAELLAREGFRVVSATVVPDDRARI-GEAIREAAAAETALCVTCGGTGLSPRDVTPEATEDVCERMVPGLGELMRAKSAAITDHA-WVSRATAGTLGRTLVVNVPGSPKGATENLEVVLAPARHGLKMLRAEQAQ....... 169
401 6.000e-35UniRef50_A0JUX0 Molybdopterin adenylyltransferase n=13 Tax=Micrococcaceae TaxID=1268 RepID=A0JUX0_ARTS2  ali  23  11...........HRHGEATGRKAGVVIASNRAGIYRDETGPVITDWLTEHGFETFPAMVVPDGEPVGAAL--RALLTQQPAVIITSGGTGLSPDDLTPEMTVPLLDREIPGIMEGIRQAGLAKTPMAM-LSRGHAGAAGRTFIVNLPGSPKGVMDGLSVLDPVISHLCDQLEGSHEH....... 174
402 6.000e-35UniRef50_B5ICM7 Molybdenum cofactor synthesis domain protein n=2 Tax=Aciduliprofundum boonei (strain DSM 19572 / T469) TaxID=439481 RepID=B5ICM7_ACIB  ali  32  1........MGVKEHKKHNTLKIGVITVSSTRTKDTDESGKIIMEAIEKNGHKICGYDVVKDLKLDILRGLFHLL--QNCDVVILNGGTGISSRDVTAETIKAILDKELVGFGEIFRLKSYEEIGTAAMMSRAIGGVCCEKLIFSIPGSKGAAKTGCDVIFSEINH.................. 156
403 6.000e-35UniRef50_A0A267DJI8 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267DJI8_9PLAT  ali  30  9...................IKIGVITISDTAYKSPDKSGPQLVHLVSKSQYDNIFQVIVPDETQMIEEQLKTFSDAFHCDVILTTGGTGFTPRDVTPEATSRVLDRRADGLSTALLLKSLESTPYAV-LSRGVSGMRGQTLIVNLPGSQKAVDECFAVLEPVLAHAVKQLQG........... 167
404 6.000e-35UniRef50_A0A1V5JYE0 Molybdopterin adenylyltransferase n=1 Tax=Candidatus Aminicenantes bacterium ADurb.Bin508 TaxID=1852832 RepID=A0A1V5JYE0_9BACT :_  ali  28  2...................ISAAVVIMSDRRGQREDSSGPSLRSIVESEGFRVLSLVVIPDDRERIVYTLQGLV--GKVEAVFTAGGTGVTDRDVTPEATLEVIDRRLPGIETALLLEGLKKTPMAV-LSRQVAGLAGKTLILNLPGNPAAAQESLKPLLPALRH.................. 146
405 6.000e-35UniRef50_A0A2V7QR71 Molybdenum cofactor biosynthesis protein n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7QR71_9BACT  ali  30  1...................MRVAVITVSDSRGERQDSSGAVVAGWVKAKKFELVSATKCADETVEIVRSLIEACDSDAADLVLTTGGTGLAERDVTPEATRAVIEREADGIAERIRVLALPNFARAA-LGRGVAGVRGKSLIVNLPGSPSGVRDGLDALDPIVQHACDVLSGKTEHTP..... 161
406 6.000e-35UniRef50_I3Z5P2 Cyclic pyranopterin monophosphate synthase subunit MoaC n=180 Tax=Bacteroidetes TaxID=976 RepID=I3Z5P2_BELBD  ali  26  147...................LKAAVIVCSDSIGQKEDQAGKVIIQKLEALKVSIEDYSIIPDEKEKIQSKLKGFVDAG-MDMVIFTGGTGLSPKDVTPEAIRPLIEREVPGIEETIRSFGQARMPYSM-LSRSVAGLIGNTLVLALPGSTKGAEESMDAIFPAVLHIFKVLEGPK......... 301
407 8.000e-35UniRef50_A0A0S7ZL23 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0S7ZL23_9BACT  ali  30  2......................AVLTISDRAGDRADDSGDVITDWVRRCSCELVHRGLVPDESDQIARLLAQWADEGIADLILTTGGTGLGPRDVTPEATRAAIERETPGIAEAIRADGRSVTARAV-LSRGVAGVRAASLIVNLPGSVGGVRAGLATLGLFLDHAVAIIRNEP......... 154
408 9.000e-35UniRef50_W7C5Q5 Molybdenum cofactor biosynthesis protein B n=1 Tax=Listeria grayi FSL F6-1183 TaxID=1265827 RepID=W7C5Q5_LISGR  ali  36  2...................IRVGVVTISDTRDLDTDTSGQLVVRALRSRDIDVTGRVVVRDEVQQIKGAIDTYL-QEKADCIITNGGTGISKRDVTFESIREKIHQELPGFGEIFRMLSFETIGSKAIASRAIAGTQSDCLLFALPGSTNACDLAMEKLILPELEHLIG.............. 152
409 1.000e-34UniRef50_A0A2D7IMX5 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026  ali  35  70.....KNGGKSDYATRYR-PKVGVVTLSDGRGKREDISGKILADGFLNSGCVVDHRIVLEDGSDQLVPMIYDWIDSG-VELILTTGGTGLSPRDLTIEVLESIFESKLTGVEQALHAYGRGKIKTAM-LSRLTAGLVKGTLVICLPGSSGATRDALEVLIPTIFHSFHMLKGE.......... 236
410 1.000e-34UniRef50_A0A2R6HLA8 Molybdenum cofactor biosynthesis protein MoaB n=1 Tax=Halobacteriales archaeon QS_4_62_28 TaxID=1919173 RepID=A0A2R6HLA8_9EURY :_  ali  37  20.......HGHDHQHGTDDALDFAVLTISTSRSTEDDESGPVARERIEDAGHAVTTQDVIGDDADAIRSAVDSL--QGEVDVIVTTGGTGLTDDDVTVEAIGPLLAPEIPGVGEYFRRLSHEQVGTAAMLTRATAGIAGETAVYVFPGSPDAIQLGVEDVLLPEVGHVVGLA............ 181
411 1.000e-34UniRef50_A0A0M3CJK5 Uncharacterized protein n=1 Tax=Sphingobacterium sp. IITKGP-BTPF85 TaxID=1338009 RepID=A0A0M3CJK5_9SPHI  ali  31  74..........HAHLLENRKIKAAVVVCSDSVGEKQDRSGFVLEELLEDYGIDVVRFEVVPDEIDAIQHQLT-VSRELGVDMLIYTGGTGVSDRDVTPEAVEPYLTKKLPGVMEIARQYGQQFVKTAM-LSRAVAGFADRMLVLTLPGSTNGVKESVKALFPQILH.................. 228
412 1.000e-34UniRef50_A0A2D8MUL0 Molybdenum cofactor biosynthesis protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D8MUL0_9CHLR  ali  27  3....................KLAVITISDSRGKLEDLSGXRIIKILSEKNFSLHERILVSDEISEISNSFKKCLSNNEIDFIVTTGGTGISPRDITPEVTKNFINKEILGVSNEIXTRFQKKLPTSI-LXRGXCGISGNKLILNLPGSPNGVEEGLSVIVPLLDHIFDLLSGNTEH....... 160
413 1.000e-34UniRef50_A0A2G9SR69 Uncharacterized protein n=1 Tax=Chlorobium sp. 445 TaxID=2033588 RepID=A0A2G9SR69_9CHLB  ali  25  11........VKHTRSAVEERIRVAVITVSDRAGIYKDESGPKVAAAFPKDLYEVIITKVVPDEVKAIANEIVNCVDNEHADVVVTTGGAGCSARDVTPDATASVIHREVVGFSEVIRLANRDKNP-NLILSRGVSGIRNQSVIINLPGNPENARMAIESVLPAIPHCI................ 171
414 1.000e-34UniRef50_A0A1A6FRU7 Molybdopterin adenylyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A1A6FRU7_9RHIZ  ali  27  9.....................IGVVTASDRAGIYEDESGPAIAAYLQKALTSPIVRRIIPDGFESVRDTLIDLSDNIGCDLIVTTGGTGPAPRDLTPEATLAAAPRELPGFGELMRKVSLTQTPTAI-LSRQVAAHRGKCLVINLPGKPAAIELCLDAVMPAVPYCLDLI............. 160
415 1.000e-34UniRef50_A0A285D2C0 Molybdopterin adenylyltransferase n=1 Tax=Rhodobacter ovatus TaxID=439529 RepID=A0A285D2C0_9RHOB  ali  25  1...................MKIAIVTASDRCGDYEDTSGPAIADWLE----TVVTRRIVPDGIESVRDTLVELCDLEGAALVFTTGGTGPSPRDLTPEAMALTIEKELPGFGELLRFAGLQQTPTAI-LSRQTAGIRGRSLIVNLPGQPASITLSLQAIFAAIPKCLELI............. 154
416 1.000e-34UniRef50_A0A1F3BBB9 Uncharacterized protein n=2 Tax=archaeon RBG_16_50_20 TaxID=1797286 RepID=A0A1F3BBB9_9ARCH  ali  34  5........AEHHKSTSPKSVGLFIITCSTSKGETPDQSGDIIEKLATDAGHQVQGRKLIDDSKVMIRRTVKNALAGKQVDALIITGGTGLSPRDVTFESVEPIITKQIPGFGELFRKLSYDRIGSPAMLSRALAGLVKDKPVFCLPGSPDAVQTAMENLILLELGHLIRVAKEH......... 177
417 1.000e-34UniRef50_A0A1D8G1R9 Molybdopterin adenylyltransferase n=91 Tax=Actinobacteria TaxID=201174 RepID=A0A1D8G1R9_9ACTN  ali  28  3...................YRALVVTASNRAGVYEDRGGPILAEGLAALGFTVDGPRVVPDG-DPVEAALRDGV-RAGYDVILTTGGTGVSPTDATPEATRRVLDHEVPGIPEAIRAHGRAKVPTAA-LSRGLAGVAGRTLIVNLPGSTGGVRDGLAVLEPILVHAVDQLRGGDHPRP..... 160
418 2.000e-34UniRef50_A0A2R6KIA2 Molybdenum cofactor biosynthesis protein B n=2 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6KIA2_9EUR  ali  34  120..........RHHAHDLDNLGVAVVTVSSSRTLSDDPAGDTITAVMEEGDDEVVTRELIPDEYDRIEGTLDNLVGREDVDVVITTGGTGVTPDDVTIEAAKRLFDKELPGFGELFRLLSYDEIGTKVVATRATAGVIEGVPVFCLPGSENAVELGTEAIITEQAAHIAGLARREE........ 284
419 2.000e-34UniRef50_A0A1V4ZV69 Molybdopterin adenylyltransferase n=43 Tax=root TaxID=1 RepID=A0A1V4ZV69_9EURY  ali  39  18...................ITTGIITVSTSRTAENDTSGLTISEIVREAGYPVGYYAVVPDQIETIRAELAKAMRHANC--IIINGGTGLTHDDCTIEAVTPLLEKTIDGFGELFRLKSYEEIGTSAMLSRAVAGTIKNCAVFCIPGSTPAVKLATSALIVPEILHI................ 163
420 2.000e-34UniRef50_A0A1I2HMY4 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Marinilabiliales TaxID=1970189 RepID=A0A1I2HMY4_9BACT  ali  28  138..GMLKAGDELHY--TPRLIRVKIITLSDRRGEYQDKSGPQIKHLTQTHFNTIGRPVLLPDDAEQLNYHLETGI-QNKADIIFTTGGTGIGARDLTPEVVRPFLDKEIPGIMELIRMKYGQE-KPAALLSRGIAGVKNNTLVYTLPGSVKAVTEYCREILPTLEHSLYMLHGIDNH....... 314
