current user: public

If you have questions about the server, please let us know.

Query: ACL93484.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# E-value Template Links and tools%idFirst MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALAGPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGGLast
1 2.000e-29UniRef50_I2BAZ4 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=I2BAZ4_SHIBC  ali  29  1MINVLFFAQVRELVGCDSLRVDFPSVEALRQHLCARGDRWALALESGKLLFAVNQTLVAADHPLCDGDEVAFFPPVTGG 81
2 3.000e-29UniRef50_A0A1S1HXK6 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1S1HXK6_PROST  ali  30  1MITVLFFAQVRELVGTDRLDVSYPTVETLRQALAAKGERWALALEDGKLLAAVNQSFVATDHPLSDGDEVAFFPPVTGG 81
3 1.000e-28UniRef50_I0QR08 Molybdopterin synthase sulfur carrier subunit n=21 Tax=Gammaproteobacteria TaxID=1236 RepID=I0QR08_9GAMM  ali  34  1MIDILFFAQVRELIGTGSLQIEFSNVETLRQALSQRGDRWALALESGKLLVAVNQTLVEPNHPIKAGDEIAFFPPVTGG 81
4 1.000e-28UniRef50_D2TPJ3 Molybdopterin synthase sulfur carrier subunit n=92 Tax=Proteobacteria TaxID=1224 RepID=D2TPJ3_CITRI  ali  34  1MIKVLFFAQVRELVGTDTLEVDFPTVSALRQHLAANGGRWALALEDGKLLAAVNQTLVSFDHPLSAGDEVAFFPPVTGG 81
5 2.000e-28UniRef50_B4ESV2 Molybdopterin synthase sulfur carrier subunit n=22 Tax=Gammaproteobacteria TaxID=1236 RepID=B4ESV2_PROMH  ali  30  1MIKVLFFAQVRELVGVDSLELDYPTVDDLRRALINKGDRWALALEDGKLLSAVNQSFVQGTYAIKDGDEVAFFPPVTGG 81
6 5.000e-28UniRef50_A0A094JCF8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Alteromonadales TaxID=135622 RepID=A0A094JCF8_9GAMM  ali  30  1MINVLFFAQVRELLGTASVQVDLATAADLRAHLASQNDKWAQVLDSDKLLVAINQTMSQWHAAIQDGDEVAFFPPVTGG 82
7 6.000e-28UniRef50_A0A0F5VFI1 Molybdopterin synthase sulfur carrier subunit n=23 Tax=Bacteria TaxID=2 RepID=A0A0F5VFI1_9GAMM  ali  31  1MIKVLFFAQVRELTGCDMLQLEGTSVEQLRNELAQRGERWALALEAGKILAAVNQTMVPLTFPLKAGDEVALFPPVTGG 81
8 8.000e-28UniRef50_C6C914 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Proteobacteria TaxID=1224 RepID=C6C914_DICP7  ali  31  1MINVLFFAQVRELTGTDRLSLEYADVAALRQALCARGGRWALALEDGRLLAAVNQSLVTMTHPLADGDEVAFFPPVTGG 81
9 9.000e-28UniRef50_B3PDN2 Molybdopterin synthase sulfur carrier subunit n=20 Tax=Bacteria TaxID=2 RepID=B3PDN2_CELJU  ali  35  1MIRVLFFAQLREQLGVHELVLDIETLEALREHLVNQHETWRSWLFRPNVLVAINQEYARLSAMVDSGDEVAFFPPVTGG 82
10 1.000e-27UniRef50_A0A0J5P482 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0J5P482_9PAST  ali  29  1MIKVLFFAQTRELIGIDQLELDVETAEQLRQQLSERGKNWALALTEGKLLVAINQTISPLNTPIKDGDEIAFFPPVTGG 81
11 1.000e-27UniRef50_E0SKA8 Molybdopterin synthase sulfur carrier subunit n=178 Tax=root TaxID=1 RepID=E0SKA8_DICD3  ali  31  1MITVLFFAQVRELTGTDRLSLEYQDVASLRQALCAQGDRWALALEDGKLLAAVNQALVAMSHPLSDGDEVAFFPPVTGG 81
12 2.000e-27UniRef50_C7RBV3 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=C7RBV3_KANKD  ali  24  1MINVLFFAKYREQLNMDSLQLDASSVQSVIEALKNKGDTWHQVFTQSGLMIAVNQQMAKLNSPLKDGDEVAFFPPVTGG 81
13 2.000e-27UniRef50_P30748 Molybdopterin synthase sulfur carrier subunit n=439 Tax=Bacteria TaxID=2 RepID=MOAD_ECOLI  ali  29  1MIKVLFFAQVRELVGTDATEVDFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG 81
14 2.000e-27UniRef50_A0A2E0HLE9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Pseudomonadales bacterium TaxID=1891229 RepID=A0A2E0HLE9_9GAMM  ali  39  1MIKVLFFARVRDQAGRAELELPLPDGGQLMAVLSQRDEKLQQALSDPRLLMALNQEMAGPDTTVEEGDEVAFFPPVTGG 83
15 2.000e-27UniRef50_A0A0D8D006 Molybdopterin synthase sulfur carrier subunit n=120 Tax=cellular organisms TaxID=131567 RepID=A0A0D8D006_9GAMM  ali  29  1MIKVVFFAALREQLNCAELELSADSIAKVKQLLVEQNPQWQDTFSNASLLSAVNHEMVDGSHPVKAGDEVAFFPPVTGG 83
16 3.000e-27UniRef50_C5B7H0 Molybdopterin synthase sulfur carrier subunit n=22 Tax=Gammaproteobacteria TaxID=1236 RepID=C5B7H0_EDWI9  ali  34  1MIQVHFFAQVRELTGCAELACECRDVETLRATLAQRGDKWALALEPGKLLAAVNQTMAPFDHPLQDGDEVAFFPPVTGG 80
17 4.000e-27UniRef50_A0A066RUZ1 Molybdopterin synthase sulfur carrier subunit n=145 Tax=Bacteria TaxID=2 RepID=A0A066RUZ1_9GAMM  ali  31  1MIHVLFFAQVRELTGCDVLQLEADSVEQLRAALAERGDRWALALEKGKLLAAVNQTMVPLDYLLKSGDEVALFPPVTGG 81
18 4.000e-27UniRef50_K4KWI3 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Proteobacteria TaxID=1224 RepID=K4KWI3_SIMAS  ali  35  1MIEVKFFARLRDQLGQTGLALPATTAADVRSALLAQHPHWQDTLSQPSVLVAVNQTMAQWESPVAEGDEVAFFPPVTGG 82
19 5.000e-27UniRef50_A0A1Y5CVD8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Colwelliaceae TaxID=267889 RepID=A0A1Y5CVD8_9GAMM  ali  29  1MIKVVFFAALREQLNCSELSLNLTTVADLKTALASKDENWQQVFANNALLSAVNHDMVHSEQAIKSGDEVAFFPPVTGG 82
20 6.000e-27UniRef50_E3G316 Molybdopterin synthase sulfur carrier subunit n=95 Tax=Bacteria TaxID=2 RepID=E3G316_ENTLS  ali  32  1MINVLFFAQVRELVGTDRLTFEADNVETLRQQLASRGDRWALALEEGKLLAAVNQTLVAFDHPLADGDEVAFFPPVTGG 82
21 8.000e-27UniRef50_A8G1M8 Molybdopterin synthase sulfur carrier subunit n=57 Tax=Gammaproteobacteria TaxID=1236 RepID=A8G1M8_SHESH  ali  35  1MINVLFFAQVRELLGESGLQVELSSAETLRAALAAKDEKWGRVLASDKLLVAVNQTISSWDTPVQDGDEVAFFPPVTGG 83
22 8.000e-27UniRef50_A0A0S2JLC4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Colwellia TaxID=28228 RepID=A0A0S2JLC4_9GAMM  ali  22  1MIKIVFFAALREQLACAELSLDVKTVGDVKQRLSDKNSQWQQTFSKASLLSAVNHDMVDDSHLVKSGDEVAFFPPVTGG 82
23 9.000e-27UniRef50_E6WC77 Molybdopterin synthase sulfur carrier subunit n=136 Tax=root TaxID=1 RepID=E6WC77_PANSA  ali  35  1MIKVLFFAQVRELTGTSALELEYADVAALRSALATKSDRWALALESGKLLAAVNQTLVPMSHPLRAGDEVAFFPPVTGG 81
24 1.000e-26UniRef50_A0A1H7KK88 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Colwellia TaxID=28228 RepID=A0A1H7KK88_9GAMM  ali  27  1MIKVLFFARLREQLATDSLQLAVTTTEHIRQQLAQKGATWAQVMSADTLLVAVNQEITDWSHSVNSGDEVAFFPPVTGG 82
25 1.000e-26UniRef50_F9TCI4 Molybdopterin synthase sulfur carrier subunit n=30 Tax=Proteobacteria TaxID=1224 RepID=F9TCI4_9VIBR  ali  32  1MIKVLFFAQTRELVGMDELQLEGATVEEVRSHLVEQDGKWDLALEPGKLLAAVNQSIVPLEHPIQSGDEVAFFPPVTGG 81
26 1.000e-26UniRef50_H3KD37 Molybdopterin synthase sulfur carrier subunit n=19 Tax=Proteobacteria TaxID=1224 RepID=H3KD37_9BURK  ali  31  1MIRVLYFAVLRDAIGHAEDQVECPEGGTVREALVARGEPWASAFANKRIRGAVNQEMADDDEPVKDGDEVAFFPPVTGG 84
27 1.000e-26UniRef50_Q8E943 Molybdopterin synthase sulfur carrier subunit n=132 Tax=Bacteria TaxID=2 RepID=Q8E943_SHEON  ali  35  1MINVLFFAQVRELLGTAQLSIEASTAEGLRATLAATDDKWAKVLASDKLLVAVNQTISQWDTRVNDGDEVAFFPPVTGG 83
28 2.000e-26UniRef50_A0A2E2K5M8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2E2K5M8_9GAMM  ali  32  1MIKVLFFAKLREALGQSELQWPLASVEDVRAALVAEYPQWQEALCASNVLTALNQEVVNAKARVKPGDELAFYPPVTGG 82
29 2.000e-26UniRef50_A0A1A6KZ92 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1A6KZ92_9VIBR  ali  27  1MIKVVFFAQVRELVGQDELTIDLTSVNAIRQQLIERGDKWALALESGKLLAAVNHTMCPLETEVKTGDEVAFFPPVTGG 81
30 2.000e-26UniRef50_A0A1M6B3V3 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1M6B3V3_9VIBR  ali  36  1MIKVLFFAQTREILGLDEIEVEGATVQALRDSLATRSDKWALAMEPERLLMAVNQTIVQPEASVADGDEVAFFPPVTGG 81
31 3.000e-26UniRef50_A0A2D8HUJ9 Molybdopterin synthase sulfur carrier subunit n=56 Tax=Proteobacteria TaxID=1224 RepID=A0A2D8HUJ9_9GAMM  ali  24  1MITVKFFAVLRERLGLAETQVDVSTVQELVQVLKQQSERYAKELDRYQLLCAVNQKLLPLTTEVKDGDEVALFPPVTGG 81
32 3.000e-26UniRef50_A0A087J109 Molybdopterin synthase sulfur carrier subunit n=93 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A087J109_VIBVL  ali  34  1MIKVLFFAQTRELVGVDSVDVEADTVESLRAHLAEQEGKWSLALEAGKLLAAVNQSIVPLETTLQDGDEVAFFPPVTGG 81
33 3.000e-26UniRef50_D8MPX2 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=D8MPX2_ERWBE  ali  35  1MINVLFFAQTRELVGTGSITVDYATVDELRAVLAAKGDRWSLALESGKVLSAVNQTLVSPQHALKAGDEVAFFPPVTGG 81
34 4.000e-26UniRef50_C4LFJ9 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Proteobacteria TaxID=1224 RepID=C4LFJ9_TOLAT  ali  32  1.MKVLFFAQTRELVGVDELTIDEPTAQQLREALATRGDKWQLALQESPLLVAVNQCLVPWDTPLSADDEIAFFPPVTGG 80
35 6.000e-26UniRef50_Q47V88 Molybdopterin synthase sulfur carrier subunit n=17 Tax=Bacteria TaxID=2 RepID=Q47V88_COLP3  ali  25  1MIKIVFFAALREQLDCAELSLDAKTVDDIKQLLSDKNEQWQQTFSNTSLLSAVNHDMVDGSHLVKSGDEVAFFPPVTGG 82
36 6.000e-26UniRef50_W0Q802 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=W0Q802_9PAST  ali  31  1MIKVLFFAQVRELVATDMLEVQATTAEELREHLSQQGKKWQLALEKGKLLVAINQTISPLDSPIKDGDEVAFFPPVTGG 81
37 7.000e-26UniRef50_A0A2A5HWS4 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5HWS4_9ALTE  ali  26  13.INILYFASLAESLGCECESFNLASVADLKQQLAARGEQWQRLINAPSTRCAVNQSLAEDEQVLASNDEVAFFPPVTGG 94
38 8.000e-26UniRef50_A0A2X3H1S3 Molybdenum cofactor biosynthesis protein MoaE n=26 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2X3H1S3_KLEPN  ali  28  1MIKVLFFAQVRELVGTDSLTLELATVEAVRQQLAARGDRWALALEEGKLLAAVNQTLTSFEHPVASGDEVAFFPPVTG. 81
39 8.000e-26UniRef50_K6Z857 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=K6Z857_9ALTE  ali  36  1MIKVLFFGQLKDQVQTGSIEVSVEDVANLKKTLVLYHPQWSEYLSADSTLVAVNQTIGNENTLLTDGDEVAFFPPVTGG 81
40 1.000e-25UniRef50_A0A1B3LRZ3 Molybdopterin synthase sulfur carrier subunit n=23 Tax=Proteobacteria TaxID=1224 RepID=A0A1B3LRZ3_9PROT  ali  24  6.IKVLYFAALREALGTPGETLELPTLADVRALIAGRGGDWGALAQMKNLRAAINQRMTDPASPVADGDEVAFFPPVTGG 87
41 1.000e-25UniRef50_K6ZM16 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Proteobacteria TaxID=1224 RepID=K6ZM16_9ALTE  ali  25  1MIKIQFFASLRERLGQAKMNVEYNTVEALKQQLLTRGEDWQ-ALSGNNVLCALNQSICKPDTIINDGDEIAFFPPVTGG 81
42 1.000e-25UniRef50_A0A1E2ZEF5 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E2ZEF5_9GAMM  ali  26  1MIQILFFARFREELGVASEQLELSSIGDLLEALCGRGDAWARLFEDQRVMMAVNQELADRNTILKAGDEVAFFPPVTGG 83
43 2.000e-25UniRef50_A0A0A3AKG4 Molybdopterin synthase sulfur carrier subunit n=164 Tax=Bacteria TaxID=2 RepID=A0A0A3AKG4_9PAST  ali  37  1MIKVVFFAQTRELIGESAIEVEAADAEALRQALSEKGERWALALNSGRILVAVNQSIVPLSTPLQAGDEVAFFPPVTGG 81
44 2.000e-25UniRef50_A0A0A3ZV01 Molybdopterin synthase sulfur carrier subunit n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0A3ZV01_9GAMM  ali  34  1MINVLFFAQIRELVGTGSVTMEYATVEALRAALASKGDRWALALESGKVLSAVNQTLVAMQYELKPGDEVAFFPPVTGG 81
45 2.000e-25UniRef50_A0A0Q0JFT7 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q0JFT7_9GAMM  ali  32  1MIQVLFFAQVRELLGTAKTEISITNTEQLRQALASTDEKWAKVLSSDKLLVAVNQTMSAWDAAVADGDEVAFFPPVTGG 82
46 3.000e-25UniRef50_J5HJ44 Molybdopterin synthase sulfur carrier subunit n=15 Tax=root TaxID=1 RepID=J5HJ44_9PAST  ali  34  3.IQVLFFAQTRELVGVDSLRVEFDTAEALREHLSQQGPKWQLALEKGKLLVAINQTIASLESAIQDGDEVAFFPPVTGG 82
47 3.000e-25UniRef50_A0A1A7QAP7 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1A7QAP7_9PAST  ali  36  1MIKVVFFAQTRELIGEAELSVPAADVEALRQDLSQRGERWALALNSGRILAAVNQDLVPLNTALKAGDEVAFFPPVTGG 81
48 3.000e-25UniRef50_A0A1E5Q7P5 Molybdopterin synthase sulfur carrier subunit n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A1E5Q7P5_9PROT  ali  30  1.MKVLYFAWLKEKTGLSSEDVDLPDVSGFVAWLQGRGDGYADAFGDASIRVAVNQEHVEMSHPLSNGDEVAFFPPVTGG 83
49 4.000e-25UniRef50_A0A075R8N3 Molybdopterin synthase sulfur carrier subunit n=37 Tax=Bacilli TaxID=91061 RepID=A0A075R8N3_BRELA  ali  33  3.VTLLLFAGLAERAGQNSIQIELPTVQDLLDKLPHEYPALKELL--SSCFVSVNQEYADHHTIIKENDEVAILPPVSGG 81
50 4.000e-25UniRef50_A0A1I0AQU7 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Alteromonadales TaxID=135622 RepID=A0A1I0AQU7_THASX  ali  30  1MVTIRFFAALKEQLDCSSLTIDISDIAALKAHLVDVNPHWKEALLNNALLASVNHQMVNEQCAIKQGDEVAFFPPVTGG 82
51 4.000e-25UniRef50_A0A2H6JU20 Molybdopterin synthase small subunit n=1 Tax=archaeon BMS3Bbin15 TaxID=2005738 RepID=A0A2H6JU20_9ARCH  ali  26  1MVRVRLFAWFREKAKRDTIVLSLTTVGDVLEQIKNEIPELGDALKEKNYFVAVNHEVAEKNTEVKDSDEIAIFPPVSGG 82
52 4.000e-25UniRef50_A0A0X8LN15 Molybdopterin synthase sulfur carrier subunit n=43 Tax=root TaxID=1 RepID=A0A0X8LN15_VIBFL  ali  34  1MITVLFFAQTRELVECDRLTLEASTVEALRAHLAEQPGKWSLALEPGKLLAAVNQSIVPMDFALSDGDEVAFFPPVTGG 81
53 4.000e-25UniRef50_A0A2A5GF08 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Porticoccaceae TaxID=1706374 RepID=A0A2A5GF08_9GAMM  ali  33  1.MKVLFFGSLREQLGTSELNTALPTIGQLLASLQAQGDEWKLALGTGNVLFAVNQDMVDADTTISDSDEVALFPPVTGG 82
54 4.000e-25UniRef50_A0A1Z8U9W6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8U9W6_9PROT  ali  29  1.MKIRYFAWLREHIGTSSEDIAVDTVSDLVVFLSARSSGHQSALSDMTVRVAVNHVYVDIDHPITAGDEIAFFPPVTGG 83
55 5.000e-25UniRef50_A0A2A5CTI5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Moraxellaceae bacterium TaxID=1889775 RepID=A0A2A5CTI5_9GAMM  ali  21  1MINILYFASVKDRLGTARESLDVPTGTGLMKILKSRGEPWVSVFSDTKLLIAINQEMANEAALVNEGDEVAFFPPVTGG 82
56 6.000e-25UniRef50_Z5XKZ6 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Proteobacteria TaxID=1224 RepID=Z5XKZ6_9GAMM  ali  31  1MNKILFFAQLRERLGCDSVQLDAQSVRQLRQTLAERDERWHTWLLDKDVLVAVNQILVDDNAAVGTGDEVAMFPPVTGG 81
57 7.000e-25UniRef50_UPI000780B055 molybdopterin converting factor subunit 1 n=2 Tax=Cellvibrio sp. OA-2007 TaxID=529823 RepID=UPI000780B055  ali  30  1MIRVLFLAQLREQLGTAELHISVVSISTLKQYLVTNHSHWEPFIANSKLLVAVNHAYAKADVSIKSGDEIAFFPPVTGG 82
58 8.000e-25UniRef50_A0A0B0HE98 Molybdopterin synthase sulfur carrier subunit n=24 Tax=root TaxID=1 RepID=A0A0B0HE98_SOVGS  ali  30  1MIRICYFARLAEELGCREEELDFDTVRDLVEMLKQRGEPWQSTLSDGKLMVALNHTMGSLDSQPADGDEIAFFPPVTGG 81
59 8.000e-25UniRef50_S0ACP2 Molybdopterin synthase sulfur carrier subunit n=589 Tax=Proteobacteria TaxID=1224 RepID=S0ACP2_SERPL  ali  30  1MISILFFAQVRELVGTGDLSMPAPTVEALRRALCARGERWALALESGKLLTAVNQSLVAAEHTLRAGDEVAFFPPVTGG 81
60 1.000e-24UniRef50_A0A1S5Y030 Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1S5Y030_9BACT  ali  24  1MIRIIFFAQLRESLGVGEIQWPLETLESVISELQSQSEIWRRALSNQNLLMSINKEFAKPDSKVKPGDEVAFFPPVTGG 82
61 1.000e-24UniRef50_A0A1X9NDI9 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1X9NDI9_9GAMM  ali  30  1MVTVLFFARIREQLGVDRLSMALPSLSQFKQHLVDSHPDWSNILMADNVIKAVNQDVVDDNHSLTEGDEIAFFPPVTGG 84
62 2.000e-24UniRef50_Q65TT0 Molybdopterin synthase sulfur carrier subunit n=39 Tax=Gammaproteobacteria TaxID=1236 RepID=Q65TT0_MANSM  ali  30  1MLKVLFFAQTRELVGVDQIDVEAATAEALRAHLAEKGGKWALALEAGKLLVAINQTLSSLDSSIRDGDEIAFFPPVTGG 81
63 2.000e-24UniRef50_E3BLD9 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=E3BLD9_9VIBR  ali  34  1MIQVLFFGQTRDLIGVDELSLSGKTVEDIRVELSKRPGKWALALNKETTLFAVNQTMVSSEHAVREGDEVAFFPPVTGG 81
64 2.000e-24UniRef50_A0A1D8RUE1 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1D8RUE1_9GAMM  ali  29  1MIKVIFFAALREQLGSAGTEISATTVAEVKVALGEKNNDWQDYLTNNSLLCAVNHQMVNNDFLVKAGDEVAFFPPVTGG 82
65 2.000e-24UniRef50_A0A1V5YJV5 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1V5YJV5_9CHLR  ali  36  2MVRVRFFASLREAVGLEQEDVKLPTIKTLLQTLARAHPGLGALLEGRGVRFAVNRCYVPPDAGLQEGDEVALVPPVGGG 83
66 2.000e-24UniRef50_A0A1G7E9P9 Molybdopterin synthase sulfur carrier subunit n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1G7E9P9_9BACL  ali  25  1MIHLRYFASLRDATGKSEETLDRNTVKELIEWAEENYAG----FNNKTILVAVNEEYARSEDIIQDGDVVAFIPPVSGG 77
67 3.000e-24UniRef50_A0A2E0VMA8 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2E0VMA8_9GAMM  ali  41  1MIKVLFFGRLGDIAGAEERKVSVPTVDDLRQLLGEDGEALAKALNEPQVMVAVNQDLVEWDHVFEDEDEVAFLPPVTGG 83
68 4.000e-24UniRef50_D5BP16 Molybdopterin synthase sulfur carrier subunit n=2 Tax=SAR116 cluster TaxID=62654 RepID=D5BP16_PUNMI  ali  27  1MVTILYFAWLREHTGCATEDIDMHTVGDIVAYLKAQSDGHAKALGDETVRVAVNRTYGSIDTEIATGDEIAFFPPVTGG 84
69 4.000e-24UniRef50_A0A2H9TCB5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=invertebrate metagenome TaxID=1711999 RepID=A0A2H9TCB5_9ZZZZ  ali  29  1MITILFFAGFKEQTGCSSLPIPIDSLTTLKQQLGQKGAVWHDIMTSKQTLIAVNQQVVHDNPILKDGDTVAFFPPVTGG 85
70 4.000e-24UniRef50_A0A0U3HV97 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0U3HV97_9GAMM  ali  29  4..RILFFAQLRELLGCSQVEVAIDSVAELRSKLIEQHPEWEAHLQNGQVLQAVNQILVNNKAIVQPGDEVALFPPVTGG 83
71 4.000e-24UniRef50_A0A2U2S6G0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Anaerolineae bacterium TaxID=2052143 RepID=A0A2U2S6G0_9CHLR  ali  29  5..KILFFATLRHQAGVRSTEMDLPTVHQLKQLLIERFPGL-DWQVMDHCLASVNQEYCDDETPIPTGAEVAFFPPVSGG 83
72 4.000e-24UniRef50_Q1H1V7 Molybdopterin synthase sulfur carrier subunit n=17 Tax=Proteobacteria TaxID=1224 RepID=Q1H1V7_METFK  ali  32  1MIQLLYFARLREALGTESESLEPATVSALMQSLATRGGVWEEQFSGNTLRAAVNQELAPESALVRPGDEVAFFPPVTGG 83
73 5.000e-24UniRef50_I0I899 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Caldilinea TaxID=233191 RepID=I0I899_CALAS  ali  34  3.IQVRLFATLRQLAGWSQQTIEVPEGTTLEQALAERFPAL--TISKRTFYAAVNQEYAKGDQVLHAGDEVAIFPPVSGG 81
74 5.000e-24UniRef50_A0A1F9HVR9 Molybdopterin synthase sulfur carrier subunit n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9H  ali  25  6.ITVRFFAMLKGKVGKGEATLTIPSLGKLKEILKGQFPSIAELIDKKNIMFSVNQEFATNNTIIKDGDEVALLPPFSGG 86
75 5.000e-24UniRef50_A0A269PUL6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Pseudoalteromonas sp. NBT06-2 TaxID=2025950 RepID=A0A269PUL6_9GAMM  ali  32  1MIKVLFFGRLRELLDCSQLEIEQGTIAQLRLELANKGTKWAEFIAGNNALAAINQEMVEETSMINSGDEVAFFPPVTGG 82
76 5.000e-24UniRef50_A0A1C7HG93 Molybdopterin synthase sulfur carrier subunit n=20 Tax=Proteobacteria TaxID=1224 RepID=A0A1C7HG93_9BURK  ali  30  3.VKVLYFASLREHMGQDEIDLDITTVERLKNYLSEKDPLLKEAFEKPRLRCSVNQEMATDRHHVKDGDEVAFFPPVTGG 85
77 6.000e-24UniRef50_A0A1F4DAK8 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1F4DAK8_9PROT  ali  35  1MITVLYFARLREALGTGSEQIVLPDLDGVRALLVARGGFWGQELAANKVRAAVNQHIASGDTQVADGDEIAFFPPVTGG 84
78 6.000e-24UniRef50_K6Y8M1 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=K6Y8M1_9ALTE  ali  37  1.MKVLFFGQLREQLGVAELPLDIASVRELRKTLSAKGENWESFLAADNLLVAVNQTICDQNYELSQDDEIAFFPPVTGG 80
79 6.000e-24UniRef50_A0A2V8ZF53 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8ZF53_9BACT  ali  30  124.VKVLFFGRLKEVVGQSEESLDLATIEQLFALYSERVPEFRK--YRSSVVASRNQEFASWDTVLHPGDEIAFLPPVSGG 202
80 7.000e-24UniRef50_A0A2E7IPF1 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E7IPF1_9GAMM  ali  39  1MIRVLFFAKLRESLGQSEYQAEVATVAALRECILNARPDWRELLCAPNVIVACNQEVVGLESRVSDGDEVAFYPPVTGG 83
81 8.000e-24UniRef50_A0A2H5ZI64 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZI64_9BACT  ali  28  3.VKVRFFAVLRERTGVSSTVLTFPSVHEAWQLLQQQYPVLGP--FSECVTFAVNREYVNQHHRLHDGDELALIPPVSGG 81
82 9.000e-24UniRef50_Q6LT39 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Proteobacteria TaxID=1224 RepID=Q6LT39_PHOPR  ali  31  1MINVLFFAQVKELVGVDRLEVEYATAEVLRAHLAERGDKWLLALEPGKLLVAINQTICHLDTDIKDGDVVAFFPPVTGG 81
83 1.000e-23UniRef50_I3I5C1 Molybdopterin converting factor, subunit 1 n=1 Tax=Cellvibrio sp. BR TaxID=1134474 RepID=I3I5C1_9GAMM  ali  25  1MIKVFFFAELRERLQCAECFVTGTTVKSLLEQLIADHPEWEKIFSEKKILIAVNHAMANVNANIVAGDEVAFFPPVTGG 82
84 1.000e-23UniRef50_A0A2E1JNX0 Molybdopterin synthase sulfur carrier subunit n=4 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2E1JNX0_9GAMM  ali  35  1MITVLFFASLKETIGQGSMSVTLTDVSKLVEHIVSDQPSWREALTAENIVVSVNQEIVREDILISTGDEVAFLPPVTGG 81
85 1.000e-23UniRef50_A0A1I6I2A7 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1I6I2A7_9ALTE  ali  24  6.ITVRYFARLREELGTDSEVLALDTAGDLLNTLAERGGPWRQLAGDQPVMIAVNQAMARPHTRVGPGDEVAFFPPVTGG 87
86 1.000e-23UniRef50_A0A135I9K1 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A135I9K1_9GAMM  ali  30  1MIQVLFFAQVKELVGTASLTLDGATAEDIRAHLVNNGDKWALALESGKLLVAINQTISELSSPVEAGDEVAFFPPVTGG 81
87 1.000e-23UniRef50_A0A0J8GTR7 Uncharacterized protein n=3 Tax=Alteromonadales TaxID=135622 RepID=A0A0J8GTR7_9ALTE  ali  32  1MIKVLFFAKLKEDLNSAGVELEFDSVQALKQKLVELNPSWAKSLSQSNVLSAVNQTMVGSEFIVKAGDEVAFFPPVTGG 81
88 2.000e-23UniRef50_A0A2V8KI06 Molybdopterin converting factor subunit 1 n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8KI06_9BACT  ali  24  3.VKLLFFASLKDIVGSRQLQLDLPTIEDVLTELEASYPRIRD--YRPVVLTAINEEYVDQRTPIHEGDELAIFPPVSGG 81
89 2.000e-23UniRef50_A0A2V8KW88 Molybdopterin converting factor subunit 1 n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V8KW88_9BACT  ali  26  3.VKLLFFASLKDIVGSRQLLLDLPTIEDVLARLEASYPRIRD--YRPVVLTAINEEYVDQRTPIHDGDEVAIFPPVSGG 81
90 2.000e-23UniRef50_A0A2E9C6Q9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2E9C6Q9_9GAMM  ali  24  3.INVKYFASIRDLIGKDSEVLNLDDGASVKDLWNIV---VVDKHSPTKLLIAVNHEYVDGKYKLKDGDEVAFFPPVTGG 77
91 2.000e-23UniRef50_A0A2E5J987 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E5J987_9GAMM  ali  22  7.INVKYFASIRDLIGKDSEIFDLNDGADVSDLWDLI---IADRNKPAKLLIAVNHEYVGKKHKLKDGDEVAFFPPVTGG 81
92 2.000e-23UniRef50_A0A2A5C826 Molybdopterin synthase sulfur carrier subunit n=1 Tax=SAR86 cluster bacterium TaxID=2030880 RepID=A0A2A5C826_9GAMM  ali  25  1MATIHYFASVREKLGLSSEQLELPTVSALVDMLIEQHDKWEGVLKTSSVLVAVNQSIAKFSSPIKDTDDIAFFPPVTGG 87
93 2.000e-23UniRef50_Q2SA05 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=Q2SA05_HAHCH  ali  31  1MIKVLFFAKLREQVGCTEMELPASSVAALLDAVIAELPSAESALKQGNVLAAINQEMAPLTATVVDGDEVAFFPPVTGG 83
94 2.000e-23UniRef50_A0A1Q7IZJ5 Molybdopterin synthase sulfur carrier subunit (Fragment) n=1 Tax=Actinobacteria bacterium 13_1_40CM_4_65_12 TaxID=1803489 RepID=A  ali  34  7.VRTRLFARLREQAGTDAETVEVSTVDEVYDALQKAHAGLEA--NRESVRVAVNQEFADWDAIVSDGDEVAFIPPVSGG 85
95 2.000e-23UniRef50_A0A1Z9YSN5 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alteromonadaceae TaxID=72275 RepID=A0A1Z9YSN5_9ALTE  ali  30  1MMKVKLFAQIREVTGTESLEMAVPTIEGVRQALMAKGPQWQQALSA-NVLCACNQTLCDGTMVVSEQDEVAFFPPVTGG 81
96 2.000e-23UniRef50_A0A2V9MB36 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9MB36_9BACT  ali  25  3.IKVLLFARLREIVGCEMVELEMLTVRDVWDTLRAQFPQVEG--FGKSLLFCVNQEFADLDTRIKEGDELAIFPPVSGG 81
97 3.000e-23UniRef50_A0A1F9KLL8 Molybdopterin synthase sulfur carrier subunit n=30 Tax=cellular organisms TaxID=131567 RepID=A0A1F9KLL8_9DELT  ali  30  3.VKVKFFAILRERAGAGEITREGGTVADLWEALRKDYPRLAPV--ETRLLYAVNRNYVRPNHILKENDEVVFVPPVSGG 81
98 3.000e-23UniRef50_A0A1Y1HN11 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HN11_KLENI  ali  32  70.VKVLYFARAREATGSTEESAEIENGTTLLETLVRRFPKLQEI--RSCLVLAINQEYADGSAVLKEGDEVALIPPISGG 148
99 3.000e-23UniRef50_UPI000673BB29 molybdopterin synthase sulfur carrier subunit n=1 Tax=Gilvimarinus polysaccharolyticus TaxID=863921 RepID=UPI000673BB29  ali  29  1MMQVLFFAQLRELLGCESIELSAQAVGDVVPALVAECPQWAEVLQGKAWLMSVNQTMAKANTAIKVGDEVALFPPVTGG 82
100 3.000e-23UniRef50_A0A2E1CV18 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E1CV18_9PROT  ali  32  1MAHLLYFALIREQIGHPEEQMSLPTVQKLIDHLRSCNDHYARAFADQKVRVAVNEEYVSLHHPISANDEIAFFPPMTGG 84
101 3.000e-23UniRef50_A0A2M8PT62 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8PT62_9CHLR  ali  29  41.IHVLLFATLKDIAGQSRLTLSLPTVDDVRQALIERFPALEA--NVKSAIAAVNEEFAFAGDVIQDGDEVAFFPPVSGG 120
102 3.000e-23UniRef50_A0A2V9HDF7 Molybdopterin converting factor subunit 1 n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V9HDF7_9BACT  ali  34  28.VTVLFFGRLKELTGHPEHSIEATTIEHLFALYAARHPELAK--YRSSVVASRNQEFAAWDTPLRSGDEVAFLPPVSGG 106
103 3.000e-23UniRef50_A0A2G1UJS9 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G1UJS9_9ALTE  ali  26  9.VTVRFFARLREELDTDSLILPVTTAGTLLAELATRGGAWAQLCGDQPVMIAVNQAMAKPGTVLSGGDEVAFFPPVTGG 89
104 3.000e-23UniRef50_A0A1S7LMP2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=magneto-ovoid bacterium MO-1 TaxID=451514 RepID=A0A1S7LMP2_9BACT  ali  35  1MAKLLFFASVREKMGMPETELNLPTVGALISHLQEQGAPYSEALAGGHIQVAVNQLHTRPNDPVSDRDEIAFFPPVSGG 83
105 3.000e-23UniRef50_UPI000C2916DF MoaD/ThiS family protein n=1 Tax=Alteromonas sp. P0211 TaxID=2048003 RepID=UPI000C2916DF  ali  33  35.VTVKFFAFFREQLGISAIDVECAQVQDVLNRLYQDFPRLAEMVKSQNTLCAVNHQLVGLEHALNNGDEVAFLPPVTGG 115
106 3.000e-23UniRef50_F0F2C7 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Bacteria TaxID=2 RepID=F0F2C7_9NEIS  ali  31  6.ITILYFAALREQAGKEQETRSAQTPAELYAELQAAY---AFDLPQERLRAAVNHAFCDWQTALNDGDTVAFIPPVSGG 82
107 4.000e-23UniRef50_V6F3I6 Molybdopterin synthase sulfur carrier subunit n=126 Tax=Bacteria TaxID=2 RepID=V6F3I6_9PROT  ali  30  1.MNVLYFAWLRAKVGVGEEILVVPTTGALVEWLKTRSDGHAQAFADKLVRVAVNQDYVGWDHPIKPADEVAFFPPVTGG 83
108 4.000e-23UniRef50_F8CD82 Molybdopterin synthase sulfur carrier subunit n=41 Tax=Bacteria TaxID=2 RepID=F8CD82_MYXFH  ali  28  6.VTVLYFAAARERTGQTRESLEVPAGAQVRDVLRERHPALAPLL--PHLRVAVNQAFVGPDSPVGDGAEVALIPPVAGG 84
109 4.000e-23UniRef50_F9DRM4 Molybdopterin synthase sulfur carrier subunit n=49 Tax=Bacilli TaxID=91061 RepID=F9DRM4_9BACL  ali  31  1MITVHYFARLRELTGKGEESLDRATVEELLDWAEATYPGFGK----ETIHVAVNEEYARKEDVIQAGDVCAFIPPVSGG 77