421 2.000e-34UniRef50_A0A1F5DEK5 Uncharacterized protein n=3 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A1F5DEK5_9ARCH  ali  30  8...........HREGAGKSKGILIITCSSSRGKAFDPSGEMIERMMKENGHHVYERKLIPDESETINAILTEALQKDVIDTIIVTGGTGISEKDVTIEVVQKLIEKELPGFGEIFRKISYDEIGAAAILTRAMAGIASNKPIFCIPGSPDAVKRSLDKLVLPELPHILKHA............ 174
422 2.000e-34UniRef50_A0A256ZKR2 Molybdenum cofactor biosynthesis protein n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_135 TaxID=2012509 RepID=A0A256ZKR2_9AR  ali  35  7...........HRREAPKSVRFSVVIVSTSRYEAPDLTGDLLCRLLAETGHEVISRRVAPDDIWALRSVLEEEA-RKGVDAIIFAGGTGLSPDDVTIEAIRPLLEKEMPGFGELLRLLSYERVGPAAMLTRALAGVYKGVVVFCLPGSPDAAELAVRELIGPEVHAVKHARG........... 175
423 2.000e-34UniRef50_A0A1X9MDS0 Molybdenum cofactor biosynthesis protein B n=16 Tax=Bacillales TaxID=1385 RepID=A0A1X9MDS0_9BACI  ali  27  3.......MMEEHCDQVTRSIRCMVLTVSDSSTYENDQSGARIRSLLEEKGHSVSEYQIINSEYSLIQHWIKIAATRADIDAILITGGTGIALHDTTHEAVRDSLDKEMPGFGEIFRHLSFQEIGTAAILSRATAGVRDGKAIFSMPGAIGAVNLAMKRIILPEIGQVMK.............. 165
424 2.000e-34UniRef50_A0A2H6HAC6 Molybdopterin adenylyltransferase n=19 Tax=Bacteria TaxID=2 RepID=A0A2H6HAC6_9BACT  ali  28  1................MATLRALVLTVSDRRGEAEDRSGPAAAERLETLGIA-TELRVVSDGVSSVRDALEEAV-EEGFDLVVTTGGTGFSPRDLTPEATSSVVERSAPGIAEAIRSSTFGINPYGM-LSRGVAGITGSTLIVNLPGSVGGVTESLDVIAPALGHAIALLRDET......... 157
425 2.000e-34UniRef50_A0A2A2JG46 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2JG46_9BILA  ali  33  136...........................SDTRGTKKDESGPALCEAIKQWGIQVSNVSIVPDEQNQIAEKLVELTDAEH-DVIMTTGGTGFTTRDVTPEATLEVIHKRCSGLEVALHSYSLQKTPFAA-LSRAIAGIRNHTLIVNLPGSVKAVKECWEILSVILPHAVMQLQNTSDLVHDKLQH 297
426 3.000e-34UniRef50_A0A133UUI6 Uncharacterized protein n=7 Tax=Euryarchaeota TaxID=28890 RepID=A0A133UUI6_9EURY  ali  30  4.........EEHRKEAPKELHVGVITVSDTRGRDEDESGKIIQERLKESEFT-SERVVIPDEPDDLGEKLSEYLNDPEVDAIITTGGTGIAKRDITIDVARKFFDKELPGFGEFLRRKGYEMVGIFGILTRTTLGIAGKKPIFCLPGAPNSVRVGMDLITSDLAHIVKHAR............ 170
427 3.000e-34UniRef50_A0A0A2VYV6 Molybdenum cofactor biosynthesis protein A n=1 Tax=Beauveria bassiana D1-5 TaxID=1245745 RepID=A0A0A2VYV6_BEABA  ali  41  336............................SRRGEDDDTSGHYLSEVATEAGHQVVDKAIVKENRYAIRAAVSQWIADEQVQVVLINGGTGFTDGDQTPEALLPLFDREVEGFGELFRMLSFEEIGTSTLQSRAVAGMANKTLIFAMPGSTKACRTAWENIIQPQLDA................. 473
428 3.000e-34UniRef50_UPI0009F4757E MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI0009F47  ali  23  8...................FNAAIITISDKCQDAKDESGIAMQKILIAYGFSIKSYEIIPHKREVIKDRLITFCDDLKIDLVVTTGGMGVGPKDITPEATKQVIKKEIPGISEAIRCYGIQKAPRTM-LFRGVAGIREHTLIINLPGSTKDAREALESILETVWQGLKVLKGVTSEGDR.... 168
429 3.000e-34UniRef50_A0A239LPX6 Molybdopterin adenylyltransferase n=2 Tax=Granulicella rosea TaxID=474952 RepID=A0A239LPX6_9BACT  ali  27  4................RSNVKVVVLTISDRCGTQVDISGPKVAELLRGAGADTLEMQTLPDEFGEIVHALRFHATEAE--LIVTTGGTGLAPRDVTPEATQTVCERMVDGLAERMRAAGLAHTPMA-PLSRAVCGTIGEALIVNLPGSPAGAETSLAAILDILPHALDLLAGRTEHQP..... 169
430 3.000e-34UniRef50_A0A2E8WST8 Uncharacterized protein n=9 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8WST8_9CHLR  ali  28  7........................ITLSDSRSSITDKSGDVLVSFLVSNNLNLYERILIPDDPSELKSALEKYVNTDDVSLIVTTGGTGISQRDITPEITSKFLEKNIPGIPELIRNSSYEKIKTSI-LYRGLCGIANNKIILNLPGSPGGVKDGLSSIIEILPHMFDLIDGKQGH....... 160
431 3.000e-34UniRef50_A0A073IND5 Uncharacterized protein n=3 Tax=Synergistaceae TaxID=649777 RepID=A0A073IND5_9BACT  ali  29  1...................MRSAVLTVSDSRGERVDTAGPELERLAFLQGCVTEERKIVPDDPDAIREAVCAWAA-KGISLILTTGGTGLSPRDNTPEALLSIADKFVPGFGEMMRMQTLKYTPRA-FLTRSLAIVRGASLIIAFPGSRRGASQCFEAVSGGLRHAVETLIGASSDC...... 158
432 4.000e-34UniRef50_A0A2W5GIR4 Molybdopterin adenylyltransferase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2W5GIR4_DELAC  ali  24  2............SEPVHDAVRIGIVSISDRAGVYEDKGLPALQDWLTRALRNPIEPRLIPDEQAGISATLIELVDAG-CCLVLTTGGTGPAPRDVTPEATLAVADKEMPGFGEQMRQISLAFVPTAI-LSRQVAVIRGKSLIINLPGQPKAIAETLEGLKNP..................... 153
433 4.000e-34UniRef50_A0A2E3NF34 Molybdenum cofactor biosynthesis protein B n=14 Tax=Bacteria TaxID=2 RepID=A0A2E3NF34_9DELT  ali  35  17............RTAAPEKVPTAIVTVSDTRTLETDTGGALVEEMLEAAGQSVAGREIVKDEPAAIAAALDAAIEDDACRAIVFTGGTGVAPRDVTPDTIEPLLERVVPGFGELFRMLSYEDIGSAAILSRALAGLKAGKVVFVIPGSRGAVRLAMEKLIVPELGHLAGEAIKTR........ 179
434 4.000e-34UniRef50_A0A1I5LVL4 Molybdenum cofactor biosynthesis protein MoaC n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I5LVL4_9RHIZ  ali  28  147MKEGGKRGVWIHPDGVPPALTAAVITLSDRAGSYEDYSGPALASRLEQAGCQVSSRSILPDDADLLEKAIKALV--GTVHLIMTTGGTGVAPRDVTPQVISRIGGIAVPGLGEVLRSSAAAHVPTS-WLSRSTAIILEKTLIIALPGSLGGVNDGMKALSPLLPHALDLIDNKKPAHTHDHSH 343
435 4.000e-34UniRef50_A0A2P9F7K7 Molybdopterin adenylyltransferase n=14 Tax=Streptomyces TaxID=1883 RepID=A0A2P9F7K7_9ACTN  ali  27  45...................YRALVVTASNRAGVYEDKGGPLIAEGLARFGFAVEGPQVVPDG-DPVEAALRAGVDAG-YDVIVTTGGTGVSPTDRTPEATRAVLDHEVPGIPEAIRAYGRDKVPTAA-LSRGLAGVAGRTLIVNLPGSTGGVRDGLAVLEPLLTHAVDQIRGGDHPRP..... 202
436 4.000e-34UniRef50_G4LZ84 Molybdopterin biosynthesis protein, putative n=1 Tax=Schistosoma mansoni TaxID=6183 RepID=G4LZ84_SCHMA  ali  27  8..................RLSVGVLTVSDTCSKDVDQSGPVAESLLQEAGFDVPLKDCVPDNPHIIRCVIMKWVASRQVEAVLTLGGTGLSRRDVTSDIILELQNQRLPGIEHSLYSISLQNTPMGA-LSRFVAGVCNETLLITLPGSTRAVSQCIPVILRVMKHAIHQIKG........... 164
437 5.000e-34UniRef50_A0A1F9U8F1 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=1 Tax=Elusimicrobia bacterium RIFCSPHIGHO2_02_FULL_57_9 TaxID=1  ali  30  164...........QKKPGFSGIRAAVVTISDRRQEMENISGPLLANSLGQLGATVVRQEQVPDEQTAIAQILTALANE--VELIITTGGTGLSPRDVTPETINRLCDRIIPGIGERLRSLGAQNTAMA-CLSRSVGGLIGKTLVIALPGSQRAVIEGLSILEKLVPHALHIARG........... 323
438 5.000e-34UniRef50_A0A1Q7SWL2 Molybdenum cofactor biosynthesis protein n=27 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7SWL2_9BACT  ali  32  1...................MRISVLTISDSVGEREDLSGPAVVAFCRGLGWEITSSLRVSDDPANIREQLRAVADSGRVDVLLTTGGTGLGPRDNTPEATQAVADRIVPGLSEEMRRKGLQHTPTAV-LSRATAAVRTKTLILNLPGSPKGAVESLEAVAHLLPHAVKVLHG........... 154
439 5.000e-34UniRef50_A0A109W5M1 Uncharacterized protein n=2 Tax=Desulfomicrobium TaxID=898 RepID=A0A109W5M1_9DELT  ali  26  89................HRGLSLAWIALSDARGEREDVSGPAIREIVSGAMEICLSRGVIPDEPDILKHILTDFCLFQGFDLVITTGGTGVGPRDITPDVTYTLLDKRLPGFEQAMMAAALKKTPRGAI-SRAVAGTMGLSLVVNLPGSLKAVRENLLSVLPAIRHAIEKLQGDQKDC...... 251
440 5.000e-34UniRef50_A0A1Y1NEZ1 Uncharacterized protein (Fragment) n=1 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1NEZ1_PHOPY  ali  25  1................MDSLTAAILVVSTTAAQSTDASASVLRNVLAEDGWQVMAESIVSDDVLAIQRRIIQWADADAPHLIITTGGTGFAVSDGTPEAINPLLHKQAPGLVHAMLSTSLAVTPFAMM-SRPAAGVRNKSLIVTLPGSPKGAKENLQAIIKTLPHACLQAAG........... 161