110 4.000e-23UniRef50_A0A2W4LTR5 Molybdopterin converting factor subunit 1 n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4LTR5_9PROT  ali  31  112..QVLYFAKVRDLVGKPEEAIAIPTVADVLEHLKHRYPALGEAL--PKVRVARNETFASLTEPVADGDTIALIPPVAGG 190
111 4.000e-23UniRef50_A0A2I0FEJ0 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A2I0FEJ0_9BACL  ali  27  1MITVHYFAGIREMTGTHKEDFDCATVGQLKERLIQKYPQMQG----NSLQFAVNEEYALQTDILSEGDAVALIPPVSGG 77
112 4.000e-23UniRef50_A0A2D6G4K9 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D6G4K9_9PROT  ali  28  1.MKVLYFAWLRERVGIAEEDLDLPDVAGLIEWMKTRGGGFEKAFTEMSVRTAVNQVHVEPSHRLGNGDEVAFFPPVTGG 83
113 5.000e-23UniRef50_A0A0R0LSI7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Ferrovum TaxID=416212 RepID=A0A0R0LSI7_9PROT  ali  21  3.VTVKYFASLREKLNLSEEQLTLPQGDQLKAFLCLRGPQWQKVFQEGPLQIAINQERASWQDIFSDNDEIALFPPVTGG 85
114 5.000e-23UniRef50_A0A2A4VZI8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4VZI8_9GAMM  ali  24  3.IKVVFFAALREQLDCSEISIEVQTVADIKTKLAHKNEHWQQVFSNGALLSAINHDMVTSDNRVKADDEVAFFPPVTGG 83
115 6.000e-23UniRef50_D5MEV6 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=D5MEV6_9BACT  ali  29  3.IRVRCFAAVREIVGVGELVVELPEGSTLDQLLQSQFPKLQAL--TGSLLFSVNREYASADTRLAAGDEVALIPPVSGG 81
116 6.000e-23UniRef50_A0A2S9YBY8 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Myxococcales TaxID=29 RepID=A0A2S9YBY8_9DELT  ali  31  4..TVLLFAGIRQRVGAAQIELELPTVAQLREHIRATHPEIGDAL--DHCRIAVNQEFVRDTHPVAPGDELALIPPVSGG 81
117 6.000e-23UniRef50_G4QF75 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=G4QF75_GLANF  ali  25  1MINIRFFAFLRERLGTDTLDYEFTTVLDIKQKLIARGEPW-TLLAEQDVLIAVNQTLTSESSLVSDGDEIAFFPPVTGG 81
118 6.000e-23UniRef50_A0A2A4SYZ0 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4SYZ0_9GAMM  ali  22  3.VTVKYFASLREHVGQAEEQCQVPEGCSASEVWVQLNAALE---LPSNILVAVNQDYASLDTRINDGDEIAFFPPVTGG 78
119 7.000e-23UniRef50_UPI00083267F7 molybdopterin converting factor subunit 1 n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI00083267F7  ali  30  1MIKVLFFASFREKLKCEELLVDEGSLSSLKSQLAEKGDDWREIMMSEKTLVAVNQTMTRKDVSLKSGDEVAFFPPVTGG 83
120 7.000e-23UniRef50_A0A160F3Y6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A160F3Y6_9BACI  ali  28  1MITLLFFAYLKEAIGKERLQLDASTVKELKQQLVSDYG-----FDLQHVMVAVNEEYATDDRVLQAGDIVAFIPPVSGG 76
121 7.000e-23UniRef50_A9WDC0 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Bacteria TaxID=2 RepID=A9WDC0_CHLAA  ali  29  4.VTVRFFAGHRDIVGRSEASYEGTTLGQLWEQLTAEYPRLTG--YTGRLLFAVNQQFAQPTTVLANGDEVAFIPPVSGG 82
122 7.000e-23UniRef50_K6QE59 Molybdopterin converting factor, large subunit n=1 Tax=Thermaerobacter subterraneus DSM 13965 TaxID=867903 RepID=K6QE59_9FIRM  ali  28  15.VRVRLFAVVAERLGARQLELELPTAGSVRDALARQHPRWRPLLDL--CRLAVNGRYCEPSTPIGPGDEIALIPPVSGG 93
123 7.000e-23UniRef50_A0A2G6L1A0 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G6L1A0_9GAMM  ali  23  8.VNVLFFASIREAVGVDRIQVEHNDIAAVIDKLCQQNPCWAVVIKSRKVLAALNQEMAHFDSTVSDGDEIALFPPVTGG 89
124 8.000e-23UniRef50_A0A2D6NA97 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6NA97_9CHLR  ali  27  3.VQVRYFAAVREIIGDNEALLELPTINDLWERLAATHPRLQQL----TCTAALNQEYVSPEAVIEDGDEVVFIPPVSGG 79
125 8.000e-23UniRef50_A0A2E4XK81 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E4XK81_9ACTN  ali  29  1MVTLRLFASIREIAGTNQLEIDAKTVGQAIELAIETFPDFAAAL--PTCRIWVNGNPVNEDDKVSDGDEIAILPPVSGG 78
126 8.000e-23UniRef50_A0A240C7D5 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A240C7D5_SERFI  ali  32  1MLDILFFAQVRELVGCSRLRLEYATVEALRLALLNRGSRWQLALESDRLLAAVNQTLVPMDHALQAGDEVAFYPPVTGG 81
127 9.000e-23UniRef50_A0A2K9LTF7 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2K9LTF7_9GAMM  ali  31  1MIKVLFFARVRDQVGCAELDIELPDVAGFTATVKAMGAAFEQALSEPNVLIAVNQEMANSQMTVEDGDEIAYFPPVTGG 83
128 9.000e-23UniRef50_A0A0K9H5L7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A0K9H5L7_9BACI  ali  27  1MINVLCFAHLKEQVGQEQLELAHDEL-TVKELLQELHEQHS--IDTDSLIVAVNEEYADVDDVIKSGDTVALIPPVSGG 76
129 9.000e-23UniRef50_A0A251VVY7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Litorilinea aerophila TaxID=1204385 RepID=A0A251VVY7_9CHLR  ali  35  3.VTVKLFATLRQQAGWSERRIDLPTEATLQDLLSRLEEEHENLFADRPVYAAVNQEYAHLDRILAPGDEVALFPPVSGG 81
130 9.000e-23UniRef50_UPI0003B4048D molybdopterin converting factor subunit 1 n=1 Tax=Leucothrix mucor TaxID=45248 RepID=UPI0003B4048D  ali  26  3.VKVLYFASLRELVGHPSTTIALESPQTVESLWSQVNPDIER---PEACLVAVNQEYADLQTLINDGDEVAFFPQVTGG 77
131 9.000e-23UniRef50_A0A1U9JQY7 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chromobacteriaceae TaxID=1499392 RepID=A0A1U9JQY7_9NEIS  ali  33  4..TLLYFARLRDQLGQDQETLTFTSVAELLELLRQRGAAWADALAEQPFRVAVNHSVVHGPHPLADGDEVAIFPPVTGG 83
132 9.000e-23UniRef50_A0A2D5XT79 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D5XT79_9PROT  ali  28  11.ITLRYFAWMREHVGXDCEDILLPTIADLLPHLRARSAGHALALSNMRVRVAVNRTYGDLDTPVSAGDEVAFFPPVTGG 93
133 1.000e-22UniRef50_J1JZX1 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=J1JZX1_9RHIZ  ali  21  9.IRLRYFAWIRERIGYDHEDLSVPTVHELLNYLAHLGENYACALSSETIYIALNQEQVGYDHAIKDNDEIAIFPPMTGG 91
134 1.000e-22UniRef50_A0A1F8RL66 Molybdopterin synthase sulfur carrier subunit n=7 Tax=root TaxID=1 RepID=A0A1F8RL66_9CHLR  ali  38  4..RVRLFARLADLAGTRETEVELGEGADAFRLLCQRFPELAD--HSDSVMYAVNAEYVNSDHSLRDGDELALIPPVSGG 81
135 1.000e-22UniRef50_A0A2V7XJX8 Molybdopterin converting factor subunit 1 n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7XJX8_9BACT  ali  33  3.VRLLYFAVLRDIAGKGEEVIELPDGADVWNRLRAQHRALAGYERPP--MTAINETYVAADQVLRDGDEVAFIPPVAGG 81
136 1.000e-22UniRef50_P45309 Molybdopterin synthase sulfur carrier subunit n=237 Tax=Bacteria TaxID=2 RepID=MOAD_HAEIN  ali  30  1MLNVLFFAQTRELIGVDAIQLEFATAEAVREHLAQKGDKWALALEKGKLLVAINQTLMPLESAVKNGDEIAFFPPVTGG 81
137 1.000e-22UniRef50_A0A1S1WY91 Molybdopterin synthase sulfur carrier subunit n=199 Tax=root TaxID=1 RepID=A0A1S1WY91_9NEIS  ali  38  6....LYFARLRDALGLDAETLEAATVDELMAELRQRGGEWARALAGQTFRVAVNQDMATGDTPLADGDEVAVFPPVTGG 83
138 1.000e-22UniRef50_A0A0X8D368 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Aneurinibacillus TaxID=55079 RepID=A0A0X8D368_9BACL  ali  30  1MITIKLFAAMAEEAGKETIEMEGMTTEDVKRWLAEQYPSLASRIPAA--MVAVNQEFAAFANPLQDGDEVAFIPPVSGG 80
139 1.000e-22UniRef50_A0A2E8CG90 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E8CG90_9DELT  ali  29  5.VNILYFASVREAMGCSEEKIELPSVSELVDLLVAQNKRFREAQNAGRLLVAVNQELATDATVVREGDEVAFFPPMTGG 88
140 1.000e-22UniRef50_Q2BLQ4 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=Q2BLQ4_NEPCE  ali  31  1MAKVVYFASLRERLGLAEETVQLDSVSGLVDRLVEQHGEWKTVFNDSQVMVAINQEMSDQEAMVSDADEVAFFPPVTGG 83
141 1.000e-22UniRef50_A0A2A4W0A7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Kordiimonadales bacterium TaxID=2030814 RepID=A0A2A4W0A7_9PROT  ali  25  1.MQLIYFASIREQIGLSEEEYDLPTVEALLDDLRARGPNYASALLADKLKVAVNQQHAKLNTSVKDQDEVAIFPPVTGG 83
142 2.000e-22UniRef50_G7VRC5 Molybdopterin synthase sulfur carrier subunit n=19 Tax=Bacillales TaxID=1385 RepID=G7VRC5_PAETH  ali  22  1MIKLYYFAGLREVTGKAEEDLAGQTVGDLYNWITDQYP----AVPISSVRIALNEEYALPTDVVQDGDVIAFIPPVSGG 77
143 2.000e-22UniRef50_V6M3G1 Molybdopterin synthase sulfur carrier subunit n=55 Tax=Paenibacillaceae TaxID=186822 RepID=V6M3G1_9BACL  ali  30  3.ITILLFAGLAERANQREIQLTLPEQATVRDLLAEQYPALSPLL--GSCFVSLNHEYAAPDHVIQASDEIALLPPVSGG 81
144 2.000e-22UniRef50_A5UY53 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A5UY53_ROSS1  ali  25  7.IIVRYFAAHREITGRSDETLTLATVGALWTLLTERYPRLAG--YSGRLLFAVNQEFATPDQSLHHGDEVAFIPPVSGG 85
145 2.000e-22UniRef50_A0A1Y6C3H8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y6C3H8_9ALTE  ali  29  7.IKVLYFASLGEEFGIAEEHLTIPHVSSLKKLLSARGEQWKNRLQASNILCAVNQEVQQGEDILNPGDEIAFFPPVTGG 89
146 2.000e-22UniRef50_A0A1Y5EUR3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Piscirickettsiaceae TaxID=135616 RepID=A0A1Y5EUR3_9GAMM  ali  29  3.IKVLYFASLREQFGCNEQQLDSAGIHTVADVWRLVSSGHT---FKQSVLHSVNQQYAELEAPVKAGDEVAFFPPVTGG 77
147 2.000e-22UniRef50_B2V7E7 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=B2V7E7_SULSY  ali  30  3.VKVLYFSQVKDKIGKNEEEIEFETLKDLVDVLAKKYPDIKEILKRS--MFAVNESYETMDYNLQDNDMIAIIPPVSGG 80
148 2.000e-22UniRef50_A0A1Z9UPJ3 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1Z9UPJ3_9BACT  ali  26  1MIKLLFFARIKERLGKSEMTIDFQSLQALTQELIERHGHGWQILLEPDTVFSCNQRVVDRDLIVADGDEVAFFPPVTGG 82
149 2.000e-22UniRef50_A0A2V8LLJ0 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LLJ0_9BACT  ali  25  12.VRVLFFGGARDLVGLEELDLSLTSAAAAKEQILNSYPDLRR--FGNSLLFAVNQEYAQPDRQIHDGDELAVFPPVSGG 90
150 2.000e-22UniRef50_A0A0H4J9X3 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A0H4J9X3_9PROT  ali  27  1MIKVLFFAKLREELKINELDVEYADVASIRELINHLRQQYQQIDNVKNIKAAVNQELVDWDLSLNDGDEVAFFPPITGG 81
151 2.000e-22UniRef50_A0A2V9M2S0 Molybdopterin converting factor subunit 1 n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9M2S0_9BACT  ali  32  3.IKVLFFASLADLTGMRETEVDHTSVASIYTKFARDFPRLEE--HRASLLYAVNSEFVQPDSPVHDGDEVAFFPPVSGG 81
152 2.000e-22UniRef50_A0A0S8GAM4 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0S8GAM4_9PROT  ali  25  3.IQVRYFASLRERLGRTQETVDAVSAATVADLWLHVS---AGAPWPSNTLVAVNHEYSHAGQRLRDGDEVAFFPPVTGG 77
153 2.000e-22UniRef50_A0A1F7SDH5 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A1F7SDH5_9BACT  ali  26  3.VKIKFFAALREGIGKSEIEINIPSGSRLIERLEKEYKAIAE--FKTSIAYSINMEYVRGDEVLKEGDEIALIPPVSGG 81
154 2.000e-22UniRef50_A0A2E7JL17 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A2E7JL17_9BACT  ali  32  3.IKALFFASCRDIVGNREMDLDVAEGAELRSELLGNYPRLAAL--DEVLSIAVNSEYVDDTTILNPGDEVAFIPPVSGG 81
155 2.000e-22UniRef50_A0A2E3KBQ6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E3KBQ6_9PROT  ali  24  1.MNLLYFAWIRIKMGVSGEHIDPPDIESLIDWIKQRNTISNEAFSDSNIRFAVNQEYVDIDHPVQPGDEIAFFPPVTGG 83
156 2.000e-22UniRef50_A0A2E9TCQ6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9TCQ6_9CHLR  ali  25  22.IAIKLFAGLRDRAGTGDLSVELPEGATVRDAIAAQHNAPKKWAAPTSLMAAVNNEYVEFTDTVADGDELALIPPVSGG 100
157 2.000e-22UniRef50_A0A0X9W9F6 Molybdopterin synthase sulfur carrier subunit n=29 Tax=Bacillales TaxID=1385 RepID=A0A0X9W9F6_9BACL  ali  29  1MISILFFAQLQESMGQAQMEVPLATVAEVKAWLEKEYP----LLSLGQVMTAVNEEFARDQTIVNEGDQVAFIPPISGG 77
158 2.000e-22UniRef50_A0A2D2ASW4 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D2ASW4_9CAUL  ali  74  1MARVLLFGRLADVAGWRERVIEGDRLGDIRVALAD-DLALAEALAGPGVQVAVDRVIVRGEAALAAGSEVAFMPPMSGG 78
159 3.000e-22UniRef50_A6X250 Molybdopterin synthase sulfur carrier subunit n=38 Tax=Alphaproteobacteria TaxID=28211 RepID=A6X250_OCHA4  ali  21  3.VKLVYFAWVREKIGKGEELIELPTVADLISHLKSRGDEYEAAFEHEHIRAAINQEHAEHVELVNDGDEVALFPPMTGG 85
160 3.000e-22UniRef50_A0A1F9DRZ2 Molybdopterin synthase sulfur carrier subunit n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9D  ali  28  3.VKVKFFAILRERAGTGEITKEISTVAELWEALQRDYSKLAPV--DMRLLYAVNQAYVKADYVLKERDEVVFVPPVSGG 81
161 3.000e-22UniRef50_A0A142LJB7 Molybdopterin synthase sulfur carrier subunit n=14 Tax=Bacteria TaxID=2 RepID=A0A142LJB7_9PROT  ali  30  1MLNVLYFASIREAIGKDAEAVALPTVAGLVERLRSRAGPYAEALAHRRWRVAVNQELVGLSEPLKAGDEVAIFPPVTGG 83
162 3.000e-22UniRef50_F2NNP7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=F2NNP7_MARHT  ali  32  3.VNVRLFAVYRERVGRAHLELDLPEGATVRQALEAQYPGL----SLEGGMVAVNQEFASGTTPLREGDELAFLPPVSGG 79
163 3.000e-22UniRef50_A0A0H2MIJ4 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0H2MIJ4_9PROT  ali  19  1.MKILYFAWLRTTIGKPLEEITPPTVKDLLDWLPSLGENYSIVQEKSDLRIAINQEYANLDQEIKQGDEIALFPPVTGG 83
164 3.000e-22UniRef50_A0A0M0W2L7 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacillales TaxID=1385 RepID=A0A0M0W2L7_9BACI  ali  33  1MIQVYYFAGLRDAAGKAEETIDRAEVQELLDWVEEAYP----AFRNKTVFVAVNEEYASREDVITSGDIVALIPPVSGG 77
165 3.000e-22UniRef50_R0CTZ3 Molybdopterin synthase sulfur carrier subunit n=307 Tax=root TaxID=1 RepID=R0CTZ3_RALPI  ali  33  3.IELRFFASVREQLGTSQERVVVPTVGDVRRWLAQRGPVWGETLAEGRLRMAVDHQIVPADTAVHDGCEVAFFPPVTGG 85
166 3.000e-22UniRef50_A0A2V8WQK9 Uncharacterized protein n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V8WQK9_9BACT  ali  35  71..KVLFFGRLKDLIGRAEDSVDAATIEQLFALYAARNPELAK--YRPSLVASRNQEFAAWDTPLRPGDEVAFLPPVSGG 148