441 5.000e-34UniRef50_C6BYR9 Molybdenum cofactor synthesis domain protein n=4 Tax=Desulfovibrio TaxID=872 RepID=C6BYR9_DESAD  ali  26  98......................AYVTLSDAAGERKDEAGPLIAEMIKNALVSIAEGYLIPDECADLKALLMHLAYVDGYDLILTTGGTGVGPRDVSPEATLGVIEKRLPGFERAITATGLEKTPHAMI-SRAVAGTLGESVVVNFPGSPKAVRESLEAVLPALKHTVDKLQGDKTDCA..... 255
442 6.000e-34UniRef50_A0A1H2V6C4 Cyclic pyranopterin monophosphate synthase subunit MoaC n=6 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1H2V6C4_9BACT  ali  26  148..................SLRCAVIVCSDSAGSKEDSSGRTVVEKLQQHHLQASIYEVIPDEFALIQEKAQQLA-SEGYHLVLFTGGTGLSPRDVTPDAIRPLLSREIPGIMEAARNYGQQRTPYAM-LSRGVAGFIQNSLVITLPGSTKGAAETMEALFPYVLH.................. 294
443 6.000e-34UniRef50_S7THE5 Molybdenum cofactor biosynthesis protein B n=3 Tax=Desulfobacterales TaxID=213118 RepID=S7THE5_DESML  ali  35  2.......GVEEHKKGALKRVRLGIVTLSTTRGPAEDESGNWMAAASREKGHEILFHRVLPDDAAVIRETLLSLLDEHDPDAVLMNGGTGADPADVTIEAVHPLFRKELTAFGALFAQLSYADIGAAALISRASAGIIGRTAVFCMPGSIKACRLACDRLVFPELGHLVK.............. 163
444 7.000e-34UniRef50_A1RWZ1 Molybdenum cofactor synthesis domain n=8 Tax=Thermofilum TaxID=2268 RepID=A1RWZ1_THEPD  ali  31  1MDKDLGSSIAEHKRKALRDLRYAFVTVSTSRGEIPDVSVEVARELIERHGDKLVSYILVPDNPRLILEALVNLLERNDVDVVVFSGGTGPAPSDVTVETVEPLLEKRLAGFGDVFRGLSYQEVGSSAFLSNAIAGVVHGKLVFLLPGSPDAVREAFEKLILPEGHVLSIARGHR......... 182
445 7.000e-34UniRef50_A0A1F9ISP3 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_50_16 T  ali  28  143................PRDFKVAVIVTSDGQGIRRDKSGQIIREKLAGFGIVDCEYLVLPDEKEKIRQALLGF-YEKRFHLVITTGGTGLGPRDVTVEATQEVIDRVVPGIMEAARSFGQQRTPYSM-LSRGLAGLKGQMLIVNLPGSSRGAQESLEAIFPGLLHSYKMMAG........... 298
446 7.000e-34UniRef50_P44645 Molybdopterin adenylyltransferase n=1354 Tax=root TaxID=1 RepID=MOG_HAEIN  ali  22  5...................LKIGLVSVSDRAGVYQDQGIPELQAWLEQALVDPLETRLIPDEQPVIEQTLKELVDEQGCHLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQMRQVSLHFVPTAI-LSRQVGVIRKESLILNLPGQPKAIKETLEGV........................ 147
447 7.000e-34UniRef50_A0A1T4WRZ2 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Desulfovibrio TaxID=872 RepID=A0A1T4WRZ2_9DELT  ali  27  84................RRGWSVAWVTLSDARGERIDTAGPLVGEMLGEHDVSLTMGYLLPDDQSSLQLLLMDLAWGQGVDLIVTTGGTGVAPRDVAPDATLRVIEKRLPGMERAMTSESLAKTPHAMI-SRAVAGTLGLSLIINLPGSPKAVRECLGVVLPALRHTLEKLHGDPSDC...... 246
448 8.000e-34UniRef50_B0R6F7 Molybdopterin adenylyltransferase n=92 Tax=Archaea TaxID=2157 RepID=B0R6F7_HALS3  ali  36  40...........HHDDDVSQVGVAVVTVSSSRSLSDDPAGDAVVAAVEAAGHEVATRELVTDRYDRVQGALDNLTGRDDVAAVITTGGTGVTPDDVTVDAARPLFDMELPGFGEEFRRRSAADIGTKIIGSRATGGVVGGTLVFCLPGSEHAATLGTDEIILPELAHLAGLAGH.......... 201
449 9.000e-34UniRef50_A0A2V7YSW6 Molybdenum cofactor biosynthesis protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YSW6_9BACT  ali  37  20.......SAEQHRQAAPTILGFAILTVSDTRAKRDDTSGDAIRELAAAAGHRVIDSTLVPDDVAAIRGAVRRLLALPEVDVLVVTGGTGFSPRDVTLDAVGPLLDQRVDGFGELFRMISWAQVGAAAMLSRAAAGLVGTRAVFLLPGSPKAVTLAMEGLILPEAAHLVGQA............ 183
450 9.000e-34UniRef50_L8EZB9 Molybdopterin biosynthesis protein n=6 Tax=Streptomyces TaxID=1883 RepID=L8EZB9_STRR1  ali  25  107.............VSPAHPPRALVITASNRAGVYADKGGPVLAEGLTALGFAVDGPQVVPDGDPV--EAALRAAVTAAYDVVLTTGGTGISPTDRTPDVTRRVIDHEVPGIPEAIRAAGRAKVPTAA-LSRGLAGVAGRTLIVNLPGSTGGVRDGLAVLADLLPHAVDQLRGGDHPRP..... 270
451 9.000e-34UniRef50_A0A0C3J628 Uncharacterized protein n=2 Tax=Pisolithus tinctorius Marx 270 TaxID=870435 RepID=A0A0C3J628_PISTI  ali  31  2..................SFSAGVITVSDSAGVNEDKSGPLIQDILRTRGFERVVSAVASDDEESIRASLK-LILSLKVDCVFTTGGTGFGERDITPEAISPLLERQAPGLVHLLLSSSLKHTPLAA-LSRQLAGTIGKTLVVTLPGSTKAVRENLDALLGVLDHALDLIKG........... 157
452 1.000e-33UniRef50_A0A1V5JYL0 Molybdenum cofactor biosynthesis protein B n=82 Tax=cellular organisms TaxID=131567 RepID=A0A1V5JYL0_9BACT  ali  38  2............ESNHLKPLTVAVITVSSSRKPGTDASGKALIDLLSADGIEVTHYAVVPDDVARIRAEVS--AATSRATCVIVTGGTGLTPDDVTIEAVAPLLAKTIDGFGELFRLKSYEEIGTAAILSRAIAGVIDGRAVFCIPGSTKAVTLAAREIIIPEIRHI................ 156
453 1.000e-33UniRef50_A0A2E6Z1F1 Molybdopterin adenylyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6Z1F1_9CHLR  ali  21  8...................INIGIISISDRAGIYTDKGIPTIKNVLN-LSFKKSFKEIIPDEQKLIENTIIKFSDKLSCDLILTTGGTGPSHRDVTPDATTNVCNKILPGFGELLRRISYEIIETSIV-SRQTAGIRNNSLIVNFPGNPKSIEETLPSIINPIMHTLDLLKEEK......... 165
454 1.000e-33UniRef50_A0A1U9Z6X3 Molybdopterin adenylyltransferase n=67 Tax=cellular organisms TaxID=131567 RepID=A0A1U9Z6X3_9RHIZ  ali  28  6........................LTISDRRGEYEDQSGAMIETWLAETITSPYARVIIPDGVVSVREALADLCDNVKADLILTTGGTGPAPRDETPEAMHAIMEKELPGFGELMRRVSLEQAPTAI-LSRQTAGVRGKSLIVNLPGRPASIRLCLDAVFPAIPYCLDLIAGRIETDPRVKAH 169
455 1.000e-33UniRef50_A0A0L8G889 Uncharacterized protein n=3 Tax=Protostomia TaxID=33317 RepID=A0A0L8G889_OCTBM  ali  30  5............PSEVRNRIRVGLLTVSDTCFKADDKSGAGLRALILEDPGVVEVQQVVADELLEIKDILKDWCDNLKLDLILTTGGTGFSPRDVTPEATKMVIEKEAPGLSVAMIQKSLEITPMAV-LSRLVCGIRGQTLIINLPGSAKASKVRYMLYFRFGMH.................. 161
456 2.000e-33UniRef50_E4NFT9 Putative molybdopterin biosynthesis protein n=21 Tax=Actinobacteria TaxID=201174 RepID=E4NFT9_KITSK  ali  27  1...................MRALAVTVSNRAGVYEDRGGPLLVEGLRAMGFETDGPRVVPDGEPV--EAALRAAVAAGYDVVLTTGGTGISPQDLTPEMTARVIDREIPGIPEAIRAHGRAKVPTSA-LSRGLAGLAGRTLIVNLPGSTGGVRDGLAVLAPLLPHAVDQLAGGDHPRP..... 158
457 2.000e-33UniRef50_M5U842 Molybdenum cofactor biosynthesis protein B n=2 Tax=Rhodopirellula TaxID=265488 RepID=M5U842_9PLAN  ali  36  10.........GCGDVDANAALNVVVITLSDTRKIEDDKSGNRIVELLEDVGHKIAERIVMTDDAGPLRESVLAFVADDSVDAIITTGGTGIAPRDMAVDVMEELLDASLPGFGEYFRAVSISEIGPKAMLSRATAGRIGRTIAFALPGSTGAVTTAMNHCVLPIIRH................. 166
458 2.000e-33UniRef50_A0A2P4UQH5 Molybdopterin adenylyltransferase n=184 Tax=Actinobacteria TaxID=201174 RepID=A0A2P4UQH5_9ACTN  ali  26  9...................IRAMAVTVSNRAGVYEDRSGPLLVSFLEDLGCQVDGPVVVPDGEPV--AEVLADAVAAGYDVVVTTGGTGLSPTDETPEMTRRIIEREVPGIAEAIRQEGREAVP-AAVLSRGIAGTAGRTLIVNLPGSTGGVRDGMAVLGTVLRHAVDQIGGGDHPRP..... 166
459 2.000e-33UniRef50_A0A172TD09 Molybdenum cofactor biosynthesis protein B n=1 Tax=Deinococcus puniceus TaxID=1182568 RepID=A0A172TD09_9DEIO  ali  40  1...................MRVALLIISDTRTPDTDTSGQYLLAELQAQGHQVTSYRIVKDDAVEIRAALVAFV--REATIVISSGGTGITGRDVTIPVVESLITKPIPGFGELFRMLSYAQVGGAAMLSRAVAGLCRGAVIFALPGSLNAVTTAWEGLLKSELSHLA............... 147
460 2.000e-33UniRef50_C1MY41 Molybdenum cofactor synthesis protein n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1MY41_MICPC  ali  33  185...............VPTSVRLGVVTVSDRAGEYEDVTGPALVCQMTAAAAEPKDRVVVPDDARKIAAAIKTLAASG-CNLVLTTGGTGLSSRDVTPEATTSVLHKLAPGIPEAMHRAAVDRGVPHAMLSRSAAGVRDRCLVINLPGRPHAARDDLDVVMPVLAHAISQ.............. 351
461 2.000e-33UniRef50_L7U8T7 Molybdenum cofactor biosynthesis protein B n=3 Tax=cellular organisms TaxID=131567 RepID=L7U8T7_MYXSD  ali  39  7.......................VVTCSDSRDAARDGSGKVLRDGLESAGHNIAGYVVVKDDPEAIRGAVAAAQAAGARAL-LFTGGTGIGRRDTTVETLRALFEKELPGFGELFRMLSYRQIGSAAMMSRATAGTYQGMIIFALPGSPQAARLALDALILPELHAVRELT............ 154
462 3.000e-33UniRef50_A0A076N595 Molybdenum cofactor biosynthesis protein B n=35 Tax=Actinobacteria TaxID=201174 RepID=A0A076N595_AMYME  ali  23  5..................KRTARVIVASNRAGVYADHTGPVIAAWLAERGFDVPEPRVVPDG-DPVAQALREALD-DDVHVVITTGGTGISPTDRTPDVTAPLLDHQLPGLAEAIRSAGLPKVPTAV-LSRGVAGVAGRTLVVNLPGSRGGVKDGLGVLDGVLTHAVDQLAGGDHPRP..... 163
463 3.000e-33UniRef50_UPI000981055B gephyrin n=1 Tax=Castor canadensis TaxID=51338 RepID=UPI000981055B  ali  28  29..............................................KRLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGM-LSRPVCGIRGKTLVINLPGSKKGSQECFQFILPALPHAIDLLRD........... 153
464 3.000e-33UniRef50_B3QV96 Molybdenum cofactor synthesis domain protein n=1 Tax=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) TaxID=517418 RepID=B3QV96_  ali  22  18.................RKITVAIITVSDLAGIYKDESGPIVANVFPEDVYDIISKTIVADELNGIMNELIRCSDEEHADVIVTVGGSGCSSRDVTPDATAKVIEKEVPGISDVIRIANWQNYP-KMIYSRGMSGVRNDSLIVNLPGNPEGARIAIETIVGSIPNCIKTL............. 171
465 3.000e-33UniRef50_B8DRK1 Molybdenum cofactor synthesis domain protein n=12 Tax=Desulfovibrio TaxID=872 RepID=B8DRK1_DESVM  ali  29  96......PGGRVLHLLARRRGRAAWVTLSDAAGLRQDASGPTIAEMVREAMPLCIERGLLPDDGQRLRALLVDLALTQGYDLILTTGGTGIGPRDVTPEATLAVIERRLPGFEQAMMAASLAKTP-NAVISRAVAGTLGGAVIVNLPGSRKAVVENLAAVLPALAHALDKLQGDPAEC...... 269
466 3.000e-33UniRef50_A0A2R6JFV9 Molybdenum cofactor biosynthesis protein B (Fragment) n=5 Tax=Halobacteria TaxID=183963 RepID=A0A2R6JFV9_9EURY  ali  40  73...................LGIAVVTVSSSRTVADDPSGDAIVAAVEDAGHEVPIREIVTDDYDGVQGTVDTMVDREDVDAVVTTGGTGVTPDDVTVDAVSPLLDKRLPGFGELFRRLSYDEIGTRVVGTRAVAGASEGVLVFCLPGSENAARLGIEEVILPEVGHLAGLA............ 224
467 3.000e-33UniRef50_UPI00068645AC MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Desulfovermiculus halophilus TaxID=339722 RepID=UPI00068645A  ali  28  95...............VKSGVSLAWVTLSDSAGKRNDSSGPRIPEMISKHLPLCLSRGILRDDAGSLQSLLTHLALCEGFDLIVTTGGTGVAPRDITPEVTAGLVHKRLPGFEQAMMQASLAATPRAAI-SRAVAGILGSSLIINLPGSPKGVRENLAPLLPALDHTLDKIHGDPADCGR.... 260
468 3.000e-33UniRef50_L0RHE6 Molybdenum cofactor synthesis domain protein n=4 Tax=Desulfovibrio TaxID=872 RepID=L0RHE6_9DELT  ali  27  99......................AYVTLSDAAGQREDKAGPLIAEMIKNALVSIIQGYLIPDECNDLKALLNHLAHVSCFDMILTTGGTGVGPRDVSPEATLAVIDKRLSGFERAITAAGLEKTPHAMI-SRAVAGTIGDSVVVNFPGSPKAVRESLEAVLPALRHTVDKLQGDKSDCA..... 256
469 3.000e-33UniRef50_A0A221SVK1 Molybdenum cofactor biosynthesis protein n=2 Tax=Deinococcus ficus TaxID=317577 RepID=A0A221SVK1_9DEIO  ali  40  14......ASSQEHRAAAPASVRVAVITVSDTRQEATDQSGAYLHRELLAAGHQVVARRIVRDDAVEIRSALV--ALTREATVVLVTGGTGVTGRDVTVPVVESLLTKPMPGFGELFRMLSYAQVGGAAMFSRATAGLVRGAAVFSMPGSLNAVQTAWEQILKDQIGHVAH.............. 174
470 3.000e-33UniRef50_A0A2W5XNM1 Molybdenum cofactor biosynthesis protein n=1 Tax=candidate division WPS-2 bacterium TaxID=2052317 RepID=A0A2W5XNM1_9BACT  ali  21  11..................RWRIALIVLSDKAGLRQDACLPALRAALQPSRFAIVREEVLADDRERLEQLLTALCDSDEADGILTSGGTGLSPRDITPQATLAVADYQVPGLADAMRNRSAEHIPTAM-LSRAVVAVRRRTLIVNLPGSPRAIPETLGIILPVLDHAFQLLRETVGEHA..... 171
471 3.000e-33UniRef50_L1NSU9 Molybdenum cofactor biosynthesis protein n=20 Tax=FCB group TaxID=1783270 RepID=L1NSU9_9FLAO  ali  25  132.....KKGGKTDYKEATEGLTAAVIVCSDTAGKKEDKAGKAILAHL-ERYAVPATYTIIPDEVADIQNHIKQAV-NENTSLVLITGGTGLSPRDVTPEAVRPLLDREIEGIAETIRSYGQDRTPYSM-LSRSVAGTIGNSLVIALPGSTKGATESMDAVFPAVFHIFKMLKG........... 297
472 4.000e-33UniRef50_K2PT10 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MogA n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=K2PT10_9FLAO  ali  24  149................PSGLTAAVVVCSDSIGSKTDAAGKAIIAELEKYQIKVNHYQVIPDEKEIISQCATSLSKE--HHLLIYTGGTGLSLRDVTPEALEPLIHRRIPGIEEAIRAYGQQRVPFAM-LSRSLVGTIGNCLVMAIPGSTKGASESMKAVFPHLLHVFKILRGQTQH....... 307
473 5.000e-33UniRef50_A0A1G1M2P6 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1M2P6_9BACT  ali  26  2...................IRVAVLVVSSKIGREEDKGKAALVELVESIPASLAAYEVAPDERDAIRDRLTALCDGETVDVVLTVGGTGVRPTDVVPEVTREIADKEIPGIGEAMRVESLKKVQTAM-LARGTAAIRGRTLIVNLPGSPRGACENLSVVLPVLEHTIDKIQG........... 155
474 5.000e-33UniRef50_W2TSV0 Molybdenum cofactor synthesis domain protein n=1 Tax=Necator americanus TaxID=51031 RepID=W2TSV0_NECAM  ali  29  174.........................SVSDSAGKRKDLSGPAIVELIKNLDAQVVSTVTIPDDRSLIAATLRE--RTNDSDIIITTGGTGFAARDVTPEATVDVLERRCTGLEMALHSRSLAATPMAA-LSRAVAGISGHTLIVNFPGSVKAVRECWEVLEPVLNHAVDLLHD........... 323
475 5.000e-33UniRef50_C0QKG2 Molybdenum cofactor biosynthesis protein B n=20 Tax=Bacteria TaxID=2 RepID=C0QKG2_DESAH  ali  37  6...........HKSKDPGKLRVAVISVSTTRDLSQDKSGTWIKQQAKKEGHEVVVHHVVTDEIAAIRNMVEHVVTQITPNAILLTGGTGISPRDVTIEAVTPLFTKKLTAFATLFAMLSFEEIDSAALLSRARAGIINSVAVFCMPGSLKACKLACNQLIFPELGHIVTHMSEAP........ 169
476 5.000e-33UniRef50_A0PL01 Molybdopterin biosynthesis Mog protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0PL01_MYCUA  ali  25  9.......................IIIASTRAGVYTDECGPIIAEWLEQRGFSPLESKVVADGNPVGEAL--QDAVEAQVDLIITSGGTGISPTDSTPEQTVAVLDFVIPGLADAIRRAGLPKVPTSV-LSRGVCGVAGQTLIVNLPGSPGGVRDGLDVLADVVHHALDQIAG........... 156
477 5.000e-33UniRef50_A0A0E1NVG4 Molybdopterin adenylyltransferase n=457 Tax=cellular organisms TaxID=131567 RepID=A0A0E1NVG4_YERPA  ali  22  4...................LRIGLVSVSDRAGIYQDKGIPALEEWLTSALTTPVETRLIPDEQSLIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADRQMPGFGEQMRQISLHYVPTAI-LSRQVGVIRKQALIINLPGQPKSIKETLEGV........................ 146
478 5.000e-33UniRef50_A0A162SZT1 Molybdenum cofactor biosynthesis protein n=4 Tax=Bacteria TaxID=2 RepID=A0A162SZT1_9BACL  ali  23  7....................TACVITVSDTAGTREDQGGKRVADYLYTLQFMV-ERRVVADDLLQIESTLRTAVA-DHYALVVTTGGTGLGPRDVTPEATRNVIERLVPGMAEEMRRKGLEQTPFAI-LSRGVCGVAGRSLIVNVPGNPTGAVDSLKAIAPVLKHALAVLR............ 156
479 6.000e-33UniRef50_UPI000A000244 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Desulfovibrio cuneatus TaxID=159728 RepID=UPI000A000244  ali  29  99...............ARQGISLAVVTLSDAAGLREDESGPLIASMVAQAMPLCISHFLLPDDPGALRALVADLALRQGYDLVITTGGTGLSPRDSAPEALAPLLERSLPGLTQAMMAASLAKTPRAA-LSRAVAGTVGASIVFTLPGSKKAVQENLEAVVGALEHGLQKLQGDTRDC...... 262
480 6.000e-33UniRef50_A0A1D2I6F1 Molybdopterin adenylyltransferase n=94 Tax=Actinobacteria TaxID=201174 RepID=A0A1D2I6F1_9ACTN  ali  26  23.................APYSALVVTASNRAGVYEDTGGPLVAEGLRRFGFAVDGPQVVPDGDPVQAAL--RAGTEAGYDVIVTTGGTGISPTDRTPEATRAVIGHEVPGIAEAIRAHGRDKVPTAA-LSRGVAGVENGTLIVNLPGSRGGVKDGLAVLEPLLKHAVDQLRG........... 177
481 6.000e-33UniRef50_A0A1F3KL69 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3KL69_9BACT  ali  25  2...................IKCQIITLSDRAGEYIDTSSVYVKQYFEDKNIEYIGYTLIPDDADKLRELIYYFTRTTQVEVIFTCGGTGVGPRDITPETVTPLLDKTLPGVMELIRVK-YGLTNPKATLSRGIAGIINQTLIFTLPGSPKAGREYCEVIMPLLKHAVDVLKGHK......... 162