167 3.000e-22UniRef50_Q602K9 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Proteobacteria TaxID=1224 RepID=Q602K9_METCA  ali  26  3.IRVRYFAALREQMGRAEEQLAFEDLASVADVWKAVC---RGKRLPEDVLCAVNMDYAGADTPVKDGDEVAFFPPVTGG 77
168 3.000e-22UniRef50_A0A137S8Q0 Molybdopterin synthase sulfur carrier subunit n=14 Tax=cellular organisms TaxID=131567 RepID=A0A137S8Q0_9ALTE  ali  23  7..TVRFFARLREELDTESLELPATTVEGVLSELAARGGPWAQLQGDQPVMAAVNQAMAKPSTPVTPGDEVAFFPPVTGG 86
169 4.000e-22UniRef50_A0A1G0SG36 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Ignavibacteria bacterium RIFCSPLOWO2_12_FULL_56_21 TaxID=1798438 RepID=A0A1  ali  34  10.IRVRLFASARELAGFETRELELPTLEDVWRQLESVNPAFERW--KESTRFAVNQEYVRGGLRLRDGDEVAVLPPVSGG 88
170 4.000e-22UniRef50_A0A1Y0D985 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y0D985_9GAMM  ali  34  3.IQVLFFAKIREQLGQEQITVDFATVEALRLHLTAQGEPWTSALAVNKLLVGVNHTIVPLSSAIKAGDEVAFFPPVTGG 82
171 4.000e-22UniRef50_A0A0N9ZYF8 Molybdopterin synthase sulfur carrier subunit n=1352 Tax=root TaxID=1 RepID=A0A0N9ZYF8_9RHOB  ali  34  1MIDVLYFAWVRERIGLPREQVEAATVADLIDELKAREERYAFAFEDSALRVAVDQELVDFDAPLNGVREVAFFPPMTGG 82
172 4.000e-22UniRef50_E6SJL1 Molybdopterin converting factor, subunit 1 n=2 Tax=Firmicutes TaxID=1239 RepID=E6SJL1_THEM7  ali  30  75.VSVRLFAVVADRLGTRRLELALPPGATVRDELARRHPGHRPLLDL--CRLAVNGRYADPDTPLAGGDEVALIPPVSGG 153
173 4.000e-22UniRef50_D8FVB8 Molybdopterin synthase sulfur carrier subunit n=112 Tax=Cyanobacteria TaxID=1117 RepID=D8FVB8_9CYAN  ali  25  8.ITVKLFAVYQEVYGKPELQLEIPSVSQVLERLIAEHPKLEQW--RDRTRFGVNLEFATPETILQNGDEVVLIPPVSGG 86
174 4.000e-22UniRef50_A0A1E3Y761 Molybdopterin synthase sulfur carrier subunit n=6 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1E3Y761_9B  ali  32  3.VTVQYFARLRDLAGCGTWTCDLPDRATVGDAWRERFPATAAL--GDSLSCAVNADFSRMDAPIHDGDEVAFLPPVSGG 81
175 4.000e-22UniRef50_A0A2A4XA04 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4XA04_9GAMM  ali  28  3.IRVKFFASLRETIGKAEHNLDAQNINTARDVWQTATDNHEQL---PNMLVAINMEYAKLNDNVKDGDEVAFFPPVTGG 77
176 4.000e-22UniRef50_A0A238HHC5 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A238HHC5_9NEIS  ali  28  5.INILYFAALREQAGKEQETRDAQNPAELYAELQAVY---SFELPQERLRAAVNHAFCAWDTPLNEGDIVAFIPPVSGG 81
177 4.000e-22UniRef50_F2BDT8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Neisseriaceae TaxID=481 RepID=F2BDT8_9NEIS  ali  28  7.IRILYFAALRETAGKEGETVALPNGATAASVYAQLAAQYGFTLPQERLRCAVNHRFAAWETALKAGDILAFIPPVAGG 84
178 5.000e-22UniRef50_I6TVI3 Molybdopterin converting factor subunit 1 n=16 Tax=Thermococcales TaxID=2258 RepID=I6TVI3_9EURY  ali  30  4.VKVKYFARFRQLAGVDEEEIELPEGADLIEEIKKRHEKFKEEVFGEGVNIAVNGRYVSWDEELKDGDVVGVFPPVSGG 90
179 5.000e-22UniRef50_A0A0J6YXU9 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A0J6YXU9_9BACT  ali  36  1MITVRYFASLRSIAGREEDQFNLTTLEKLSDEISKTAPKIGEMVRGKNVMVSVNHDVVAPGAIIKDGDEVAFLPPFSGG 82
180 5.000e-22UniRef50_F5SIP0 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacillales TaxID=1385 RepID=F5SIP0_9BACL  ali  25  3.INVLLFAGVAEAVGKRDLRLELPTVHTLIDRLATEYPDAADLIRHS--VIALNQDYAEADQVIRPGDEIALIPPVSGG 81
181 5.000e-22UniRef50_A0A244CTR4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A244CTR4_9GAMM  ali  26  1MNKILFFAQLRERLECENVLIDVSSVSELREFLAQKNEHWKTWILDKDVLVAINQTLAAGDSRIESGDEIAMFPPVTGG 81
182 5.000e-22UniRef50_A0A1T2KUI7 Molybdopterin synthase sulfur carrier subunit n=42 Tax=root TaxID=1 RepID=A0A1T2KUI7_9GAMM  ali  31  1MIKVLYFARLREQLETASEEMDLENVNGLVTLLKDRGGTWDDVFGGAQVLMAVNQEMVDGNAAINDGDEVGFFPPVTGG 83
183 5.000e-22UniRef50_E5AQP9 Molybdopterin synthase sulfur carrier subunit n=9 Tax=root TaxID=1 RepID=E5AQP9_PARRH  ali  24  3.IELRFFASVREAVGTGAETVDVPTVGDVRAWLCSRGGAWAGALADTRLRMACDHVMTNPATRLTDGCEVAFFPPVTGG 85
184 5.000e-22UniRef50_A0A136KWF7 Molybdopterin synthase sulfur carrier subunit n=6 Tax=cellular organisms TaxID=131567 RepID=A0A136KWF7_9CHLR  ali  28  4.IRILFFATIRDKFGRKTLELDIPTVLQLKQKLANDYPNLKDSL--KAVLVSVNQEYSFDDFIIPANAEIALFPPVSGG 82
185 5.000e-22UniRef50_A0A218PCL1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A218PCL1_9EURY  ali  33  3.IRVRYFARFRSLTGTGEEELEVPDGTTVRELLKERHPALREEVFGEDVNVSRNGRYASFDEVLKEGDVVALFPPVSGG 87
186 6.000e-22UniRef50_A0A2H1ED40 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2H1ED40_9FLAO  ali  31  1MIKILFFGIATDLVGNSSLTITIPSVQELRQLLTTKFPNLKQI---TSYAVAVNEEYASKETILTANDTVAIIPPVSGG 81
187 7.000e-22UniRef50_UPI000553ACD9 MoaD/ThiS family protein n=1 Tax=Alysiella crassa TaxID=153491 RepID=UPI000553ACD9  ali  31  9.INVLYFAILREQAQKEQEIHEAQTPAELYAELQAAY---AFDLPKERLRAAVNHAFCAWDTPLNDNDTVAFIPPVSGG 85
188 7.000e-22UniRef50_B8GPA3 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Proteobacteria TaxID=1224 RepID=B8GPA3_THISH  ali  25  3.ITVRYFASLRERVGRAEDQLETDGNDTAGGVWARAVPEQA---MPDRVLIAINQEYADADHPVRDGDEVAFFPPVTGG 77
189 7.000e-22UniRef50_A0A2D5LCD1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D5LCD1_9GAMM  ali  39  1MVSVKFFAQLRDVTGIEALQINAADLNAVFDELAKRYPEVLAQLRGDNVRIAVNQELVNGNPALTAGDEVALLPPVTGG 80
190 8.000e-22UniRef50_A0A1Q7L2L6 Molybdopterin synthase sulfur carrier subunit n=11 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7L2L6_9  ali  33  10.VKVLFFGRLKDVLGHSEEFLDLATIEELFALYAARIPELAK--YRSSVVASRNEEFASWDTPLRSGDEVAFLPPVSGG 88
191 8.000e-22UniRef50_A4SVZ7 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Proteobacteria TaxID=1224 RepID=A4SVZ7_POLAQ  ali  30  5...LRFFASLREALGVGQENIEIPTITELRVYLAQRGGAWAEVLADKSMRCALNHHMVDTSTRLEEGAEVAFFPPVTGG 85
192 8.000e-22UniRef50_A9BNE9 Molybdopterin synthase sulfur carrier subunit n=448 Tax=root TaxID=1 RepID=A9BNE9_DELAS  ali  30  11.ITVRYFASIREALGTGSETLEADTVGALREELIARGGAAAEALAPGKVRMALNQVLCDAGAAIRQGDEVAFFPPVTGG 91
193 8.000e-22UniRef50_R4YK26 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Oleispira antarctica RB-8 TaxID=698738 RepID=R4YK26_OLEAN  ali  29  1MINVLFFARLKDQIGQAELSLDGKTVAELQQVLIVQG---MVALQDRSIRIALNQNFCEPDAVIKGGDEIAFMPPVTGG 80
194 8.000e-22UniRef50_A0A1Z9B9M4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1Z9B9M  ali  30  1MIRLRLFASIKELTNTEEELLPLKTVKDLKKVLSFRGSSWGXVFSGEMVITAVNKELVSDDFNLKDGDEVAFFPPVTGG 83
195 8.000e-22UniRef50_A0A098QTU3 Uncharacterized protein n=1 Tax=Spirochaeta lutea TaxID=1480694 RepID=A0A098QTU3_9SPIO  ali  24  5.VTLRYFAQLAEQRGCHTEQVELHPGQRAEELYRQLQQRYRFSLDQEILRPAVNGVYTTWDQELQAGDEIAFIPPVAGG 82
196 8.000e-22UniRef50_A0A1B9MNW7 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Gilliamella apicola TaxID=1196095 RepID=A0A1B9MNW7_9GAMM  ali  29  1MNNVIFFAQIRELVGIDKVTLDADSVSLLIERLSKLGDKWSLALKERTVLCAVNQCIVDFDYIIQSSDEIAFFPPVTGG 81
197 8.000e-22UniRef50_A0A209DQ28 Molybdopterin synthase sulfur carrier subunit n=18 Tax=Paenibacillaceae TaxID=186822 RepID=A0A209DQ28_9BACL  ali  25  1MITLLYFAGLREATGRAQEELDGKTVAELIAWVGERYPHL----PLEAVRVAINEEYAPESDVLQEGDIAALIPPVSGG 77
198 8.000e-22UniRef50_A0A0C2VJR7 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacillales TaxID=1385 RepID=A0A0C2VJR7_9BACL  ali  30  1MIHVQCFAHLKEQTGQDTITIEQSSVADLLAELSARF-----SIETDSLMVAINEEYASPEDIVSEGDRVALIPPVSGG 76
199 8.000e-22UniRef50_E0XSX8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=E0XSX8_9BACT  ali  32  2.....FFASIRDITGMQNIGLQLATVSGLRKELIRKYPKLK--CTDTKCAVAVNQEYVADDQILSNGDEVALIPPVSGG 76
200 8.000e-22UniRef50_Q7P1M7 Molybdopterin synthase sulfur carrier subunit n=104 Tax=root TaxID=1 RepID=Q7P1M7_CHRVO  ali  35  5...LLYFARLRETLGVESEQLEAANVAELLAELRQRGQVWTLELAADKVRVAVNQEMAGLDTPLADGDEVAVFPPVTGG 83
201 8.000e-22UniRef50_D5VDN3 Molybdopterin converting factor, subunit 1 n=22 Tax=Caulobacteraceae TaxID=76892 RepID=D5VDN3_CAUST  ali  77  1MARVLLFGRLADQAGWRDRSVEAGDLSALRAALAAEDAGLGEALAAPGVQVAVDKVLVRGEASLAAGAEVAFLPPMSGG 79
202 9.000e-22UniRef50_A0A0S8H8T4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonas sp. SM23_52 TaxID=1703359 RepID=A0A0S8H8T4_9BACT  ali  25  3.VKCLFFAVYREILGTGELEIELPPGARLAELIQLVRTRPGADALPRALVVAVNHEYAPADSVLADGDEIAFIPPVAGG 80
203 9.000e-22UniRef50_Q0VQ22 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Alcanivoracaceae TaxID=224372 RepID=Q0VQ22_ALCBS  ali  27  1MIEIRFFAALRERVGCDSLTVTAPTVTALVAWLEEDNPAVARALEAPHYMVAVNEVLSQEQTAIRDGDVVALFPPVTGG 84
204 9.000e-22UniRef50_A0A2H5YFG3 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5YFG3_9BACT  ali  37  4..RVLLFARLKDLAGVSEAEVEIGTAADVFRLLQGLYPGLAS--YDAPLAYAVNARYVSPEHPVRDGDEVAFIPPVSGG 81
205 1.000e-21UniRef50_W7E431 Molybdopterin converting factor subunit 1 n=3 Tax=Proteobacteria TaxID=1224 RepID=W7E431_9PROT  ali  29  1MIKIRYFGFLKEILNLEEEQIEWPDSQALLTYLRSRSDFWAESLSEQNIRLAINQKIIYQTSPISSGDEVAILPPVTGG 82
206 1.000e-21UniRef50_A7C5P4 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A7C5P4_9GAMM  ali  25  3.IIVKFFASLREEMGKSEVQLEATDSLTVAQVWAQVC---NNTPLPSHILIAINQEYSEQNALVKDGDEIAFFPPVTGG 77
207 1.000e-21UniRef50_A0A2E5K1C9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Opitutaceae bacterium TaxID=2006848 RepID=A0A2E5K1C9_9BACT  ali  28  3.IQLYYFAILQDQRGLREEQLELETAGDLYDKLKSLH---GFTLSQDALRLSVNQQFVGWDTVIHDGDEVVFIPPVSGG 79
208 1.000e-21UniRef50_A0A0Q0GG56 Molybdopterin synthase sulfur carrier subunit n=45 Tax=root TaxID=1 RepID=A0A0Q0GG56_9GAMM  ali  26  19.VNVLFFGQLKERLKCDKLTVEIASVAAFKHMLVEQNPHWQAWLEERDVLCALNQTMSSSDELVKAGDELAFFPPVTGG 99
209 1.000e-21UniRef50_A0A2E5J3X3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5J3X3_9CHLR  ali  19  28.IYLRFFALYKEKSGTANTTIDMPSGSSVDDLINKMHEIYPSLPRNITTLIAVNYQYVESDTILHDGDEIAIIPPVSGG 105
210 1.000e-21UniRef50_A4IL41 Molybdopterin synthase sulfur carrier subunit n=10 Tax=root TaxID=1 RepID=A4IL41_GEOTN  ali  30  1MIRLLFFAHLGEQVGERQVTWPPETVGKLKEEVEARY-----SLSLERVMTAVNEEYAHDDAPLQTGDTVAFIPPVSGG 76
211 1.000e-21UniRef50_A0A0S8HXZ5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8HXZ5_9BACT  ali  26  3.IKVRFFAICRELAGTDIAELELPKNADLWNELYKLYPDLSAV--SAHVALAVNDEYSAGDFTLHDGDEISLIPPVSGG 81
212 1.000e-21UniRef50_A0A150KNL6 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Bacillaceae TaxID=186817 RepID=A0A150KNL6_9BACI  ali  25  1MIKVMFFAHLREQIGTGEIEINSGTVKELKEYLQINH----SLNNLDSIMTAVNEEFCHDETMVDEGDIIALIPPVSGG 77
213 1.000e-21UniRef50_A0A1A9S2T6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1A9S2T6_9NEIS  ali  32  7.ITVLYFAALREQAGKEQETLAVAQGSTPAALYGQLSQQYGFTLPQERVRAAVNHAFADWAQPLAERDIVAFIPPVAGG 84
214 1.000e-21UniRef50_A0A1G0NQL2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Ignavibacteria bacterium GWA2_54_16 TaxID=1798420 RepID=A0A1G0NQL2_9BACT :_  ali  29  3.ITLRLFSVARDLAGFREQTMEIPAGANILEILQDRNPKFAEW--QHAVRIAVNQEYVSNDHPLHDGDDVAVIPPVSGG 81
215 1.000e-21UniRef50_A0A1B3XVM9 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Bacillales TaxID=1385 RepID=A0A1B3XVM9_9BACI  ali  31  1MIKVLLFAQLRDESGKEAISIEGNSVAELKGKMEAEY----QLGGLETVMTAVNEEFADDNTILSDGDTVAFIPPVSGG 77
216 1.000e-21UniRef50_A0A2E5JWK0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5JWK0_9CHLR  ali  19  5.ITIRAFAIYREILGKDELSLNISTVEDVLEHLKRLYPKTSSLINIS--MFAVNQQYREISHILIDHDELALIPPVSGG 83
217 1.000e-21UniRef50_A0A2E9VS14 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Rubinisphaera sp. TaxID=2024857 RepID=A0A2E9VS14_9PLAN  ali  24  7.ITIRLFATLREIVGQDQLTFDGLTIAELKQTLLQTYPELEPQF--KAIMMARNCSYCKEAQVLQPDDEIAFIPPVSGG 85
218 1.000e-21UniRef50_A0A2E4ZYQ7 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A2E4ZYQ7_9BACT  ali  25  7..RLLYFAILRESTGISSEDLS-TSANTPKELYTELKERWNLSITENELRVAVNGEFADMEDNLNEGDEIAFIPPVSGG 82
219 1.000e-21UniRef50_A0A0K0QIL8 Molybdopterin synthase sulfur carrier subunit n=262 Tax=Bacilli TaxID=91061 RepID=A0A0K0QIL8_BACTU  ali  28  1MIRVLLFAHLQEEAGTSELQIEKETVAELKDVVAKEY----NVPVSEPIMVAINEEYANEDDRVQDGDVVALIPPVSGG 77
220 1.000e-21UniRef50_A0A2D6GB38 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2D6GB38_9CHLR  ali  29  10.ITVRFFASYREKAGTSETVVDIPDGATVGDLLAESFPDLTS--RPIGLVVAVNQEYRDHSFGLSDGDEAAVIPPVSGG 88
221 1.000e-21UniRef50_A0A1F4QES4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=candidate division NC10 bacterium RIFCSPLOWO2_02_FULL_66_22 TaxID=1801658 R  ali  33  3.IRVKLFASVKDIVGRREVVLDLPTAAGLLERFAADHPGLRGL--APSLLLAVNREYVEGNRVLAEGDEVAFIPPVSGG 81
222 1.000e-21UniRef50_A0A258FML4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Brevundimonas subvibrioides TaxID=74313 RepID=A0A258FML4_9CAUL  ali  51  1MARVLLFGAFADVAGWREQEVEGGSTEALVAVLSE-HEGLAERLARPGRMTVVNRVVVRGDVTVTPDDEVAFAPPVSGG 78
223 1.000e-21UniRef50_UPI0004E0BEDB molybdopterin synthase sulfur carrier subunit n=1 Tax=Parvularcula oceani TaxID=1247963 RepID=UPI0004E0BEDB  ali  45  1MTRILFFGRLSDLAEAEDVSLDVTDTEALRGWLSARDARLGEALARPGIKVALNQAILPAPAPVGPGDEVAFLSPLSGG 81
224 2.000e-21UniRef50_A0A2W4TFN2 Molybdopterin converting factor subunit 1 n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2W4TFN2_9BACT  ali  32  3.VTVQFFARLRELAGCSSWTCEIATVADVWQAAEQQFPAIAAM--AGRVSCAVNADFGRMNAVVHDGDEVAFLPPVSGG 81
225 2.000e-21UniRef50_A0A285NUI0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Hydrogenobacter hydrogenophilus TaxID=35835 RepID=A0A285NUI0_9AQUI  ali  28  1.MKLLYFSILRERLKKDQEEIDFSSVRELRLELVRRYPDLKDLL--ERIKFAVNEEYVSDDYQLKGNERVALIPPVSGG 77
226 2.000e-21UniRef50_A0A2D5HM36 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D5HM36_9PROT  ali  28  1.MKILYFSWLKEKVGKSLEEIEKPSIKDLIEFLENSSANHQNAFKHKSIKVAVNKEFADFETLINEKDEIAFFPPVTGG 83
227 2.000e-21UniRef50_A0A2W6BB81 Uncharacterized protein n=1 Tax=candidate division AD3 bacterium TaxID=2052315 RepID=A0A2W6BB81_9BACT  ali  31  1MITARLFARLREQAGTGSEELELATVADVYAALRERHPQLEG--DTTVIRPVRNQSFVEWAERVEDGDEVAFIPPVSGG 79
228 2.000e-21UniRef50_K9NM24 Molybdopterin synthase sulfur carrier subunit n=48 Tax=Gammaproteobacteria TaxID=1236 RepID=K9NM24_9PSED  ali  18  1MILINYFARYREQLNLGGEKLPLTTIEDVRRLLMARGELWSQVLGENNLMCALNQELCHPDRVIEDYDEIAFFPPVTGG 83
229 2.000e-21UniRef50_A0A1F9ZEJ7 Molybdopterin converting factor subunit 1 n=1 Tax=Euryarchaeota archaeon RBG_16_68_12 TaxID=1797981 RepID=A0A1F9ZEJ7_9EURY  ali  32  3.VTVRLFASYRDIAGSGDLKVHLPDGATLRDLLEAEHPRLRGL--RDTMLLAVNHEFAEPSARLRDGDEVALMPPVSGG 81
230 2.000e-21UniRef50_A0A143PVY8 Sulfur carrier protein MoaD n=2 Tax=Bacteria TaxID=2 RepID=A0A143PVY8_9BACT  ali  32  3.VTVRLFARLREIAGTDELSRPVATVADVWQGMTGEWPALTP--YAGSLSCAVNAQYARMTTAVQDGDEVAFLPPVSGG 81
231 2.000e-21UniRef50_A0A2M7G045 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7G045_9BACT  ali  29  3.ITLKTFAQLREKTGRGQIELELPEQATLETCLKQQFPELEQDL--KHTRLALNQRYVDLTTPLKTNDEVALIPPVSGG 82
232 2.000e-21UniRef50_A0A1W6EEK3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A1W6EEK3_9BACT  ali  27  6..TVLLFGITRDLVGQNRLSVPLAKGGRVADLLAHLHEQYPALAGVKSVLVAVNSEYAEPDMVLNPSDEIALIPPVSGG 82
233 2.000e-21UniRef50_A0A2E7G3A5 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7G3A5_9CHLR  ali  23  25.IKIKFFALYKEKAKTKDTVVEIPTIQDLCDLLIENYPNLSK--FKNNIIFAVNYEYQDNTYILSDNDEIALIPPVSGG 103
234 2.000e-21UniRef50_D8LMR2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Stramenopiles TaxID=33634 RepID=D8LMR2_ECTSI  ali  30  25.VKVLFFASCREMAGTKETSLELPSIAQLREHIVEKLPGLQPV--AATVTLALNQEYLDPDATLKEGDEVAFIPPISGG 106
235 2.000e-21UniRef50_A0A2E9ZFJ4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E9ZFJ4_9GAMM  ali  25  1MLTIHYFASVREAVKRSKEKLELPEIGDLIEHLLLLHPHFEAIFQDDRILIAVNQTVVDKTQALDPGDEIAFFPPMTGG 84
236 2.000e-21UniRef50_A0A2V8A7K9 Molybdopterin converting factor subunit 1 n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8A7K9_9BACT  ali  35  50.VTVKLFARLRDIAGSPELARDVATIGSVWRELAREFPELAR--YERSISSAVNTDYARMDHVLSDGDEVAFLPPVSGG 128
237 2.000e-21UniRef50_A0A1U7LLY0 Molybdopterin synthase sulfur carrier subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1U7LLY0_9ASCO  ali  28  17....LYFAAAKDATQMTCENIPMPTMANLSEFLAQRHPALKRRQILEGCLFTVNEEYVDPETIIKHGDEVAIIPPVSGG 95
238 2.000e-21UniRef50_A0A2E6YLS3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6YLS3_9CHLR  ali  25  4.ISVKFFASYREKINAPSLDINIATVKDLIDEVSKIHPKLTKDF--SSLVVAVNWEYSDFNLVLKENDEVALIPPVSGG 82
239 2.000e-21UniRef50_A0A2W4NWV7 Molybdopterin converting factor subunit 1 n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W4NWV7_9CHLR  ali  35  4..NVLLFATLKERAGAGRIALELPTVAQLRDVLVQQYPSLGPSM--PTAICAINHEFAGAQDVVSEGDEVAFFPPVSGG 82
240 2.000e-21UniRef50_A0A2E2SAX4 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E2SAX4_9GAMM  ali  42  8..RLLFFGRLRDISHNIEEKDEIRSIKDLTSWLDAKDPILGKELVKPFVLVSVNKNIVKNDFIISEGDEVAFLPPVTGG 88
241 3.000e-21UniRef50_E6PPJ5 Molybdopterin-converting factor subunit 1 (MPT synthase subunit 1) (Molybdopterin synthase subunit 1) (Molybdenum cofactor biosynthes  ali  24  4..TIRYFASVREAIGRGSETLDLPTLGDVRAWLTQRSARHAIALSDKTLRMACGHVMAEVDAPIVPGCEVAFFPPVTGG 85
242 3.000e-21UniRef50_A0A0F2NVN6 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium BRH_c0 TaxID=1629722 RepID=A0A0F2NVN6_9GAMM  ali  40  1MLKILFFGRLSDVAGAERMDISITTITMLRDHLGQGNEALLRALNEPQVMVALNQILVDWDCNLQPGDEVAFLPPVTGG 83
243 3.000e-21UniRef50_A0A2R5G3F4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2R5G3F4_9STRA  ali  29  25.VKVLYFARSREVSGRALETWEGATTKDLEEKLVHKYEGLKEL--TGVCAWAVNEEYVDDSQVLADGDEVAIIPPISGG 103
244 3.000e-21UniRef50_A0A2A5XZQ5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=SAR116 cluster bacterium MED-G06 TaxID=1986235 RepID=A0A2A5XZQ5_9PROT  ali  30  1.MSVRYFAWMREHTGTDLETIALPDVGDLVPHLSAMSDGHALALKNKAVRVAVNRTYGDLDTPVTAGDEVAFFPPVTGG 83
245 3.000e-21UniRef50_A0A2G5KYM2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Reichenbachiella sp. 5M10 TaxID=1889772 RepID=A0A2G5KYM2_9BACT  ali  25  3.VSVLAFGIARDILGTRTLDLDLATGQTVGTVVAELMQRYNDLAKLSSMLVAVNESYVPDDYVVKEGDELAIIPPVSGG 80
246 3.000e-21UniRef50_D5BW53 Molybdopterin synthase sulfur carrier subunit n=32 Tax=Proteobacteria TaxID=1224 RepID=D5BW53_NITHN  ali  26  3.ITVKFFASLRERLGCTERQIDFSEPITVAEVWTLVGDG---QPISENVLIAVNMEYAGAETVVRDGDEVAFFPPVTGG 77
247 3.000e-21UniRef50_A3JRD1 Molybdopterin synthase sulfur carrier subunit n=112 Tax=root TaxID=1 RepID=A3JRD1_9RHOB  ali  39  1MINVLYFAWVRERIGLPREEIEAQTVRELIAELSAREERYAAAFEDESLRVAVDQELVDFDASLSGVREVAFFPPMTGG 82
248 3.000e-21UniRef50_B8G9X3 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Bacteria TaxID=2 RepID=B8G9X3_CHLAD  ali  26  4.VTVRFFAGHRDIVGRATAQYTVATVGQLWELLVADYPRLAG--YTGRLLFAVNQQFGQPATVLADGDEVAFIPPVSGG 82
249 3.000e-21UniRef50_A0A2D5IFT4 Molybdopterin synthase sulfur carrier subunit n=12 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D5IFT4_9RHOB  ali  37  1MMRVLYFAWLRERIGLPAEDIEAQTVEHLVQELRSRAPRYEAAFSDSAVRCAIDQNLVSFDAPLGDAREVAFFPPMTGG 82
250 3.000e-21UniRef50_A0A2H5YDE5 Molybdopterin synthase sulfur carrier subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2H5YDE5_9BACT  ali  29  3.ITVRLFALYRERLGADTLTLEVAQVADALALLSQRFPRMLPLV--DNTRVAVNLEFAEPTHPLREGDEVALIPPVSGG 81
251 3.000e-21UniRef50_A0A2E5LRR5 Molybdopterin converting factor n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E5LRR5_9CHLR  ali  25  10.ITVRLFAQYREATGKSTINMLIPSVSDVLELLFNEHPSLSP--GRSSTVVAVNQSYAEHNHLLRAHDELALIPPVSGG 88
252 3.000e-21UniRef50_A0A2N0KHS6 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A2N0KHS6_9CHLR  ali  28  21...VTFFALYRERAGLRQLALELPTVTDLTDTIRQRFPNLAP--PDVKIVVAVNAEYADPDLALHEGDEVCLIPPVSGG 97
253 3.000e-21UniRef50_A0A0C1YIY4 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1YIY4_9CYAN  ali  26  5.ITVKLFAAYQDAYGQPEVRLELPTAAEVRDRLIAEHPELAQW--RDLTRFGVNLQFVEPDTPLQSGDEVVLIPPVSGG 83
254 3.000e-21UniRef50_A0A0D6EVG8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Methylopumilus planktonicus TaxID=1581557 RepID=A0A0D6EVG8_9PROT  ali  25  3.VKLFYFAKVREALGVDREEIDLETVADLVDFLKGRGSAWHTTFSESSIRMAVNQEIVEDGHAIRANDEVAFFPPITGG 85
255 3.000e-21UniRef50_A0A1Z8KY66 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A1Z8KY66_9PROT  ali  24  10.ITVRYFAWVRSRLNRPQDRVSIPTVTELLAQLSTLSPDHAQVLDNPGLKAAINQSYADPDATIMPGDEVALFPPVTGG 92
256 3.000e-21UniRef50_A0A1B3N0U5 ThiS family protein n=8 Tax=Sphingomonadales TaxID=204457 RepID=A0A1B3N0U5_9SPHN  ali  45  1MAQLLFFGRLGDLAGGTERMLEPQAIADLIGILGQSDDLLGSALAEPRIRYAINGAIVDADALVEDEDELAFLPPVSGG 82
257 4.000e-21UniRef50_A0A1G6VE95 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A1G6VE95_9BURK  ali  29  3.VTIRYFAAIREAVGQGSETVSAPTLGALRDELIARGEPWAQSLGRGRVRMALDQTLSDESAALADGAEVAFFPPVTGG 83
258 4.000e-21UniRef50_A0A1G1F8F5 Uncharacterized protein n=1 Tax=Nitrospirae bacterium GWC2_57_13 TaxID=1801697 RepID=A0A1G1F8F5_9BACT  ali  29  1MITIKLFALLRDREGAG--TLAVTTVDELLAQIAREYPSLAELITHGSLLVSVNQEFATKESAVRDGDEVALMPPFSGG 81
259 4.000e-21UniRef50_A0A142X1P6 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Planctomycetaceae TaxID=126 RepID=A0A142X1P6_9PLAN  ali  28  4..TLLFFARARDLAGTDRARLEGPTVGELRRVLLDRYPALAPI--APHLLIAVNQAYAQDPDSIPDGAEIAVFPPVSGG 81
260 4.000e-21UniRef50_A0A0T6VQ84 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A0T6VQ84_9PSED  ali  24  1MIDLHYFARYRETLGLDAEQLELRTVDDLRRTLLARGNAW-EVLAEQNLMCARNQELCSLDEPIADGDEVAFFPTVTGG 82
261 4.000e-21UniRef50_C7PD88 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Bacteroidetes TaxID=976 RepID=C7PD88_CHIPD  ali  35  1.MRILLFGIAKDIAGAPVITAEITTVAALRAWLYTKYPSLEQL---RSLMIAVNKVYANDEDTLQPGDEIAVIPPVSGG 76
262 4.000e-21UniRef50_A0A2D6RZK4 Uncharacterized protein n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6RZK4_9BACT  ali  25  3.VTVRYFAVCRQMFNRDEEDIELPEGADVLDQLKEEKPEISELF--ETMQMSVNWQYADHETKLSNNDEVALIPPVTGG 81
263 4.000e-21UniRef50_UPI00041CBD9D molybdopterin converting factor subunit 1 n=1 Tax=Acetobacter nitrogenifigens TaxID=285268 RepID=UPI00041CBD9D  ali  34  3.VTVLYFAALRERLGKSSETASLHDATTVGEWIAAQGPALADAFAGSGIRVAVNKTLADLHAPLTDGDELALFPPMTGG 84
264 4.000e-21UniRef50_A0A1E7YV24 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Acidithiobacillus caldus TaxID=33059 RepID=A0A1E7YV24_9PROT  ali  26  1MLHVKFFASVRERVGRSQMDLPWSEGMTVTAALQAVEEASGVTLHGQHLLAARNQHHVTFAEPLADGDEVAFFPPVTGG 79
265 4.000e-21UniRef50_A0A1K2HTD8 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Hyphomicrobiaceae TaxID=45401 RepID=A0A1K2HTD8_9RHIZ  ali  32  1.MKILYFAWLRERLNRSEEDIDLPTVSDLIAHLSARDEAFAMAFEKPRIRAAIDTRIVSHDTPLAGGTTVALFPPMTGG 83
266 4.000e-21UniRef50_A0A1F8XN45 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8XN45_9DELT  ali  25  1MVTVRFFAMLKGLAKTEVKEYNVSTVEELKSFIKRDFPALAGLIQSRSLLVSVNQEFAKNDTLVKDGDEVGFLPPFSGG 82
267 4.000e-21UniRef50_A0A1G1NI12 Molybdopterin synthase sulfur carrier subunit n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1NI12_9BACT :  ali  30  3.VTVLCFAQLRDHLGASEFTVSLPTGRELLDALRQRNPRIGPLLDVS--RLAVNQEYVAADVRLQDEDEVVVIPPVSGG 81
268 4.000e-21UniRef50_A0A165Y234 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A165Y234_9BACI  ali  27  1MIRILFFAQLKEQLNKKEMTLPYQTVKQLRERLEKEY----SLPALSSVLFAINEEFAAEDDIIRDGDVVALIPPMSGG 77
269 4.000e-21UniRef50_T0N8E8 Molybdopterin (MPT) converting factor, subunit 2 n=1 Tax=Thermoplasmatales archaeon A-plasma TaxID=667135 RepID=T0N8E8_9EURY  ali  33  6..RIRYFGSASDDAGTSEETIEIPDGTSVHDKLSEMHPAIGKRW--NNLLIAVNQSYVSGDAAVKNGDEIAIFPAVSGG 83
270 4.000e-21UniRef50_A0A1W9X084 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9X084_9GAMM  ali  29  3.IIVKFFASLREEVGKSEVQMETPDSLTVAQVWAQVCD---NAPLPAHVLMAVNMEYANQDAPVKNGDEVAFFPPVTGG 77
271 4.000e-21UniRef50_A0A1S2UT42 Molybdopterin synthase sulfur carrier subunit n=27 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A1S2UT42_9PSED  ali  30  3.INVLFFARYSEAVGWDSLEVEGSTVEALRQTLAA--DQGFEVLNETSLMCARNQELCSLDEPLQAGDEVAFFPPVTGG 80
272 5.000e-21UniRef50_A0A2H5RD05 Molybdopterin synthase sulfur carrier subunit n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2H5RD05_RHIID  ali  24  5.ITILYFATARDATNVSSEKISLPSLKDLTDLLKKRHEKLVPVLETS--LYAINMEYVECDYLVKEGDEVAIIPPVSGG 89
273 5.000e-21UniRef50_A0A0A2TEY0 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacillaceae TaxID=186817 RepID=A0A0A2TEY0_9BACI  ali  33  1MVKVLLFAQFQEAAGRESVEIDAAPISHVKSVLKENYG----ILELDDANVAVNEEYTNMSTELKDGDTVAFIPPVSGG 77
274 5.000e-21UniRef50_D6TJF3 Thiamine S protein n=7 Tax=Ktedonobacteria TaxID=388447 RepID=D6TJF3_9CHLR  ali  28  3.IRIRYFASLREVTGQSDELLDIADGAEIKKDLVTRYPRLQDIL--ERCLCALNRAYVPPETALHENDELVFIPPMGGG 81
275 5.000e-21UniRef50_I3TVF4 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Tistrella TaxID=171436 RepID=I3TVF4_TISMK  ali  31  4..QILYFAWMRARIGRGEDEIALSTVGALLDHLAGVSPAHAQALADRSVRVAVNQDYAGPDAAVRDGDEIAIFPPVTGG 85