482 6.000e-33UniRef50_A0A1X6NWL4 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6NWL4_PORUM  ali  30  198..................RIKVGILTVSDRAGEYEDRGGPAIRSFVEAHLANPVIYQVVPDERAAIGAGIRSMATAYGCVLILTTGGTGPAARDVTPEATTEVCEKLMSGFGERMRAVGVANGVPSAILSRGVAGVCGGALVVNLPGNPGAVAECLGAVWGAVGHCVRVIGG........... 356
483 7.000e-33UniRef50_A0A1F9VSE4 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_12_FULL_59_9 TaxID=1797952 RepID=A0A1F9VSE4_9BACT  ali  31  23.......................VVTVSDSRKKRKDVSGDVLSRGLKEMGFDVRRRFVVPDEKVEIQAVVRKSAAEKN-SLLVLTGGTGLGPRDVTPEAVEEICDRMVPGLGEALRSSGASKTPMS-WLSRSAVGLYGNMLVAALPGSPRAVEEALAVLGPLLPHALDIARG........... 171
484 7.000e-33UniRef50_A0A2M9DWM3 Molybdenum cofactor biosynthesis protein B n=8 Tax=Desulfobacterales TaxID=213118 RepID=A0A2M9DWM3_9DELT  ali  30  2.......GTHEHKKRAPKAARVGILSMSSTRSLEEDKSGHWIHKEAVREGCQVVLHAVLPDDAGTIRQKVSDAINEFSPHILLLTGGTGIAEKDVTIEAVRPMFDKELTAFGVIFAQLSFGQIDSAAILSRATAGVVGRTVIFCMPGSIKACKLACRELIFPEVGHL................ 161
485 7.000e-33UniRef50_A0A2T4TWS4 Molybdenum cofactor biosynthesis protein B n=2 Tax=candidate division NC10 TaxID=640293 RepID=A0A2T4TWS4_9BACT  ali  31  3......AHDHHTEAKKVGPIRYVRLSITDSRKSEDDHSGRLIESLLNEAGHYQVASMILKNDPKGLREVIKKLC-EEEVDLIVMTGGTGLSKKDQTIEAISPLLDKVLPGFGELFRSLSFHEVGSAALMSRALCGTAKGKVIIALPGSVDAVRLAMTKLLIPEVQHL................ 162
486 8.000e-33UniRef50_U1QTZ6 Molybdenum cofactor synthesis domain protein n=6 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=U1QTZ6_9EURY  ali  38  57..............DEPDRASFGVLTVSTSRTLADDESGDAIVRGIENDGHRVVERELVGDDREAIRAAVLALV-EAGAEAVVITGGTGLAPDDVTVDAVGPLCDRAIPGFGELFRSLSYDDIGPNALLSRADAGIVDTVPVFCLPGSTQGATFGTEELVLPTITHV................ 208
487 9.000e-33UniRef50_A0A045JA78 Molybdopterin biosynthesis protein n=16 Tax=Actinobacteria TaxID=201174 RepID=A0A045JA78_MYCTX  ali  23  1................MSTRSARIVVVSSRAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEAL--HDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSV-LSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAG--GDHPR.... 160
488 9.000e-33UniRef50_A0A1Y4GA44 Uncharacterized protein n=2 Tax=Cloacibacillus sp. An23 TaxID=1965591 RepID=A0A1Y4GA44_9BACT  ali  26  45..........SEKAEIWPAIRTAVLTVSDSRGEREDTAGPELEHLAFMQGCVTEDKKIVPDDPEEICAAVMAWA-EAGISLVLTTGGTGLSQRDNTPEALLSIADKTVPGFGEMMRIETLKYTERS-FLTRSVAIITGRTLAVAFPGSRRGVEQCFGAIAGGLRHAVETLTGKASEC...... 211
489 9.000e-33UniRef50_A0A1J0LR34 Cyclic pyranopterin phosphate synthase n=12 Tax=Bacteria TaxID=2 RepID=A0A1J0LR34_9FLAO  ali  21  145.................KELTARVIVCSDSAGKKEDKAGKAIIKKLEECNVAITDYVIIPDEPFDIEQKIEK-SLEEETDLVIFTGGTGLSKRDVTPETIIPLLDTRIPGIEEAIRSYGQDRTPYSM-LSRSVVGLKNNSLILALPGSTKGAAESMDAIFPFVMHIFNVIKG........... 299
490 9.000e-33UniRef50_D7BEQ5 Molybdenum cofactor synthesis domain protein n=5 Tax=Bacteria TaxID=2 RepID=D7BEQ5_MEISD  ali  24  2...................IRVGILSVSDERGVYPDTTHTALREALAAGPFEVAAYELVPQESAQIKRVLRLWADREGYELILSAGGTGLSPRDNTPEATRELLEREVPGLAEQMRACIGAS--PHVVLSRGVVGTRGRSLIVNLPGEPDDARVALEAIFPLLSKTIEMITGKT......... 156
491 9.000e-33UniRef50_A0A2D8LD15 Molybdenum cofactor biosynthesis protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D8LD15_9CHLR  ali  26  18.................RVMKYIVITVSDTSSAKKDLSGPEIIKFMGKENI-LLGKEIISDDVDKIISIFNKWLSVEDLDLILTTGGTGIGPRDVTPEATKKVIDYEIPGIPELMRVKNYLNTDY-VSLSRAVAGVKSEKLXINLPGSIKAVQENLKIIYPLLKHAIELINGNTKH....... 176
492 9.000e-33UniRef50_A0A0M0K7N8 Duf1244 molybdenum cofactor synthesis fusion protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0K7N8_9EUKA :_  ali  32  169..................PIRLGILTVSDRAGVYADLSGPEIANAMQAAGWTVVRTVCVPDDIDAIRYVLRTWSERPSCNLILTTGGTGLAARDVTPEATRALLERPTPGITELLLRESLRVEPLAA-LSRAAAGLRGETLIVNLPGRPKAVRENLAVLMPLLGHCL................ 344
493 9.000e-33UniRef50_A0A2D7B6D3 Molybdenum cofactor biosynthesis protein n=34 Tax=Bacteria TaxID=2 RepID=A0A2D7B6D3_9BACT  ali  26  6...................IKVGIITISDRAGLYDDLGGPALKKASQDYEWEVVGETLVADEKRDIQRAVLEQI-RSGANLVLTTGGTGVALRDVTPEAVREIAVRELPGFGELMRMESLKITP-NAILSRSLAVVVEKGLVICLPGKPSGAVECLGFVLGAIPHCVE............... 154
494 1.000e-32UniRef50_A0A1J5N118 Molybdopterin adenylyltransferase n=15 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5N118_9DELT  ali  24  81MDD-MAAGNGTFEVS-RTGYALAWITLSDARGERVDESGPLVGRLVGELELNNVQGFVIPDETAQLKGLLVDLALNQGFDLILTTGGTGVAPRDVSPEATLAVIEKRLPGYERAMTMASLAKTPHGAI-SRAVAGTLGHALIVNMPGSPKAVAECLEPLLPTFRHTLEKLQGDPSDCAALR.. 261
495 1.000e-32UniRef50_A0A2V4PV36 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Microbacterium esteraromaticum TaxID=57043 RepID=A0A2V4PV36_9MI  ali  25  4.....................AAVLTVSDRAGARPDSAGPVAVSALREAGFDCDDAMIVSDGADAVEHALRELLASG-IRFIITSGGTGISPRDETPEGTARVLERQIPGIAEELRRAGLAATP-ASMLTRGLAGVVGDALIVNLPGSPKAVAEGMPIVLSVATHVLSQLHGE.......... 155
496 1.000e-32UniRef50_Q8U3T3 Molybdopterin adenylyltransferase n=40 Tax=Euryarchaeota TaxID=28890 RepID=MOAB_PYRFU  ali  35  2.......GVEEHKKEAPKTFKFGVITVSDAKGEREDKSGPLIIEELSKLG-EHVYYKIVPDDKIEVLIALFEAIKSG-ADVVVTTGGTGITRRDITIESIKPLFDKELS-FGEVFRAKSYEEVGYATVLTRATAGIIRGVVVFSLPGSVNAVKTGLEIIKSEVFHILKHAR............ 168
497 1.000e-32UniRef50_E6QKA8 Molybdopterin biosynthesis mog protein n=3 Tax=root TaxID=1 RepID=E6QKA8_9ZZZZ  ali  26  2...................PGFAVVTISDRCFASTDTAGQAVARMVEQWPDETIGRGLVPDHEDAIGTLLHELC-HNQYRLILTVGGTGLGPRDVTPEATRRIIDREVPGLAEAMRAGTAAAYRFA-WLSRAVAGLRGSTLIVNLPGSERGATECLQAILPLLPHALDIIAGGSAHPA..... 161
498 1.000e-32UniRef50_A0A1T9BP66 Probable molybdopterin biosynthesis protein Mog n=168 Tax=root TaxID=1 RepID=A0A1T9BP66_9MYCO  ali  26  7....................SARVIVASTRAGQYPDKTGPVIAEWLGAQDFHVERPIVVPDGDAVGEAIRSALADR--VSLVITTGGTGLSPTDVTPEQTAALLDHQIPGLADAIRRSGLPAVPTSI-LSRGVCGVAGRTLVVNLPGSTGGVRDGLAVLGGVLGHALDQIAG........... 157
499 1.000e-32UniRef50_UPI00032E649B molybdenum cofactor synthesis domain-containing protein n=1 Tax=Enterococcus faecalis TaxID=1351 RepID=UPI00032E649B  ali  24  138...............................GLAVDQSGSLIREQLPAL-YQVTKQTILPDEENQLVELLQEWSKT--CDLILTIGGTGLSERDRTPEATLRVAERIIPGISEGLRQLSLEKTPFAM-LSRGVSVQRGRTLIVNLPGSPKSVTEHLHFLLPVLPHALDLITNKK......... 276
500 1.000e-32UniRef50_A0A2R6FHW7 Molybdenum cofactor biosynthesis protein MoaB n=5 Tax=Halobacteria TaxID=183963 RepID=A0A2R6FHW7_9EURY  ali  36  33...................LGVAVLTISSSRSLDDDPAGDAIESVLEGTGHEVTIRELVTDEYDGVQDAVDRFVERDDTDCVVTTGGTGVTPDDVTAEAVEPLFDKRLPGFGELFRTLSYEEIGTKVVGTRAVAGVADGVPVFCLPGSENAARLGTGDIIIEEAPHLAGLAGRGEE....... 189
501 2.000e-32UniRef50_A0A1H9UFD4 Molybdenum cofactor synthesis domain-containing protein n=1 Tax=Actinokineospora terrae TaxID=155974 RepID=A0A1H9UFD4_9PSEU  ali  25  1................MTERTARVITASNRAGVYDDRTGPVIVAWLRGRGYAAPDPVVVADGAPVEQAL--RAAVAEGVDVVITTGGTGINPTDRTPEATRAVLDHEVPGLADAIRAAGLPEVPTAV-LSRGLAGVAGRTLVVNLPGSTGGVRDGLGVLDPVLDHAVDQLRG........... 155