276 5.000e-21UniRef50_A0A2E1XDF7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Parvularcula sp. TaxID=1979207 RepID=A0A2E1XDF7_9PROT  ali  43  1MARLLFFGKLADAAGARQRDLDAQTVGDLVSALGKQEAALGAALQEKSVRVIVNEKMAARDSAISDGDEIAFLPPVSGG 82
277 5.000e-21UniRef50_A0A2V9QS06 Molybdopterin synthase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9QS06_9BACT  ali  33  3.VRVLFFGVLKDLAGRGSEELTLPTVSDVIEVYERRVTSLRSML--PSIAISVNQEYSGPETRLQPGDEVALLPPVSGG 81
278 5.000e-21UniRef50_A0A2S6TGP8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Alphaproteobacteria bacterium MarineAlpha3_Bin6 TaxID=2013072 RepID=A0A2S6T  ali  24  1.MKILYFAWVRDKIGLDSEEFDLPTAGEFIEWFKTRGDTYAEVIASDTVKMAINQEYAGPENAISNEDEVALFPPVTGG 83
279 5.000e-21UniRef50_A0A076W108 Molybdopterin synthase sulfur carrier subunit n=57 Tax=Bacillaceae TaxID=186817 RepID=A0A076W108_BACMY  ali  25  1MIRVLLFAHLQEDAGTNELKVDCETVAELKNIITKEH----HIAVSEQIMVAINEEYANEDDKIKSGDIVALIPPVSGG 77
280 5.000e-21UniRef50_A0A2V7RVV8 Molybdopterin converting factor subunit 1 n=29 Tax=Bacteria TaxID=2 RepID=A0A2V7RVV8_9BACT  ali  26  3.VTVLLFASYADAVGRSEIELDVTSGATVKDVIERVRQMADAQRLPAAPMVAVNEQYASRDRELRHGDEVALIPPVAGG 80
281 5.000e-21UniRef50_UPI000C292CD5 MoaD/ThiS family protein n=1 Tax=Alteromonas sp. P0213 TaxID=2048004 RepID=UPI000C292CD5  ali  25  4.IQVRFFALFRERLGIDSMQFTCATVEDVLNGLYQQNPAIAEHVQVGQLLCAVNHKLVGMEHSLQSGDELALLPPVTGG 84
282 6.000e-21UniRef50_S5TV00 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Thiotrichales TaxID=72273 RepID=S5TV00_9GAMM  ali  25  15.VKVLYFASLKELFGRSEQQLNIDGLKTVEDVWKHVSKGYD---VSQQVLYSVNHEYAQADSLVHAGDEVAFFPPVTGG 89
283 6.000e-21UniRef50_A0A2E4DP19 Uncharacterized protein n=3 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E4DP19_9BACT  ali  25  37.VTVRYFAICRQMFNRDEEDIELPEGADVLDQLKEEKPEISELF--ETMQMSVNWQYADHETKLSNNDEVALIPPVTGG 115
284 6.000e-21UniRef50_A0A2E3J3N2 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3J3N2_9BACT  ali  29  3.IKTLFFATCRDIVGEREVSLEGTTVRDLIELISSENPSFRSM--EASLMVSVNQKYVDRMEVLNDGDEVAFIPPVSGG 81
285 6.000e-21UniRef50_A0A1Q7PM49 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 13_1_40CM_3_65_7 TaxID=1805024 RepID=A0A1Q7PM49_9BACT  ali  21  11.VRVVLFAKPRELVGQPNIDLSLPAGATAADAWGQLSTRYDLGPLPRSFRCAVNSEYAGWDDPLKDGDELAVIPPVSGG 88
286 6.000e-21UniRef50_A0A2E8WRF7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8WRF7_9GAMM  ali  25  1MIRVKYFASLRERMNRGEDQIEVSTLADVLARLTLDGQTLQQLSLGETMMLSVNHEMVEMDHVVKEGDEIGVFPPVTGG 84
287 7.000e-21UniRef50_H5SQW8 Molybdenum cofactor biosynthesis protein D n=3 Tax=Bacteria TaxID=2 RepID=H5SQW8_ACEAU  ali  34  3.VRVKLFSLLREAVGTGEVNFSGETAGELWEELERQHPALAP--FRPARAIAVNRHHAREDARLSDGDEVAFFPPVSGG 80
288 7.000e-21UniRef50_D3FW88 Molybdopterin synthase sulfur carrier subunit n=17 Tax=Bacillaceae TaxID=186817 RepID=D3FW88_BACPE  ali  26  1MITLLLFAELAERLNTKEMQIDASSLKEVKEMVKEQHEGIAHVIDQS--MIAVNEEYAEGTEVLKDGDVIAFIPPVSGG 79
289 7.000e-21UniRef50_A0A2E8WCD3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8WCD3_9BACT  ali  28  4..RVLLFAQCSDIVGSRKVDLDLPTVQDLMDHFSAKYPPMKKL--DRSIMLSVNQEYVEREQLLKDGDEVAVITPVSGG 81
290 7.000e-21UniRef50_A0A1Y3G5Q7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y3G5Q7_9PROT  ali  34  5.IKVLYFASLREQLGYAEDIIDVPDIQSLITLLGEKKPQVKAVLTEPRLRAALNQTLVSFTTAVKPGDEVAFFPPMTGG 87
291 7.000e-21UniRef50_A0A2G6E9Q2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6E9Q2_9BACT  ali  28  19.ITVKFFASFQEILGTNSVLLDIACVADLIEYLEQQYPVFEGRLEKRSL-VAVNEQYSQRHRHLSDGDVIAFFPPVSGG 99
292 7.000e-21UniRef50_F5T271 Molybdopterin synthase sulfur carrier subunit n=16 Tax=root TaxID=1 RepID=F5T271_9GAMM  ali  24  3.IQVKFFASLREKLGQA--DMELTTASTALDAWNQ---ATQNKPVPDNLLVAINLDYAKLNTPVQDGDEVAFFPPVTGG 75
293 7.000e-21UniRef50_A0A2E0KVU4 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A2E0KVU4_9CHLR  ali  25  3.IKVLLFATLKDIAGQNSLLLDLATVADVRQGLTARYPKIQANVEVA--IASVNEEYAQNDTVVHDGDTLAFFPPVSGG 82
294 7.000e-21UniRef50_A0A1Z4QCD6 Thiamine S protein n=1 Tax=Cylindrospermum sp. NIES-4074 TaxID=2005457 RepID=A0A1Z4QCD6_9NOST  ali  24  49.VNVKLFAAYQEACGVSELVLEFPNVAAVCDRLIAEHPKLAQW--RDITRFGVNLIFVEPDTLLQDGDEVVLIPPVSGG 127
295 7.000e-21UniRef50_C8Q195 Molybdopterin synthase sulfur carrier subunit n=49 Tax=Proteobacteria TaxID=1224 RepID=C8Q195_9PROT  ali  34  13...ILYFASLAEQAGKDEETIDGDNLTELYQTLSAQY---GFKLAPTKLAVAINHHIANWQTPLQDGDIIAFIPPVAGG 87
296 8.000e-21UniRef50_A0A0D5ZE17 Uncharacterized protein n=1 Tax=uncultured archaeon TaxID=115547 RepID=A0A0D5ZE17_9ARCH  ali  24  5.VKIRYFALYRDLSGKSDETMDLKDGSTLLDEVRESHPIFRK--QSGEFLLAVNEEYAAPETVLKDGDEVAIFPNVSGG 83
297 8.000e-21UniRef50_A0A098F541 Molybdopterin synthase sulfur carrier subunit n=33 Tax=Terrabacteria group TaxID=1783272 RepID=A0A098F541_9BACI  ali  27  1MNKVMFFAHLRDAAGVDSITVDAATVGQLKMELAEKY----DLPKMDTVMAAVNEEFSSNDETINEGDVIAFIPPVSGG 77
298 8.000e-21UniRef50_Q0BQB8 Molybdopterin synthase sulfur carrier subunit n=47 Tax=root TaxID=1 RepID=Q0BQB8_GRABC  ali  25  6..HIVYFAWLRDRIGRNEEHVPLPNVGGLITWLRGRGRDYKSALAENRIRCAVNHEVAALDTPISPGDEVGFFPPITGG 87
299 8.000e-21UniRef50_D3PKL1 Molybdopterin synthase sulfur carrier subunit n=38 Tax=Thermaceae TaxID=188786 RepID=D3PKL1_MEIRD  ali  31  3.VQVLLFALFREQAGQARLQLELPTVADVKALLEAQYP-----LRLSGGLAAINEQLAQPHQPLKDGDELAFLPPVSGG 78
300 8.000e-21UniRef50_A0A2D5UBT6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Nitrospinae/Tectomicrobia group TaxID=1802340 RepID=A0A2D5UBT6_9BACT  ali  28  3.VTVKCFAWAREVTGGDEVELEVPTVRDLRESLGKKFPAFAERM--ESIAVSVNQEFAGDSQGVSVGDELALIPPISGG 81
301 8.000e-21UniRef50_A0A066PVT2 Molybdopterin synthase sulfur carrier subunit n=24 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A066PVT2_9PROT  ali  30  1.MKILYFAWLRERIGLSEEDVDIPTISALTDFLSARSPAHTRAFADRRIKTALDQRFVPPDTLLEGAREIAFFPPFTGG 83
302 8.000e-21UniRef50_A0A2U1S3I5 Molybdopterin converting factor subunit 1 n=3 Tax=Bacteria TaxID=2 RepID=A0A2U1S3I5_9BACT  ali  25  13.IRVRCFASIREIVGAYELVVDLPEGSTLNQLLCERFPRLQAL--RGSLLFSVNREYAAIDTTLTEEDDVALIPPVSGG 91
303 8.000e-21UniRef50_A0A2E0T669 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E0T669_9RHIZ  ali  29  1.MKLKYFAWIAEIIDKREEILEIPTIGQLIDFLSTIDPVYADAFRRKSIKFAINQVLVDEDELISRNDEIAFFPPMTGG 83
304 9.000e-21UniRef50_A0A2M9N5J7 Molybdopterin synthase sulfur carrier subunit n=48 Tax=Bacillales TaxID=1385 RepID=A0A2M9N5J7_9BACL  ali  32  5.ISILLFAGLADRIGTASLTFNVPTAGELKLLLSDAYPDAKAQIA--TAFVAVNQEYAPSEQLIQSGDEVALIPPVSGG 84
305 9.000e-21UniRef50_Q9AC49 Molybdopterin synthase sulfur carrier subunit n=32 Tax=Alphaproteobacteria TaxID=28211 RepID=Q9AC49_CAUVC  ali  100  1MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALAGPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGG 79
306 9.000e-21UniRef50_Q21HG0 Molybdopterin synthase sulfur carrier subunit n=13 Tax=root TaxID=1 RepID=Q21HG0_SACD2  ali  30  10...ILYFASLGETLRTNSETLAVDSVSDLIALLAQRGENWQ-LLQDKTTKCAVNQTIASKDQPLSHNDEVAFFPPVTGG 88
307 1.000e-20UniRef50_A0A2V6R7L0 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6R7L0_9BACT  ali  26  3.VAVRFFARYREATGRERLELELPDGGTVEAAWAARHPELAR--YRPFTLFAIGNDYVDPDQTLRPGDELCVFPPVSGG 81
308 1.000e-20UniRef50_A0A257RSV2 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium 21-71-4 TaxID=1970514 RepID=A0A257RSV2_9BACT  ali  35  3.VRVLLFASYADALGGPEIRLDLPDGSTVRELLDALQRRPGAHRLPPAPLVAVNQRYASLGTPVTAADEVAIIPPVAGG 80
309 1.000e-20UniRef50_A0A0Q8F9B1 Molybdopterin synthase sulfur carrier subunit n=97 Tax=root TaxID=1 RepID=A0A0Q8F9B1_9GAMM  ali  31  4.VTLLYFASLRERAGIASETIS-TTAADLSGLYEEVQARHGFTWPREHLRVAVDGEFARWGDAVRAGSEIAFIPPVSGG 80
310 1.000e-20UniRef50_A0A2G4FD36 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FD36_9ACTN  ali  30  4.VRVLFFAHARDATGCSQVELKADTLAGALDQSCATYPALAAVLANSRVWINGDEPLTGMTTDLNENDEIAVLPPVSGG 81
311 1.000e-20UniRef50_A0P6L7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=unclassified Nitrosomonadales TaxID=1660158 RepID=A0P6L7_9PROT  ali  26  3.INILFFASLRELFNSDSMEVTKPEIMSVRELLDEKGPWLELSKRFSTIRVAVNHSIVDWDTLINEGDEIAFLPPITGG 86
312 1.000e-20UniRef50_A0A1Q7DF28 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A1Q7DF28_9ACTN  ali  30  7.VRVRFFARLREQAGVEIEPRQMPPGSTLADVYDVSRRAHPALPEREGVRAALNQEFADWTIKVSDGDEVAFIPPVSGG 84
313 1.000e-20UniRef50_A0A1Z8NTJ4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Betaproteobacteria bacterium TMED22 TaxID=1986845 RepID=A0A1Z8NTJ4_9PROT :_  ali  24  3.IKVLFFAKLREVFETNQVDISFTGVSDVLMVLREKGGVWKDELENKSFRIALNQEMVTKDAMLNEGDEIALFPPVTGG 85
314 1.000e-20UniRef50_A0A061QAE5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=alpha proteobacterium Q-1 TaxID=1492281 RepID=A0A061QAE5_9PROT  ali  22  1MITCVYFAWVREGIGCESETIAPPSLADIIHWLKGQSPGHHRVLADPSLRFAINLDHATLESPIREGDELAIFPPITGG 84
315 1.000e-20UniRef50_A0A2H5Z304 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Bacteria TaxID=2 RepID=A0A2H5Z304_9BACT  ali  26  3.VTVRYFAVVREFLGQDHEEHELPTVGQFLEDLIARQPILERL--RRSMLVMVNRRYARPDQLLSDGDEVALIPPVSGG 81
316 1.000e-20UniRef50_A0A0K0TXP5 Molybdopterin synthase sulfur carrier subunit n=21 Tax=Rhizobiales TaxID=356 RepID=A0A0K0TXP5_9RHIZ  ali  30  1.MKVLYFAWLRERLNKGEETVEVKTVGDLIAWLAANDEAADLAFARKLIKAAVNARMVDHNAPIAANDTVALFPPMTGG 83
317 1.000e-20UniRef50_A0A0M4RJ54 Molybdopterin synthase sulfur carrier subunit n=54 Tax=root TaxID=1 RepID=A0A0M4RJ54_9PSED  ali  27  4..KVVFFARYREALGLDGETVEGSSIDQLRGYLMQRGGAWQ-VLAESNLMCARNEELCKPDELLADGDEVAFFPPVTGG 81
318 1.000e-20UniRef50_A0A240DYG0 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A240DYG0_9BURK  ali  28  3.IQLRFFASLRESLGISQETIVIPTIADLRSHLAERGAVWAEVMAEGKIRCALNQQMVSDAALLQENAEVAFFPPVTGG 85
319 1.000e-20UniRef50_A0A2E7VJS6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2E7VJS6_9BACT  ali  25  6.VTLRYFAMLRESAGVESEDLS-TSSETPKELYAELQESKGFSLGATELRVAVNGEFAALDDALNEGDEIAFIPPVSGG 82
320 1.000e-20UniRef50_A0A2V6XZ54 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6XZ54_9BACT  ali  25  3.VRVRLFARYREATGQERLDVDVPTVETAWKAIVARHPDLSR--YRPYTLFAVGHDYVEPDHRLAPDDELCLFPPVSGG 81
321 1.000e-20UniRef50_A0A2T4U3R7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Alkalicoccus saliphilus TaxID=200989 RepID=A0A2T4U3R7_9BACI  ali  24  1MITIYFFAGMKEAAGTPQMTWEITTVKNIREKVKETYPQLHQAEFA---MTAVNEEFAGNDETVRTGDTVAFIPPVSGG 78
322 1.000e-20UniRef50_A0A0L9UJN8 Molybdopterin synthase sulfur carrier subunit n=7 Tax=rosids TaxID=71275 RepID=A0A0L9UJN8_PHAAN  ali  28  25.IKVLFFARARDLTGLSEMPLEVPSGSTTHDCLKKKFPDLEEI--RGCMVLALNEEYTTESSIVKDTDELAIIPPISGG 103
323 1.000e-20UniRef50_A0A2E3A8K2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E3A8K2_9BACT  ali  33  9.IRVLFFAIAGELAGESSIELELATASDAEAKLKERYDWLGKRL--SSYRIAVDEEFAGSDTPVRDGSELAIIPPVSGG 87
324 1.000e-20UniRef50_A0A1I1S567 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Lentibacillus persicus TaxID=640948 RepID=A0A1I1S567_9BACI  ali  32  1MINVLLFADLQEAVGSEEVNVEAESVSELRTKLKASY----DLTNLDNAMTAVNEEYSDEDTMLKSGDTVAFIPPVSGG 77
325 1.000e-20UniRef50_A0A063Y3L0 Cyclic pyranopterin monophosphate synthase n=10 Tax=Oceanospirillales TaxID=135619 RepID=A0A063Y3L0_9GAMM  ali  31  180..QVRFFAELREQMQQDELQVAVATVAGLSDWLHQQFPALKS----GRLMVAVNQQMAELSTALKSGDEVAFFPPVTGG 261
326 1.000e-20UniRef50_A0A1I0IQ48 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1I0IQ48_9BACI  ali  34  1MVKILFFAGLAEKIGEREMVIEEAQIDQLTEWLQAQYPSAKSELAQS--MVAINEEYAERTETLADHDIVAFIPPVSGG 80
327 1.000e-20UniRef50_A0A2V8QD58 Molybdopterin converting factor subunit 1 (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8QD58_9BACT  ali  33  9.VHVLFFGAARDAAGAEEIDIELATEGTARKEILSAYPELQR--FGKSLLFAVNQEYAEPNREIRNGDELAIFPPVSGG 87
328 1.000e-20UniRef50_UPI0007AFA1E3 uncharacterized protein LOC107625561 n=2 Tax=Arachis TaxID=3817 RepID=UPI0007AFA1E3  ali  28  135.IKVLFFARARDITGLSEMPLEVSSGSTTQDCLKKLFPSLEEI--QGCMVLALNEEYAADTTVVQDKDELAIIPPISGG 213
329 1.000e-20UniRef50_A0A2D9SHN2 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D9SHN2_9PROT  ali  29  1MI-IKYFSWVKDLAETNEETIELPDVEDLINFLEKKNNKYKEIFSKKHIKIAVNKEYVNTSFKLDKNDEIAFFPPVTGG 83
330 1.000e-20UniRef50_A0A0H4VP04 Molybdopterin synthase sulfur carrier subunit n=42 Tax=Bacteroidetes TaxID=976 RepID=A0A0H4VP04_9BACT  ali  30  1.MNILLFGITREIVGKQALQVSLETVADLKQWLFAQYPALREL---KSLAVAVDSEYAEDAQPLSAGQEIALIPPVSGG 79