502 2.000e-32UniRef50_A0A2G8SUG7 Uncharacterized protein n=1 Tax=Ganoderma sinense ZZ0214-1 TaxID=1077348 RepID=A0A2G8SUG7_9APHY  ali  32  1................MSQVRVAILTVSDTASASADRSGPVLQGLLTQAGYVCTRLQIVPDDEIRIRTVVLGWCDQGDVDWIITTGGTGFG-------AIKPLLEREAPGIVHLVLNASLQATPLAA-LSRPVAGTIKNTLVVTLPGSVKAVQENITALLQAGVHAIELVRG........... 152
503 2.000e-32UniRef50_A0A1G2ZFN7 Molybdenum cofactor biosynthesis protein B n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZFN7_9BACT  ali  32  1........MGVEEHKKYSGVRCAILVISDTKTFDTDTSGKLAQEVLEKDGNEVKLRSIIRNDVEVVRKEISVLL-SENIDLIVTIGGTGISKKDLSIEAVREFLDKELDGFGELFRSMSVKEIGTAAIMSRALLGTSNGKVILCIPGSTAAVRLAIEDILLPELKHI................ 162
504 2.000e-32UniRef50_I4F3P9 Molybdopterin biosynthesis protein B n=64 Tax=Actinobacteria TaxID=201174 RepID=I4F3P9_9ACTN  ali  28  9....................RAVVVTASNRAGVYPDRSGQALAEGLQALGFTVDGPHVCRDEVAGLSEVLREAVASG-ADVVLTTGGTGLSPTDVMPEATRQVLEREAPGIAEAVRRYGEGKVPTSV-LSRGIAGTAGRTLIVNLPGSTGGVRDGLAVLGPLLPHVVTQLRG........... 160
505 2.000e-32UniRef50_A0A1N5F6G9 Molybdenum cofactor synthesis domain-containing protein n=110 Tax=Actinobacteria TaxID=201174 RepID=A0A1N5F6G9_9MYCO  ali  28  16.......................VIVCSTRAGIYEDKSGPIAVDWLRSQGFETPDATVIAD--SQIVEYFADLVEQGNPTLILLSGGTGLNTDDQTVEAVRPHLDKEVPGIMHAFWQKGMENTP-AAVLSRGVAGIIGRTFVMTLPGSRGGVKDGCAVLDPIIEHICRQLKDYHDH....... 168
506 2.000e-32UniRef50_A0A239AW03 Molybdopterin adenylyltransferase n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A239AW03_9ACTN  ali  25  1...................MRALAITASNRAGVYEDRGGPLVVAGLRAMGFTVDGPRVVPDGDPVGGALRE--AVAEGYDVVVTTGGTGISPTDRTPEVTRAVLDYEVPGVAEAVRAAGREKVPTAA-LSRGVCGVAGRTLVVNLPGSTGGVKDGLAVLAPILVHAVEQIRG........... 152
507 2.000e-32UniRef50_G8SFN5 Putative competence-damage inducible protein n=31 Tax=Actinobacteria TaxID=201174 RepID=G8SFN5_ACTS5  ali  29  3...................IRARVIVASNRAGVYADTSGPRLVTGLRELGCEVGEPVVVPDGEPVAEAL--RAAVADRIDVVLTSGGTGVTPTDRTPEATRGLLDFEIPGIAEAIRAYSRDRVP-AAALSRGLAGVAGRTLIVNLPGSTGGAKDGLAVLGPLLAHTVDQIRG........... 154
508 2.000e-32UniRef50_A0A0T5ZM89 Molybdenum cofactor synthesis domain-containing protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T5ZM89_9CHLR  ali  33  6...................PGALVLTVSDGAGTRPDKSGPVLAELLEAAGFQV-ERAAVPDDAVVIAAAVRA--AAVRHRLVVTTGGTGMTPRDVTPQALRPLLDYEVPGFGELMRSEGRRSTPFAS-LSRSLGGVIGHCLVLAVPGSPGGARESLEAVLPALAHALETLANDSSRHA..... 162
509 2.000e-32UniRef50_UPI000947CCDD uncharacterized protein LOC109484042 isoform X1 n=3 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947CCDD  ali  26  31....................................................VTVQKCVPDDFQEIKDTLLEWSDVLRINLILTTGGTGFSPRDVTPEATKDVIEKEAPGMAVAMLMGSLNVTPLAM-LSRPVCGIRKNTLIINLPGSKKGSQECFHFVLPALPHALDLLADHRQNI...... 154
510 2.000e-32UniRef50_A0A0Q9R4Z2 Molybdenum cofactor biosynthesis protein n=3 Tax=Arthrobacter TaxID=1663 RepID=A0A0Q9R4Z2_9MICC  ali  25  3.................KQRTAALIIASTRAGVYQDECGPMIQRWLVGKGYAVQLAEVVPDGDAVREAL--AACLAGTPSVLITSGGTGLSADDVTPELTEPFLTRSLPGIMEAVRRAGAAKTPMAA-LSRGHAGVSEGTFVINLPGSPKAVQDGLDVLEPILDHICAQLEGSHEH....... 160
511 2.000e-32UniRef50_W4Z924 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4Z924_STRPU  ali  27  22.....................CAVITLSDRAGTYEDISGPTLVSGVEKLGGEVVAAEVLPDGIEPLATRLQALAAEG-VRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALSAQHTPMA-WLSRAEVVQLGTMLVFALPGSPKAAAQCLDILAPVLGHALAMVEGD.......... 173
512 2.000e-32UniRef50_S7HRL2 Molybdenum cofactor biosynthesis protein B n=6 Tax=Megasphaera TaxID=906 RepID=S7HRL2_9FIRM  ali  37  5..................PLRAAILTISNSRTFSDDTNGLLIQSALANYGHQVVDYQIVKDDKAEIERHLHEWVCS--VDLVITSGGTGMAKRDVTIETVEALFDKKIPAFQSMMTYFAYRRAGVQAMAYRTTAGIIHQCQVYCLPGLPSLIKIGMEKVILPEAFHL................ 152
513 3.000e-32UniRef50_A0A0P0MF51 Molybdopterin adenylyltransferase n=281 Tax=root TaxID=1 RepID=A0A0P0MF51_9BURK  ali  25  5................HDAVKIGIVSISDRAGVYEDKGLPALKTWLTQALKNPIEARLIPDEKEGISAALVELVDSG-CSLILTTGGTGPAIRDVTPEATLAIADKEMPGFGEQMRQISLKFVPTAI-LSRQVAVIRGQSLIINLPGQPKSIAETLEGL........................ 149
514 3.000e-32UniRef50_A0A1R4KQB8 Molybdenum cofactor biosynthesis protein MoaB n=2 Tax=Microbacterium esteraromaticum TaxID=57043 RepID=A0A1R4KQB8_9MICO  ali  27  2...................ISAAVLTVSDRAGTRDDAAGPVAVAALRDAGFACKGAVIVSDGADSVENALRRMLDAG-IRLIVTSGGTGIGPRDETPEGTARVLERPLPGIAEELRRIGLAANPPATMLSRGVAGVVGAALIVNLPGSPKAVAEGMPVVLSIAQHVLDQLDGE.......... 158
515 3.000e-32UniRef50_A0A1Q6DWI7 Molybdopterin biosynthesis enzyme MoaB n=1 Tax=Candidatus Methanohalarchaeum thermophilum TaxID=1903181 RepID=A0A1Q6DWI7_9EURY :_  ali  33  3...........HKHQKETECKIKIITVSDTRNIEKDKSGDKIQEILNDKKHTI-DRTIIKDNKTQIINKISQ-----KYDLIIYCGGTGISKRDVTVEAIKPLLDKEITGFAQYFRSKSFEEVGSRAILTRAIGGVINNTLVFALPGSVNAAKTGAKIIKKELNHLMYHI............. 155
516 3.000e-32UniRef50_A0A1M3CH11 Molybdopterin adenylyltransferase n=7 Tax=root TaxID=1 RepID=A0A1M3CH11_9BACT  ali  23  1...................MKIGRITLSDRAGVYEDLSGPEIERVVRECLDPDAEFIILPDEQSLIEQTLIELTDQLDCALVITTGGTGPAPRDVTPEATRAVLEKELPGFGEIMRAASFPHVPTAI-LSRATAGVRGTSLIINLPGQPRAIETCLQPLRPAVAKCLSLL............. 154
517 4.000e-32UniRef50_A0A1X4XXM9 Molybdenum cofactor biosynthesis protein MoaB n=1 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XXM9_9DELT  ali  26  1...................MKFAVITLSDKGYERQDLTGPALIDFIQKNDMDLAYYTVIPDDKEMLKKELIELSDN-NIDLIVTNGSTGIAPRDIAPDVTLELIEKRLFGFEEVMRLKSFEKTSTAIV-SRACVGTRKNSLIINVPGSPKAAIENISVVLGAIEHTIKKLQGDQTPCA..... 161
518 4.000e-32UniRef50_C4XNA3 Molybdopterin biosynthesis mog protein n=14 Tax=Desulfovibrionaceae TaxID=194924 RepID=C4XNA3_DESMR  ali  27  29....VLPAGQTPFAVTKKGLTLAWVTLSDSQGLRADAAGPAIAECAASLPLALAQGHLIPDEPAELRALLLDLAVTQGFDCIVTTGGTGLSPRDTTPEATLGVIEKRLPGFETAMLMASLSKTPHAM-LSRATAGTVGRAIVINVPGSPKAVRETLAAVMAAIPHGLDKLRGDPSDC...... 203
519 4.000e-32UniRef50_F9N7F1 Molybdenum cofactor biosynthesis protein B n=3 Tax=Veillonella TaxID=29465 RepID=F9N7F1_9FIRM  ali  36  9.................RPLTVAVITVSDTRTKETDKGGARVEELAREAGFEVVSRQIVTDTIDEIQGAIHQASNVSGADIIISTGGTGIAKRDVSIEAVQPLLDKEIPGFGELFRFLSYRDIGTKALASRAIGGVKDHTILFAIPGSVGAVTLAMKELILPEVKHLKR.............. 187
520 4.000e-32UniRef50_M4NGD3 GTP cyclohydrolase subunit MoaC n=193 Tax=root TaxID=1 RepID=M4NGD3_9GAMM  ali  28  160MSEAEQAHYRPRDIARLQGVPCAVVTLSDRAGSYEDRSGPLLVEGLRQLGAQVDHVEVLPDGVQPLAAHLRALA-EAQVRLCLCTGGTGLGPRDLTPEALAQVADRRVDGLAEMLRSESARHTPLA-WLSRAEAVQVGRMLVLAMPGSPRAAGQGLAIVGPLLAHALAMMNGE.......... 332
521 4.000e-32UniRef50_UPI000A00B0C0 MogA/MoaB family molybdenum cofactor biosynthesis protein n=1 Tax=Hyphomicrobium zavarzinii TaxID=48292 RepID=UPI000A00B0C0 :_  ali  23  66........................IVLSDRRGEYPDKAGPQIEASLAELGAKVLPVQVVPDDAKALLRAIDELV-REGAQLVVTSGGTGLGPKDITPETLLELGGKTVPGFGEVMRAKGTAYTPTS-YLSRSVAVVHGETLIVAMPGNPKAVAECFEAIAPMLPHALATM............. 212
522 4.000e-32UniRef50_A0A1V6A1M4 Molybdenum cofactor biosynthesis protein B n=3 Tax=Synergistetes TaxID=508458 RepID=A0A1V6A1M4_9BACT  ali  29  106...............PWRSLKVGVLTVSDSRGERVDTAGPALERSLPALGAVLKKTGIVPDETGKISDKIREW-MTAEVDIILVTGGTGISRRDVTPEAVKSLGCREIPGIGEYMRWKTSFENERSI-LSRSLAVACSGTIVITLPGSERGAVQCFSAVAPVLRHAVEVATGRSGDC...... 267
523 4.000e-32UniRef50_A0A2A6NML8 Molybdopterin adenylyltransferase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A6NML8_9BRAD  ali  26  18....................RIGILVVSDRRGEYKDQGGEAINSFLATRSNWIAIVKIIPDGIESVAGALIEMSDRETCDLILTTGGTGPAPRDLTPEATRSVITRELAGFGELMRRVSLEQVPTAI-LSRQTAGTRGQCLIVNLPGRPSSIDICLGAVFPAIPYCLDLI............. 170
524 5.000e-32UniRef50_A0A0F8W2Q4 Molybdenum cofactor biosynthesis protein B n=7 Tax=root TaxID=1 RepID=A0A0F8W2Q4_9ARCH  ali  29  1MKKKIKVH-EEHKQKAPKEINFALIIVSTSRYKETDRTIPMVEKVLKEVNISLIFKKVVPDSEEHLNNVLTKLMKDDTVDSIIFSGGTGLSPKDITYETIEPRLEKKFSGFGEIFRNISYNDIGSSAMLSRAVAGILRNKAVFLLPGSPNAVRLALDALIVPEIGHIMYMINKKE........ 186
525 5.000e-32UniRef50_C8P7E2 Molybdenum cofactor biosynthesis protein B n=67 Tax=Lactobacillus TaxID=1578 RepID=C8P7E2_9LACO  ali  34  3....................TAAILTISDSRQLATDRSGDLIADRLTSHQFTILKRILVKDDLVDIQAAFLQL-EQAGPDIIITNGGTGVAQRDTTIPAIRPLLVKVIPGFGEYFRQISLAEIGTRALASQALAGFYRNQLTYCLPGSPNACQTALDRLIIPEYQHL................ 149
526 6.000e-32UniRef50_A0A174THQ1 Molybdopterin adenylyltransferase n=2 Tax=root TaxID=1 RepID=A0A174THQ1_9FIRM  ali  25  4..................................................HQVVEYLLLPDEREPLEKELKRLADQRQVHVIFTTGGTGFSVRDITPEATIAVCDRMANGIADAIRNYSMTITPRAMF-SRAVSGLRGRTLIVNLPGSPKAVQEALEYLLPHLEHGISVLRGNVSECAR.... 131
527 6.000e-32UniRef50_A0A2N1R584 Uncharacterized protein n=1 Tax=Spirochaetae bacterium HGW-Spirochaetae-7 TaxID=2013839 RepID=A0A2N1R584_9SPIR  ali  29  22..........RSSRKDGSAVKVAVITVSDRRGEYEDLSGPEMESVFRALGIEI-ERTVVPDEKPAIVAALGRFV---GFDWIFTTGGTGPAPRDVTPEATAAFIDRQAPGLAEYLRLESLKETSHAVF-SRGIAGMRGTTYVVNAPGSVKAARLCATIFAPLLDHGVRMSNG........... 182
528 7.000e-32UniRef50_A0A0C3I2A3 Molybdopterin adenylyltransferase n=121 Tax=cellular organisms TaxID=131567 RepID=A0A0C3I2A3_9RHOO  ali  24  5...................IRIGLVSISDRAGTYEDQGIPALKDWLGRALTSPAETRLIPDERALIERTLVELVDRAGCNLVLTTGGTGPAVRDVTPEATLAIGDKEMPGFGEEMRRISLNFVPTAI-LSRQVAVIRGKCLIINLPGQPKSIRETLEGV........................ 147
529 8.000e-32UniRef50_A0A1Y3GET4 Molybdopterin biosynthesis enzyme MoaB n=2 Tax=Archaea TaxID=2157 RepID=A0A1Y3GET4_9EURY  ali  34  11...................FKIKVITVSDSRTLENDISGKTIQKQLEKKGHKV-NREIIKDEEKQIINSLKNY----NHDAYIYCGGTGISKRDVTVETLTPLFDKKLPGFGEYFRNKSFKEVGSRAMLSRATAGIKNQKPIFAVPGSKNASKLASKIITKEIGHII................ 153
530 8.000e-32UniRef50_A0A178WPZ6 Molybdopterin adenylyltransferase n=26 Tax=Actinobacteria TaxID=201174 RepID=A0A178WPZ6_9PSEU  ali  26  4....................TARVIVASNRRGVYEDKTGPVLVAWLAERGYDVPPPDVVEDGDPVGVAL--RAAVSDGVQVILTTGGTGISPTDRTPDVTRAVLDYELPGVADAIRAAGLPKVPTAV-LSRGVAGVAGRTLVVNLPGSSGGVKDGLRVLEDILAHAVDQLAG--GDHPR.... 159
531 8.000e-32UniRef50_A0A014CHH2 Molybdenum cofactor synthesis domain protein n=1 Tax=Acinetobacter sp. 25977_2 TaxID=1310906 RepID=A0A014CHH2_9GAMM  ali  21  5.SLAALSMAGVQTVEVYRAPKVAVLITGDEVGKVFDANGPLLKAWFEDYGLDI-ELIHVADEAEQVSHYFNQLKDS--HDVVITTGGVSVGDYDFVRPCAFEV------GFEQIFWKVKQKPGKPLFFAEYHNSQTRHSCYLLGLPGNPAAVYVAMQIYGKSLLDALQGNRQGPEWFTAILEH 186
532 8.000e-32UniRef50_A0A2E5UGI9 Molybdenum cofactor biosynthesis protein B n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E5UGI9_9BACT  ali  33  15........................ITISDSRTQATDDSGDVIEQKLIERGHLILQRAIVSDDVSNIQSQIREALAMQCAQFIIMTGGSGIGQRDCTPEAVKEFNHIPLEGFGEMFRLYSERDIGPRAMLSRATAGILKRVPFFILPGSTHAVTLAMDACILPIIGHVLDLCHTKEQT...... 172
533 8.000e-32UniRef50_A0A1H1EVD0 Molybdenum cofactor synthesis domain-containing protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1EVD0_9ACTN  ali  25  1................MTERHARVIAASNRAGTYEDRTGPIIVAWLRERGFRVADAEVVPDGTPVRAALER--AVEAEVELVLTTGGTGISPTDRTPEMTAELLDFSIPGLAEALRTAGLPEVPTAV-LSRGLAGVAGGTLVVNLPGSRGGVRDGLGVLDGVLEHALDQVRG........... 155
534 9.000e-32UniRef50_V4K7W3 Molybdenum cofactor synthesis domain n=5 Tax=TACK group TaxID=1783275 RepID=V4K7W3_9CREN  ali  32  4.....................FALVITSDSVGVVNDEITPIVEKALEEGGHQLVHRVVVPNDVYAIREAVADAA--SRADVVLVTGGTGLSPRDVSIEAVKSISSKELPGFGEVFRLKSLEQVGLNAMLSRASAFLVGSSLVFVTPGSPQAVRLALELILPVVGHALAQARGE-PHRH..... 159
535 9.000e-32UniRef50_A0A0F3LV82 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB n=9 Tax=Acinetobacter TaxID=469 RepID=A0A0F3LV82_9GAMM  ali  28  133.....KKGGKSHFSRVLAPMPASVIVLSDTAGKKPDTAGQNILEILAEANFQQVQYQVIPDSPEQLLALIEQ--QKNQYPLILTVGGTGLGPKDLTVETLAPLLEREIPGLMEASRSFGQKRTPYAA-LSRGVAGYIENSLVMTLPGSRQGAQESLLAVLPALVHVFDVQKN........... 299
536 1.000e-31UniRef50_A0A1G9T2E5 Molybdenum cofactor biosynthesis protein B n=2 Tax=Veillonellaceae TaxID=31977 RepID=A0A1G9T2E5_9FIRM  ali  39  10..................PLRAAILTVSNSRTFSNDTNGLAIQSGLTNYGHQVVDYAIVRDDKEEILKHIHNWTCS--VDMIITSGGTGLAKRDVTIETIEPLFDKIIPAFDEMLTLFAYRECGVQSIAYRSCAGVIHQCLVFCLPGAARLIKIGMDKIVLPEMFHL................ 157
537 1.000e-31UniRef50_A0A1V4Z3R4 Molybdopterin adenylyltransferase n=16 Tax=Methanomicrobia TaxID=224756 RepID=A0A1V4Z3R4_9EURY  ali  32  30..HMAKASHEKHKEKAGKQYTVAVITVSTSRFEKYDVSGQVIIDLLEKAGHK-TAYWLLKDNLLDIQTTLMEMLERADAAVL--CGGTGLTASDVTIEAVTPMLEKTIPGFGELFRLKSYEEIGTASVLSRATAGAIKGRAVFCIPGSPNAARLAVSQIIAPELGHI................ 202
538 1.000e-31UniRef50_UPI0009EA27B2 molybdopterin adenylyltransferase n=1 Tax=Aquitalea magnusonii TaxID=332411 RepID=UPI0009EA27B2  ali  22  2...................LKIGLVSVSDRAGVYQDQGIPALQDWLTQALASPTVTRLIPDEQAEIESTLRQLVDEEGCHLVLTTGGTGPAPRDVTPDATLAVADREMPGFGEQMRQISLRFVPTAI-LSRQVGVIRKSTLILNLPGQPKAIKETLEGL........................ 144
539 1.000e-31UniRef50_A0A0U0XQ85 MogA/MoaB family molybdenum cofactor biosynthesis protein n=255 Tax=Bacteria TaxID=2 RepID=A0A0U0XQ85_9MYCO  ali  26  7....................SARVIVASTRAGQYTDRTGPIIVEWLGAQGFRVDEPVVVPDGEAVGDAIRSAL----GASLVITTGGTGLSPTDSTPEQTAALLDYQVPGLADAIRRSGLPAVPTSI-LSRGVCGVAGRTLVVNLPGSAGGVRDGLAVLGGVLGHALDQLAG........... 155
540 1.000e-31UniRef50_K8EJ05 Molybdenum cofactor synthesis domain protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8EJ05_9CHLO  ali  27  187...................ISFGIITVSDRAGVYEDISGNVVRETIETYFHIIKGYKLVPDEEEEIAKAIVYMSDELKCDVILTTGGTGLAKRDVTPEATKSVLTREVKGIAESLRAHARRYEKHAA-LSRAVAGLRNNSLIVNLPGRPNAVSSSLGVLLPMLRHAVRQL............. 350
541 1.000e-31UniRef50_D4GUY1 Molybdopterin adenylyltransferase n=32 Tax=Halobacteria TaxID=183963 RepID=D4GUY1_HALVD  ali  40  40.....................AAVLTISSTRDVDDDPAGDAIAELLHEAGHSVSVRRVVDDDYDEIQIAVARMADRGDVDVTVTTGGTGVTPDDRTVEAATQLFEKTLPGFGELFRRLSYDDIGTKVVGTRATAGVVDGMPTFCLPGSENAARLGTAEIIVPEAPHLTGLA............ 189