331 2.000e-20UniRef50_O31706 Molybdopterin synthase sulfur carrier subunit n=92 Tax=Bacilli TaxID=91061 RepID=MOAD_BACSU  ali  33  1MIKILLFAGLAEQAGTQAIEIDMATTDEIKASLKEQYG----LESIDTAMIAVNESYVKENTSVSSGDTVAIIPPVSGG 77
332 2.000e-20UniRef50_Q6L061 Molybdopterin (MPT) converting factor, subunit 1 n=2 Tax=Picrophilus TaxID=46631 RepID=Q6L061_PICTO  ali  25  1MIRIIYFAAARDRSGTDNEYIDYKSLTELKKIIYERHNDLKSM----DLLFAVNRRYVD-DCIIKDGDEIAVFPPVSGG 75
333 2.000e-20UniRef50_A0A225DVT4 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A225DVT4_9BACT  ali  32  2....LLFAKLRDIAGADRVDVELPTVANLRRALTTSYPDLASLL--ERCAIAVNHDFAVDDTVLGDRDEIAVIPPVSGG 77
334 2.000e-20UniRef50_UPI000321EE36 molybdopterin converting factor subunit 1 n=1 Tax=Magnetococcus marinus TaxID=1124597 RepID=UPI000321EE36  ali  36  22MANLLFFASVKDKMGMPATQLALPNVASLMLYLQGLGDPYAHALAGGDVQVAVNQTHARGEDPVQNGDEIAFFPPVSGG 104
335 2.000e-20UniRef50_A0A2E8E5V6 Molybdopterin synthase sulfur carrier subunit n=27 Tax=Bacteria TaxID=2 RepID=A0A2E8E5V6_9BACT  ali  34  3.VNIRLFARLRDIAGAGEIERHVPDGATVRTVWTALAAEFPDLMSEASISTAVNAEYSRMEAPVGEGDEVAFLPPVSGG 81
336 2.000e-20UniRef50_A0A2H5VN88 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Bacteria TaxID=2 RepID=A0A2H5VN88_9BACT  ali  30  1MITVRFFAQCRELAGTAECEVQLPPSATVLEAVCERFPALREL--QGRVLVAVNERYAAPETLLHSGDVLALLPPVSGG 82
337 2.000e-20UniRef50_A0A2E8SBQ8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E8SBQ8_9CHLR  ali  25  4.INIKPFARYREIIGEKDIVMNLPSVSDLITDLVNKYPYLKPI--ESKIVVAVNYEYQDHDHLLRSNDEVALIPPVSGG 82
338 2.000e-20UniRef50_Q1D990 Molybdopterin synthase sulfur carrier subunit n=25 Tax=Cystobacterineae TaxID=80811 RepID=Q1D990_MYXXD  ali  29  9.ITVLYFAAARERTGQVREALDLPEGSHVRDLLSAKYAALAPLL--PHLRVAVDQEFVGPDAPVRDGAEMALIPPVAGG 87
339 2.000e-20UniRef50_A0A1N6KNE6 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Paraburkholderia phenazinium TaxID=60549 RepID=A0A1N6KNE6_9BURK  ali  20  3.IQLKYFASVREALGTADETVDVPTVGDVRVWLRVRGGIWAETLAEGRLRMACNHVMTDAGTRITEGCEVAFFPPVTGG 85
340 2.000e-20UniRef50_A0A1Q7Y9D4 Molybdopterin synthase sulfur carrier subunit n=5 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7Y9D4_9B  ali  25  20.VRLLFFGAAREIVGQDEVSLRLATAASAFEEVVSHYPTLRR--FGRSLLFAVNQEYATRDAPVREGDELAVFPPVSGG 98
341 2.000e-20UniRef50_D3EDH6 Molybdopterin synthase sulfur carrier subunit n=20 Tax=Paenibacillaceae TaxID=186822 RepID=D3EDH6_GEOS4  ali  30  5.ISILLFAGLADRIGTASLAFSVPTTGDLKLLLSEAFPDAQSQIA--TAFVAVNQEYALPDQLIQSGDEVALIPPVSGG 84
342 2.000e-20UniRef50_A0A258B4U2 Uncharacterized protein n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A258B4U2_9BACT  ali  33  4..RVLFFSVLRDITGTDEITLELATMGDLLAQIESRWPKLRDW--QNSLLLALDQTYVKRDEPLHDGGEVAIMPPVQGG 81
343 2.000e-20UniRef50_A0A2K8KQC8 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2K8KQC8_9GAMM  ali  32  4..TVKFFARLREELATAEVQVALADVTTLAQLLIGQYPHWQTALER-NLLLAVNQNLVNGDLTLQVGDEVALFPPVTGG 82
344 2.000e-20UniRef50_A0A212UEC2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Cytophagales TaxID=768507 RepID=A0A212UEC2_9BACT  ali  24  4..KIALFGIAREIVGQPTLDLTAPEGQSVQELLGQLRQEYPGLSRLSSLAVAVNNEYAPDDAPLHERDEIALIPPVSGG 80
345 2.000e-20UniRef50_A0A2V6P0I2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6P0I2_9BACT  ali  28  16.VAVRFFARYREATGRQRLEVDLPDGGTVEAAWAARHPELGR--YRPFTLFAIGNDYVGPDHALRPGDELCLFPPVSGG 94
346 2.000e-20UniRef50_A0A251X3X8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Thiotrichales TaxID=72273 RepID=A0A251X3X8_9GAMM  ali  29  3.VTVKFFASLREQLQQSEVKLELTVPTTVSALWRQICGDLPLPI---NILMAVNLSYVTAETVVKDGDEVAFFPPVTGG 77
347 2.000e-20UniRef50_A0A2E6GE48 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6GE48_9CHLR  ali  25  41.IHVRFFASHKERIGCSNLLLELNEGSNLIDKINQTNPGFSK--KPESLVAAVNQEYQDLNFVLRDNDEVAFIPPVSGG 119
348 2.000e-20UniRef50_A0A2E8RKQ4 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E8RKQ4_9BACT  ali  33  3.IEVRYFAFFRQQIGRTSDEINLPTVADLLNSLRTIYPEVKDAL--NTAQISVNMEFVTLDTPLSARDEVALIPPVSGG 81
349 2.000e-20UniRef50_A0A2E3YH28 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E3YH28_9BACT  ali  37  3.ITLLLFASCREAVGDRERSIEIASVGDLRRGLASLVPVLAGI--SPSLSIAVNEEYATDERILKSGDEVALIPPVSGG 81
350 2.000e-20UniRef50_A0A2E3QM54 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E3QM  ali  32  1MIKLVFFASLREELGCGSLQVEFKEQLRLSDIIKQLEEKWGEVLGGEAVKIAINKEIALDDELLSDGCEVAFLPPVTGG 83
351 2.000e-20UniRef50_A0A1I6TKW4 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Thermoactinomycetaceae TaxID=186824 RepID=A0A1I6TKW4_9BACL  ali  23  86.ITVLFFAEIAEALNQRDLILDLPTVQELIQYLVERYPHIKEVIERS--VVACNQEYALPTQSIYPQDEIALIPPVSGG 164
352 2.000e-20UniRef50_UPI0004014CFD molybdopterin synthase sulfur carrier subunit n=1 Tax=Hellea balneolensis TaxID=287478 RepID=UPI0004014CFD  ali  34  1MIEILFFGRLGDASDTLRIDKDVSDTDALTAWLSKQNRTLEAELNKAGNRIAVNKTIISENTPLNDGDEIAYMSPLSGG 81
353 3.000e-20UniRef50_A0A2E0WN07 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E0WN  ali  24  3.VNVKFFASLRERLNRGDTRVELPEGGSVEDVWLA---ATDGREKPSNVLAAVNMEYVDFSAPVSEGDEVAFFPPVTGG 77
354 3.000e-20UniRef50_A0A0N0GKX8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A0N0GKX8_9NEIS  ali  26  6...LRYFARLRDALGCQAERVDVPTPRQLIAWLRQRGGAWDSELSGQRFRVAINQDMSQLDDPIPPGAEVAIFPPVTGG 86
355 3.000e-20UniRef50_A0A0D0TC87 Molybdopterin synthase sulfur carrier subunit n=164 Tax=root TaxID=1 RepID=A0A0D0TC87_PSEFL  ali  30  3.INVLFFARYSEAIGLDSLEVEGPTVDAVRQAL-AVDPGF-EVLNETSLMCARNQELCGLDEPLQAGDEVAFFPPVTGG 80
356 3.000e-20UniRef50_A0A1J5DZC1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1J5D  ali  21  3.VSVRYFAGVRERLGASSETLELATVEAVWESLCLRHPALVGL--RRYIRLALNLEFVDADQLVAEGDEIALIPPVAGG 81
357 3.000e-20UniRef50_Q1IPZ2 Molybdopterin synthase sulfur carrier subunit n=49 Tax=root TaxID=1 RepID=Q1IPZ2_KORVE  ali  30  3.VKVIYFGMLREIAGSQQEPIEVAEGATLFAQVLAKYPEMAR--FEKSLAIAVNLEYSAHSQPLKEGDEVALIPPVSGG 81
358 3.000e-20UniRef50_A0A2N9LMU6 Molybdopterin converting factor subunit 1 n=1 Tax=Burkholderiales bacterium TaxID=1891238 RepID=A0A2N9LMU6_9BURK  ali  28  3.VTILYFARLREAVGRTREVVEPPSVGQLRSWLVLRGEPWSSAFSVQPIRIALDQVVSPDETRLHDGAEVAFFPPVTGG 85
359 3.000e-20UniRef50_A0A2N0L201 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N0L201_9CHLR  ali  24  4..KVRFFALYRERAGKNLVSLDLPTVADLTAEVRRRYPNLAP--PEVSIVVAVNADYAEPETMLRPGDDVCLIPPVSGG 81
360 3.000e-20UniRef50_UPI000348BC29 molybdopterin converting factor subunit 1 n=1 Tax=Bacillus megaterium TaxID=1404 RepID=UPI000348BC29  ali  25  1MITVLFFAGIKEEIGLDRLIVEKETVSHLKQYIKSTYPSVPF----NHCMIAVNENFVADDEILKDQDIIAFIPPVSGG 77
361 3.000e-20UniRef50_UPI000A0655F7 molybdopterin converting factor subunit 1 n=1 Tax=Advenella mimigardefordensis TaxID=302406 RepID=UPI000A0655F7  ali  25  32.INVLYFARIAELTGKRTEQLALPAPVTVTAWLAQLHEAYPALADVSVLKVAINKKHAQADTLIQDRDEVAIFEPVTGG 109
362 3.000e-20UniRef50_A0A2H6GVU9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=archaeon BMS3Abin16 TaxID=2005740 RepID=A0A2H6GVU9_9ARCH  ali  26  1MVSIRLFAGFREKIGAEKIEVSVPVLEDFIRRLGSDYPEIGALIEKSRATIAVNHEIVGMDQIISDSDEIALFPPVSGG 82
363 3.000e-20UniRef50_A0A2E8J345 Molybdopterin synthase sulfur carrier subunit n=5 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E8J3  ali  29  1MIEVVFFASLCEELGSDSVSMDITDVGEVIDKLAEKGARWSELLMRENILVAVNQQMVDQKAAVVDKDEVAFFPPVTGG 83
364 3.000e-20UniRef50_A0A2A4GCX1 Uncharacterized protein n=1 Tax=Sediminicola luteus TaxID=319238 RepID=A0A2A4GCX1_9FLAO  ali  33  42MATIKYFGMLAEATGLQEERMALEPVSTLKQLLLEKHP----TLMGKDFRIAVNQELGDDNRMVSDTTEIALLPPFSGG 118
365 3.000e-20UniRef50_A0A2E9QXZ8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E9QXZ8_9DELT  ali  33  41.VNVKYFAVLRELTGLSEERFSLATVSVLLEAILEKHPALSGRL--EQVSVAVNHQYASKETTLSEGAEVALLPPVAGG 119
366 3.000e-20UniRef50_H8KW29 Molybdopterin synthase sulfur carrier subunit n=36 Tax=root TaxID=1 RepID=H8KW29_SOLCM  ali  32  4..TILLFGVTKDIIGSPEYQLEVKSVGELRAKLYDQYPSLEKL---NSLMIAVNKNYAADDVLINATDEIALIPPVSGG 79
367 3.000e-20UniRef50_A0A2E2XEY8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Cellvibrionaceae bacterium TaxID=2026723 RepID=A0A2E2XEY8_9GAMM  ali  30  9...LRFFARLRDDLNTSEESLVLPTVEELKQYLCLRGDNWQAALNTPGLFAAVEQKVVDWDTPLEGHEEVAFFPPVTGG 88
368 3.000e-20UniRef50_K0RDW2 Uncharacterized protein n=3 Tax=Bacillariophyta TaxID=2836 RepID=K0RDW2_THAOC  ali  30  5.IRVLFFASAREAAGTTSTTVELDDAADLREKLAALYPRLAGLVKDENITLALNEEYVQMGEALKNGDTVALIPPISGG 88
369 3.000e-20UniRef50_A0A2D7IHB9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2D7IHB9_9RICK  ali  23  1.MKIFYFASLRQIVGTSEENFKIDTVKDLIQLLRKRDENFKIAFKDSKIKCAVNRQYVSLEKLITDEDEISFFPPVTGG 82
370 3.000e-20UniRef50_I0JKG8 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Terrabacteria group TaxID=1783272 RepID=I0JKG8_HALH3  ali  28  1MNQILFFAGLREQAGEESIELDVNSIGELKETLSSRY----AIDKVKESMTAVNEEFVQDEEIIKEGDTIAFIPPVSGG 77
371 3.000e-20UniRef50_A0A2E4IDU6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Saprospirales bacterium TaxID=2026790 RepID=A0A2E4IDU6_9BACT  ali  26  1MINIKCFGIAKEIVGNDIAFIESSTVADLRQRMNEQYKAFKQV---KGYMVAVNQEYAIDSQIINADDEVAIIPPVSGG 78
372 3.000e-20UniRef50_A5WBY9 Molybdopterin synthase sulfur carrier subunit n=12 Tax=Moraxellaceae TaxID=468 RepID=A5WBY9_PSYWF  ali  23  3.ITVLFFASLAEKAQQGQQQLSVEGKLSLPELYAKLTQDHGFTLEPAKVRVAINDEFASWDDVINDGDTIAFIPPVAGG 80
373 3.000e-20UniRef50_C1EJ53 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Eukaryota TaxID=2759 RepID=C1EJ53_MICCC  ali  40  1MVRVLYFARAREATGVTEESFEVADTDALRAALVAKHPSLQSVL--ESCVLAVNQEYATGNTALSEGCEVAIIPPISGG 84
374 3.000e-20UniRef50_A6SXK8 Molybdopterin synthase sulfur carrier subunit n=176 Tax=Proteobacteria TaxID=1224 RepID=A6SXK8_JANMA  ali  23  3.IQLRFFASVREALKVAQESVTVPTVGDVRAFLRERGGVWAEVLADGRLRMAYNQEMTGADTEIEDGSEVAFFPPVTGG 85
375 3.000e-20UniRef50_A0A2E8L883 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8L883_9GAMM  ali  29  1MITVLYFASIREHMGRGEDQLELTTVAALIRYLSETDSSFSELSQSPNPLISVNQIFAETSSPVSDGDEVGFFPPMTGG 84
376 3.000e-20UniRef50_A0A080K1E9 Molybdopterin converting factor, small subunit n=5 Tax=Snodgrassella TaxID=1193515 RepID=A0A080K1E9_9NEIS  ali  32  1MITVIYLARFAEELGLTEEQLELSDSEELLAYLRQRGEPWKQTLAQNKVKIAVNNVIQHSNTPLKDGDSVALLPPVTGG 82
377 3.000e-20UniRef50_E1VQD8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=E1VQD8_9GAMM  ali  21  6.VTLIYFAKIRELIGTSEEEYPLPTVQALLESLMARGEPYLGAFESGRVLAAINQEMVSLSSGVADGDELALFPPVTGG 87
378 3.000e-20UniRef50_A0A0G8AWI7 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Candidatus Synechococcus spongiarum TaxID=431041 RepID=A0A0G8AWI7_9SYNE  ali  36  6.VRILLFGRLREEHGWHERLMELPTVAQLQQALGIHCPGL---------RWAVNQDFATPDHPLQPGDELAFLPPVTGG 78
379 4.000e-20UniRef50_A0A2E3HSG1 Uncharacterized protein n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E3HSG1_9BACT  ali  23  3.VTVKYFAVCRQMLNRDEEDMELPEGADVLDRLKDEKPEISGLF--ETMQMSVNWQYADYETKLSDNDEVALIPPVTGG 81
380 4.000e-20UniRef50_F0SFS8 ThiamineS protein n=1 Tax=Rubinisphaera brasiliensis (strain ATCC 49424 / DSM 5305 / JCM 21570 / NBRC 103401 / IFAM 1448) TaxID=75627  ali  32  3.VTVLCFARLKELVGSGRVTLELPSVKDLRRELFQQFPAVESL--AGQLLVAVNGEYAGDDAAIPVGAEVACFPPVSGG 81
381 4.000e-20UniRef50_UPI000B3D2A3D MoaD/ThiS family protein n=1 Tax=Neiella marina TaxID=508461 RepID=UPI000B3D2A3D  ali  25  5...ILVFASLREAIGQGQISAALTEVKMLKNQLADQYPVIKTAIQNDALLVAVNQQMAADEVVINDGDEIALFPPVTGG 83
382 4.000e-20UniRef50_A0A238DU25 Molybdopterin synthase sulfur carrier subunit n=3 Tax=root TaxID=1 RepID=A0A238DU25_9BURK  ali  25  4..TIRYFASVREAVGLGSETLELPTLAEVRAWLAARSSRHAFALQDKPLRMACDHIMAEPESPWIPGREVAFFPPVTGG 85
383 4.000e-20UniRef50_D3DJ31 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Bacteria TaxID=2 RepID=D3DJ31_HYDTT  ali  31  1.MKILYFSIIKEKLKRSEEEIEFKSVRELRVMLMERYPDIKELL--SQVKFAVNEEYVSDDYVLKGNERVAIIPPVSGG 77
384 4.000e-20UniRef50_A0A1B8ZPN5 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1B8ZPN5_9FLAO  ali  28  4..KILAFGITKDILGTSEKELEVQEVKQLKDKLENDFPQL---IKLKSYFIAVNEEYAGDDQVITGTDEVAIIPPVSGG 80