542 1.000e-31UniRef50_P0AF04 Molybdopterin adenylyltransferase n=1010 Tax=root TaxID=1 RepID=MOG_ECO57  ali  23  1................MNTLRIGLVSISDRAGVYQDKGIPALEEWLTSALTTPLETRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAI-LSRQVGVIRKQALILNLPGQPKSIKETLEGV........................ 146
543 1.000e-31UniRef50_UPI0003C18538 uncharacterized protein LOC102319764 n=1 Tax=Pantholops hodgsonii TaxID=59538 RepID=UPI0003C18538  ali  22  2...............VKQFIKIGLVSISDRAGVYEDKGIPSLKTWLAKALITPIEARLIPDEQELISSTLADLVDHQECHLVLTTGGTGPALRDVTPEATLAIADREMPGFGEQMRQISLQFVPTAI-LSRQVAVIRKQCLIINLPGQPKAIQETLEGL........................ 148
544 2.000e-31UniRef50_A0A2E5T198 Molybdenum cofactor biosynthesis protein n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5T198_9CHLR  ali  24  5.................KKWRVYLIVLSDAQGKREDTAGESVKSMLKDNNFIINDKIIIPDDFDSLVAILKKETDPDYVQVIFTIGGTGLSPRDITPQATKLILDIEIPGLTELMRIKGYELNRLAII-SRSVAGIRNNVLIINLPGSKRGATESLGLIIEQIDHLLNQIQNKDDNYH..... 168
545 2.000e-31UniRef50_A0A1I2S0F7 Molybdenum cofactor biosynthesis protein B n=1 Tax=Halopelagius inordinatus TaxID=553467 RepID=A0A1I2S0F7_9EURY  ali  36  46.....................VAVVTVSSTRSLEDDPAGDAIVDALDEAGHDVVTRQLVDDDFDSVQSAVDNLVDRDDVGAVVTTGGTGVTPDDVTVEAVDDILRKRLPGFGELFRRLSYDEIGTRVVGTCATAGVSRGVVIFCLPGSENAARLGTEEIIVHEVPHLAGLA............ 195
546 2.000e-31UniRef50_A0A257AL10 Molybdenum cofactor biosynthesis protein n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AL10_9AR  ali  27  2..........MTHRGRWRRLRISVTVVSDTRTLKTDRSGKLITEILRSAGHEVMYGGIIGNMREEIRRSIEDAV-ERGVEVGVFCGGTGVGRRDLTVDTLAEVCEKEVNGFGEAFRSYSMREIGPFGMLSRAYMGIYRRVVLVALPGSPHAIETATKILIPVLCHVVEEVR............ 161
547 2.000e-31UniRef50_A0A1H8DMQ6 Molybdenum cofactor biosynthesis protein B n=8 Tax=Halobacteria TaxID=183963 RepID=A0A1H8DMQ6_9EURY  ali  38  60................PESLGVAIVTVSSSRTREDDPAGDTIEAALTDAGHEVAVRDVIRDDHDGVQNTVDAVAGRGDVDAVVTTGGTGVTPDDVTIEAVTPLFDKELPGFGELFRTLSYDEIGTKVVATRATAGIVDSAVVFCLPGSENAARLGAEEIIVEQAPHLAGLA............ 214
548 2.000e-31UniRef50_A0A2V3JGX0 Uncharacterized protein n=2 Tax=unclassified ANME-1 cluster TaxID=1046933 RepID=A0A2V3JGX0_9EURY  ali  38  605.....................CAVLTVSTSKFEVADLSGKIAKELVARAGHEVVFYDLLPDEEEKIKEGVSSALKSG-ADFVVTSGGTGLTKSDLTIEVVSRLLEKEMPGFGEIFRLKSYEGVGTAAVLSRAVAGVVGQKAVFCLPGSPDAVRLALSEIILPEIGHILKHA............ 765
549 2.000e-31UniRef50_A0A0F7IG73 Molybdopterin adenylyltransferase n=9 Tax=Archaeoglobaceae TaxID=2232 RepID=A0A0F7IG73_9EURY  ali  38  1..........MHEHDVALEYTVRVVTVSTSRFEKYDGSGRLIAE---SFGERVREYVLVPDDVQEIRRAVI----ESEEDVVVITGGTGLNPKDVTIEAVEPLFDRKIDGFGEIFRLESYKEVGFNALLSRATAGIVDGRVIFCLPGSKNAVRTGLEIIHSVVTHILSHARG........... 167
550 2.000e-31UniRef50_A0A2M6Z729 Molybdenum cofactor biosynthesis protein B n=2 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A2M6Z729_9BACT :  ali  31  10...........HKSSASKKIVFQIIVVSTSKGEREDRSGPLIKKIIEEAGYEVSGINIIPDDSKAIASSVR--TAEEIADAIILTGGTGLTSTDITIETIRPLLRKEISAFQTLFTTYSNNEVGPSCMLSRAMAGLINRSIIFAIPGSPQACELALKQIIIPEVAHISKHA............ 169
551 2.000e-31UniRef50_UPI0009DF7ECF hypothetical protein n=1 Tax=Kocuria sp. ZOR0020 TaxID=1339234 RepID=UPI0009DF7ECF  ali  26  13..........RRHAEVSGTYRAVVLVASTRAGRYPDKSGPTAVSMIREAGHECVDPIVVADGRAQMQHFLRDLPVGQRPDLLVTSGGTGLMPDDLTPELTREFLDRQLPGVMHAIWAAGLEHLRTA-GLSRGEVGVAGRTLVVNLPGSGGGVQDGMSVVLPLLDHVFQQLNGHRDAGHR.... 185
552 2.000e-31UniRef50_A0A2H5UZG0 Molybdenum cofactor biosynthesis protein B n=4 Tax=Archaea TaxID=2157 RepID=A0A2H5UZG0_9ARCH  ali  33  4........HEIHRSRSQVKVRVAVLTASTSRYEKKDESGLLAADILRGMGYEVEYLGVVKDDILMIRKAVIE-SLSGDFDILVITGGTGISPTDVTLEAVKPFFEKEIEGFGEIFRMESFKQIGAAAMLSRAAAGIANGKLVMAIPGSPKAVETALNLFGREIPHTIFIARGLH......... 175
553 2.000e-31UniRef50_F6FQP3 Molybdenum cofactor synthesis domain protein n=20 Tax=Actinobacteria TaxID=201174 RepID=F6FQP3_ISOV2  ali  29  9................PVPYRVAVVVASDRAGVYEDRSGPAAAAWFAERGWSVDAVRVVPDG-EPVRAALETLLGDRAPDLIVTSGGTGLAPTDRTPEATRAVVDREAPGVAELVRSRSAKRAVPAAALSRGIAGVAGRTLVVNLPGSVGGVVDGLDALADVLPHAVEQLRG........... 176
554 2.000e-31UniRef50_D3SWQ3 Molybdenum cofactor synthesis protein n=9 Tax=Halobacteria TaxID=183963 RepID=D3SWQ3_NATMM  ali  35  14...........HGHDVIDPLYVGIVTVSSSRAQADDAGGDTIQECFEAEGHEVQERLLVRDDYSSIRTAVRGLVARADIDVVVTTGGTGVTADDVSPEATSSLFERDLPGFGERFRALSWEEIGTRTIASRATAGIAVDTPVFCIPGSTGACQTACEQLIVPESPHLAGLA............ 180
555 3.000e-31UniRef50_A0A2J6HH22 Molybdenum cofactor synthesis protein n=6 Tax=Bacteria TaxID=2 RepID=A0A2J6HH22_9BACT  ali  28  138..GKMKAGDTLEYRPKIQ--KVHVITLSDRRGEYEDRSGPAIEEKLK-IFFSVITRTVIPDDPEALEALIAH-SVNADFDAIITTGGTGVGERDITPETIQPMLDKELPGIMEMIRVKYGEK-KPQALLSRSIAGTINKTQVYSLPGSVRACNEYLDEILKTYHHLMLMLHGVDAH....... 314
556 3.000e-31UniRef50_A0A2E3RRD5 Molybdenum cofactor biosynthesis protein B n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RRD5_9BACT  ali  35  17.................KPITACILTVSDTRTHQDDHGGDAIEQRLVGSGCRIIQRSITRDEPGNIRDVLTAWIDRGDVQVILCTGGTGIARRDTTIEVVRSLLHVQLDGFGELFRSISHARIGSAAMLSRSTAGLAPGTLIFAMPGSLDAVETAMDELIIPQLRHL................ 175
557 3.000e-31UniRef50_A0A1V6JDY8 Molybdopterin adenylyltransferase n=34 Tax=FCB group TaxID=1783270 RepID=A0A1V6JDY8_9BACT  ali  21  165.......................VIILSDRAGKYTDKSGPEIIKMLGDFFYKTLHSQILPDNAECLKNIITQ-SFNEKTDLLITTGGTGIGPHDTTVDVVAPFLQKQIPGIMEIIRIKYGTVNP-AALLSRSVAGIYDKTLVFTLPGSPKAVREYLNEIFKILPHCFEMLYGIDKHKH..... 324
558 3.000e-31UniRef50_H0URS4 Molybdenum cofactor synthesis domain protein n=2 Tax=Thermanaerovibrio TaxID=81461 RepID=H0URS4_9BACT  ali  31  104................WEPITTGVLTISDARGEREDTAGPALAERALCIGAEVIKRDVVPDDVEMIRDKVLNW-GREGIELILCTGGTGLSPRDVTPDAIMGIADKLVPGFGEMMRIKTSHANPRS-FLSRGIGALVGKTLVLTFPGSRRGALECFEAVEEGIRHGVEIANGRAMEC...... 264
559 3.000e-31UniRef50_A0A0D8FT89 Molybdopterin adenylyltransferase n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A0D8FT89_9ACTN  ali  32  4.....................AKVVTVSDGAGTREDRSGQALVDRLSGLGYEIAGRVVVADGAENVASTLRN-VTTDFVGLVVTTGGTGFGPRDLTPEGTRAVLDRLAPGLGEQMRAAS-----PLGGLSRGVAGTIGSCLVLNLPGSPRGAIESLDAVVPLLEHALGLLAGGDTEHP..... 156
560 3.000e-31UniRef50_A0A2V9JQR1 Molybdenum cofactor biosynthesis protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JQR1_9BACT  ali  27  5...................LRAKIIVLSDAAGRREDKSGPAVRELLESRGWVVVACEVLPDEPSRLRERLEAWTDATDCDAVFTTGGTGLGPRDITPEVTRATIEKEIPGLAEAMRAEGVKKTPRAT-LSRAVAGARKGKLILNL...................................... 131
561 3.000e-31UniRef50_H7F7M8 Molybdenum cofactor biosynthesis protein B n=4 Tax=Listeria fleischmannii TaxID=1069827 RepID=H7F7M8_9LIST  ali  36  10....................NCAVVTISDTRTFDTDSSGTYIKEALTAANHHVLRHVIVPDDGAKIKHLFAELKKEP-LHAIISTGGTGLSKRDVTYEALFSEVKQEIPGFGELFRQISFADIGTRAMATRAFSGFLEEILFFALPGSKNACETGMKHLILPEMGHL................ 156