385 4.000e-20UniRef50_A0A0P6XM92 Uncharacterized protein n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=A0A0P6XM92_9CHLR  ali  24  1.MNVLLFASLKERVGKNQVKVQVTEVSTFLQNLFVQYPELKP--FSHNLLISINQTYASPGQIIHPDDEIALFPPVSGG 79
386 4.000e-20UniRef50_J0AYY7 Molybdopterin synthase sulfur carrier subunit n=73 Tax=Bacteria TaxID=2 RepID=J0AYY7_ALCFA  ali  24  17..RVLYFAQVAERTGQRQETWDWPTVQQWTDALLERHPNLSDM--AGRLHVAVNQFHAKPTDPVRPGDEVAVFEPVTGG 94
387 4.000e-20UniRef50_Q8PBW8 Molybdopterin-converting factor chain 1 n=15 Tax=Bacteria TaxID=2 RepID=Q8PBW8_XANCP  ali  32  5.ITVLYFASLREAAGIASEQVH-SGAADLRGVYAELDARHGLRWTPAQLRVAVDGAFARWDDPLRDGSEVVFIPPVSGG 81
388 4.000e-20UniRef50_A0A1V3H5P7 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Vibrionaceae TaxID=641 RepID=A0A1V3H5P7_9GAMM  ali  30  1MIEIRFFGLLRERIGESVISLEVPTVSELIKHLIEQNTAF-LWLNDLDVISAVNHTIVESDFSINKNDEVAFFPPVTGG 81
389 4.000e-20UniRef50_A8JJB2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Chlorophyta TaxID=3041 RepID=MOC2A_CHLRE  ali  33  3.IKVLYFAKSREVAGVNEQTFELGDGADLLAQIIAAHPALDSVM--KTCVFALNQEYVRPQDALKDGDEVAIIPPLSGG 83
390 4.000e-20UniRef50_A0A1Q7C7B3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1Q7C7B3_9ACTN  ali  29  7.IRIRFFARLREQAAVETESIEVAKGSTLADVYAILRGNHPALPGQVAVRAALNQEFADWNTTVAAGDEVVFIPPVSGG 84
391 4.000e-20UniRef50_A0A010Q5Q0 Molybdopterin synthase subunit MoaD n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A010Q5Q0_9ALTE  ali  20  30.VTVKTFAQTREITGEDNIALNVSTIEAVISQLKTRSDKWALAL-EGSVLTACNQELCDLQTVLSDGDELALFPPVTGG 109
392 4.000e-20UniRef50_L2F8F9 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Moraxella TaxID=475 RepID=L2F8F9_9GAMM  ali  27  16.INVLYFASLADHAGIDEEQLMVETAGQIFDKLSQKY---NFSLSKDKIAVAINHEFSNWQTPINHGDILAFIPPVAGG 92
393 4.000e-20UniRef50_I4KRD4 Molybdopterin synthase sulfur carrier subunit n=79 Tax=Pseudomonadaceae TaxID=135621 RepID=I4KRD4_9PSED  ali  21  1MILINYFARYREQLGVGGEKLSLRTIADVRQLLCARDETWQQVLGETSLMCALNQELCTPQALIEDFDEIAFFPQVTGG 83
394 4.000e-20UniRef50_A0A2W5YWU9 Uncharacterized protein n=1 Tax=Solirubrobacterales bacterium TaxID=1909295 RepID=A0A2W5YWU9_9ACTN  ali  29  70.VRVRLFAQLRERAGTSELELELPPGACVSDALAAVGELAGGL----PLVMAINREYAEPNDPLAAEDELALIPPVSGG 143
395 4.000e-20UniRef50_E1Z8N1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chlorophyta TaxID=3041 RepID=E1Z8N1_CHLVA  ali  30  4.VTVLFFARSRELSGTSEARISLSTTKTLMQQLLSQYPQLEEL--QGNFVFSLNQEYVDEEQQLKSGDEVAVIPPISGG 84
396 4.000e-20UniRef50_A0A239E3W1 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A239E3W1_9BACT  ali  26  3.IDVLYFGVLKELFQTSQTQVELPNVGELVNLLQKT--TSNQTSPWRSLAVAVNREYAGMDTMLQDGDEVALLPPVSGG 81
397 4.000e-20UniRef50_A0A1Q7NYU7 Uncharacterized protein n=9 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q7NYU7_9BACT  ali  28  3.VRVRFFARYREATGRERLEIDLPTVESAWSAVVHRHPELEA--YRPFTLFAVGHDYVAPEHRLQAGDELCLFPPVSGG 81
398 4.000e-20UniRef50_W1SF48 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacillaceae TaxID=186817 RepID=W1SF48_9BACI  ali  23  1MNKILFFAHLRDAVGVEFLTLDAKTVAEFKDELVAKY----DLPRMETVMTAINEEFAGNDEIIGEGDEIAFIPPVSGG 77
399 4.000e-20UniRef50_G6F233 Uncharacterized protein n=2 Tax=Commensalibacter intestini TaxID=479936 RepID=G6F233_9PROT  ali  29  1MIKICYFGFLKEILNLEEEQIEWSEGQELLTFLRSRSAFWAENLSDQNIRIAINKKIIYQTTSISPGDEVAILPPVTGG 82
400 5.000e-20UniRef50_A0A2E3ANU1 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A2E3ANU1_9CHLR  ali  26  4.VRVLYFATYREQAGIGCETINIETLGGLINMVCDIHPRI--LASPERIVGAVNEEYREHSHVLKEGDTVALIPPVSGG 85
401 5.000e-20UniRef50_A0A0P7DZH5 Cyclic pyranopterin monophosphate synthase n=77 Tax=Halomonadaceae TaxID=28256 RepID=A0A0P7DZH5_9GAMM  ali  35  206.VRVLFLAELRERLDLDSLALNLATVGGLKRTLALRDPQL-EALNDTRVLCAVNQDMVRDDHPLNAGDEVAFFPPVTGG 287
402 5.000e-20UniRef50_A0A2K2V7R0 Uncharacterized protein n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2K2V7R0_9ARCH  ali  37  3.VRVRLFGSLRERAGTQEMNIELPNGSKVGDLLKN----IESIVKGVSIMIAVNSKKVDEEHALSDGDVVAIFPPVSGG 76
403 5.000e-20UniRef50_A0A1M7TC44 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1M7TC44_9BRAD  ali  30  1.MKLKYFAWVRERIGKPEETIEPPTVEELIAWLAARGETYAHAFETPRIRAAIDHAHVKQDAAIAGAREIAFFPPMTGG 83
404 5.000e-20UniRef50_L0DFI3 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=L0DFI3_SINAD  ali  28  3.VTIRLFALAKQIVGRSELPLQLPTVADLRQELARAYPELAPLI--PNLMVAIESEYADDPRAIQEGEEVALIPPVSGG 81
405 5.000e-20UniRef50_A0A2H6G2I7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium BMS3Abin11 TaxID=2005719 RepID=A0A2H6G2I7_9BACT  ali  26  4..RILFFASLRDASGVGEKQMDVEPGQSVADLWQGVSAGFEQL--PAKVLCAVNQEYVDNDYLLQEGDEVAFFPPVTGG 79
406 5.000e-20UniRef50_A0A2N5YES4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Halioglobus japonicus TaxID=930805 RepID=A0A2N5YES4_9GAMM  ali  30  1MIKVLFFGRVRESLDCAEQAVPFTSGLDLQALIEEGGPSWGDVLTEENMIRAINHEVVDGNPELAEGDEVAFFPPVTGG 83
407 5.000e-20UniRef50_A0A1Y5E716 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5E716_9PROT  ali  30  1.MKILYFAWLRAQLGMAEETISLPELHDLIDWLRARSDVFYAAFSDDVIRIAVDQEYVTENVPLKGVREIAFFPPVTGG 83
408 5.000e-20UniRef50_A0A2E9XGC1 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E9XGC1_9RICK  ali  20  1.MKILYFSWIKTKIGKDKEVVILPNGSDLVDFLKTKGPKHADALKNKKIRMAINFEHTALNHPIKKNDEIALFPPVTGG 83
409 5.000e-20UniRef50_A0A2E4FPK8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E4FPK8_9BACT  ali  34  38.VNVRLFARLKDIVGTGELARRAPLGATARTVWETMVSEFAELNYEGSISVAVNEEYSRMDAPVADGDEVAFLPPVSGG 116
410 5.000e-20UniRef50_UPI000DAEDC24 molybdopterin converting factor n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAEDC24  ali  30  3.ITIRYFGGIRERLGKDAEELELPTVDDLWRAIFRAHPELEGI--RESTRVAVNREFAPPELALSPDDEVALIPPVSGG 90
411 5.000e-20UniRef50_A0A243WJK5 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A243WJK5_9BACT  ali  29  4..KIALFGITKEIVGQPELELDAPTVAGLMDQLREKYPALREL---TSFAVAVNSDYAADDYQLHERDEIALIPPVSGG 80
412 5.000e-20UniRef50_D8TFN3 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Tracheophyta TaxID=58023 RepID=D8TFN3_SELML  ali  29  13.VDVLFFARAREIAGVSQMKLELSTTRDCVEELLSRFPGLEEI--KGVLIVALNHEYVCEPSQLKHGDEVALIPPVSGG 91
413 6.000e-20UniRef50_A0A1M7MQC2 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1M7MQC2_9BACI  ali  24  1MIEILLFAQLQEEAGTDNITMDLSTVKKLKEQLQNTYG----FQQIKESMIAVNESYALDDDIIKAGDTVAIIPPVSGG 77
414 6.000e-20UniRef50_A0A2G1YX12 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Robiginitomaculum sp. TaxID=2030823 RepID=A0A2G1YX12_9RHOB  ali  40  1MIKILYFGRLRENVGRREETLDVTTISALKQWLNTEH-ELDGALQDPSVKTMVNQTLVHGDVALSGDEEVGFLPPVGGG 82
415 6.000e-20UniRef50_A0A2E6CE59 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E6CE59_9BACT  ali  32  28.VKLLFFATCRDITGVKAMDYEVATLSELKKQLYVEHPELKPL--EKTLSFAVNTEYVDDAVRLCCGDEVAFIPPVSGG 106
416 6.000e-20UniRef50_W0PDS6 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Alcaligenaceae TaxID=506 RepID=W0PDS6_9BURK  ali  25  7.INVLYFARIAELTGKRTEQLALPAPVTVTAWLAQLHEAYPALADVSVLKVAINKKHAQADTLIQDRDEVAIFEPVTGG 84
417 6.000e-20UniRef50_A0A2E3DCZ9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E3DCZ9_9GAMM  ali  26  3.VHVLFFASIREDLGCSKLLVVLQNPARISDLIREQGPNWLSVLGKESVKVAINKEIVNSDESLVDGDEIAFLPPVTGG 84
418 6.000e-20UniRef50_A0A1M6S7S2 Molybdopterin synthase subunit MoaE /molybdopterin synthase subunit MoaD n=1 Tax=Alicyclobacillus montanus TaxID=1830138 RepID=A0  ali  28  3.IKVLFFARLRELAQTNECWIELPENADVRSELTKIFPQLQQDLHRA--AAALHESYAEDSTLLKDGDEIAWIPPVGGG 81
419 6.000e-20UniRef50_K9NR55 Molybdopterin synthase sulfur carrier subunit n=76 Tax=Proteobacteria TaxID=1224 RepID=K9NR55_9PSED  ali  28  3.VTVKFFARYREALGLDSVKVEGATVDDVRALLAQRDG--AEVLREQNLMCARNEDLCQLDEPVSEGDEVAFFPTVTGG 80
420 6.000e-20UniRef50_A0A0F7R5G7 Molybdopterin synthase sulfur carrier subunit n=455 Tax=Bacteria TaxID=2 RepID=A0A0F7R5G7_BACAN  ali  29  1MIRVLLFANLQEEAGRSELQIEKETVAELKDIVAREY----NVPVTEPIMVAINEEYANEEDTIQSGDVVALIPPVSGG 77
421 6.000e-20UniRef50_A0A1V1PMT5 Uncharacterized protein n=2 Tax=alpha proteobacterium U9-1i TaxID=1605283 RepID=A0A1V1PMT5_9PROT  ali  50  1.MRVLFFGRLGDAAGASEMNAPARTLSELRAALCADNPALALALDQAGVRVAVDHVIVHTDADIANAREIAFMSPLSGG 80
422 7.000e-20UniRef50_U5LIY0 Molybdopterin synthase sulfur carrier subunit n=5 Tax=cellular organisms TaxID=131567 RepID=U5LIY0_9BACI  ali  32  1MNKIKLFAHLRESAGKEEIELDAATINELKAILTEAY-----HLNLETVMTAVNEEFALDHELIKEGDVIAFIPPVSGG 76
423 7.000e-20UniRef50_A0A1M3BLM7 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1M3BLM7_9ACTN  ali  30  3.VTVRLFAMLRERAGSDSVEIELPDRATVDDAFGRLVPELGELVERMPLRMAVNREYASAATPIEPGDELALIPPLSGG 82
424 7.000e-20UniRef50_A0A1X9YSM8 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A1X9YSM8_9BACT  ali  34  3.VHVLAFGIARDIFGGSSADVEVATVQELRAALEAKYPRLKQL---TSFMMAVNNEYATGECVLQQRDEVAVIPPVSGG 80
425 7.000e-20UniRef50_A0A1Z5HB98 Molybdopterin synthase sulfur carrier subunit n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z5HB98_9GAMM  ali  22  5.IKVRYFASLKEKLGRDTDRLDFDRVMSVADVWEKVVPAQK---MPENTLAAVNMEYVALEHQVNDGDEVAFFPPVTGG 79
426 7.000e-20UniRef50_A0A2D9ZSB5 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2D9ZSB5_9CHLR  ali  23  3.IKVLYFASYREQSGKDTETFSLPNKSTLADLVARVLEAIEIKCSPERMVAAVNEEYQTHDQVLLTGDIVALIPPVSGG 81
427 7.000e-20UniRef50_A0A1T4XHU3 Molybdopterin synthase catalytic subunit n=5 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1T4XHU3_9BACT  ali  26  3.VRLLFFSVLRDITGTDEITWAIEPGADVTKLLHALYERWPALREDSSLLVAMDQTYVKRTQPLHENCEVAVMPPVQGG 81
428 7.000e-20UniRef50_L0HKT9 MoaD family protein n=2 Tax=unclassified Euryarchaeota TaxID=33867 RepID=L0HKT9_ACIS0  ali  26  1MIRVRYFATLRDITGRREEFFEVPTIRTLLTLLYKKYGDTFRREIESRNMILVNGKNILDETEISDGDEISIFPPVGGG 84
429 8.000e-20UniRef50_UPI0006D5469D molybdopterin converting factor subunit 1 n=1 Tax=Numidum massiliense TaxID=1522315 RepID=UPI0006D5469D  ali  35  1.MKVQLFAGLAERVGQRELELPVTTVQTVRELIGTHYPNLREAVA--SCMVAVNQEYAADEERVSARDDVVLIPPVSGG 79
430 8.000e-20UniRef50_A0A139CM62 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Methanohalophilus TaxID=2175 RepID=A0A139CM62_9EURY  ali  27  54..KVKLFANVRERAGTSEVEVNGDTVSEILDEIIAKYPNLEELIFEDGISILINGENIQHDSAITDKDEVAIFPPVSGG 140
431 8.000e-20UniRef50_L0E1Q4 Molybdopterin converting factor, subunit 1 n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=L0E1Q4_THIND  ali  28  3.ITVHYFARLREDVGRASDEVPSDGITTVAELWQHLH----RAPPPPRLMAAVNQAHARLDSAVADGDEVAFFPPVTGG 76
432 8.000e-20UniRef50_A0A2E5Z778 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5Z778_9CHLR  ali  28  13.VTVRLFASYRDLAGKSRIELNLDDVGQAIALLVEKLPVLPKNFKPH--LIAVNEEFASFDYKIKDGDEIALYPPVSGG 91
433 8.000e-20UniRef50_V5SCA5 Molybdopterin synthase sulfur carrier subunit n=11 Tax=Rhizobiales TaxID=356 RepID=V5SCA5_9RHIZ  ali  29  16.VTVRYFAWVRERVGRSEEQVTIPTVGEFARWLATRGPEYAEAFKRDVVRAALDQVHVKPSAPLAGAREVAFFPPVTGG 98
434 8.000e-20UniRef50_A0A069D7G3 Molybdopterin synthase sulfur carrier subunit n=41 Tax=Bacillales TaxID=1385 RepID=A0A069D7G3_9BACL  ali  27  5...VLLFAGVAERIGQSKIELNIDTVNDLKKQLAEAYPEASLLIHSS--LIAVNMNYAPGHVVINEGDEIALIPPVSGG 81
435 8.000e-20UniRef50_A0A1F2RSU2 Uncharacterized protein n=7 Tax=Acidobacteria TaxID=57723 RepID=A0A1F2RSU2_9BACT  ali  32  3.VTVLFFGMLKDIVGKAEDGIEGSSIGRLYELYAARFPKLAE--HSSSILFSRNREFAGWGEPLRDGDEVAFLPPVSGG 81
436 8.000e-20UniRef50_A0A2E2V001 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E2V001_9GAMM  ali  24  3.IHVKYFASVRDLMKTDAEDLNIAXSLSVYELWKQL---TVKINAPENILIAVNHKYVGRETKLNDGDEVAYFPPVTGG 77
437 8.000e-20UniRef50_A0A2E5HUB4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Chloroflexi TaxID=167963 RepID=A0A2E5HUB4_9CHLR  ali  26  4.ILVKLFAAYRDKAGISEFSLEIPTVGDLAIEICSKFPEI--TIPPSNIVIAVNSEYQNHSTVLCDGDEVALXPPVSGG 83
438 8.000e-20UniRef50_A0A2E3RFD2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E3RFD2_9PLAN  ali  28  3.VSVQMFAVARDLTGCDSLTMAVPDGANLREQLFARFPALAAV--AGSLQFAVDQEYANDSTPLVPGQEIAIIPPVSGG 81
439 9.000e-20UniRef50_A0A238KT16 Molybdopterin synthase sulfur carrier subunit n=19 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A238KT16_9RHOB  ali  32  1MIDVLYFAWVRERIGLPKEQVEATTVGELVEELKAREERYEAAFADSALRVAVDQDLTDFDAPLAGVREVAFFPPMTGG 82
440 9.000e-20UniRef50_C5A2S5 Molybdopterin synthase, small subunit (MoaD) n=31 Tax=Thermococcaceae TaxID=2259 RepID=C5A2S5_THEGJ  ali  29  3.VTVRYFARYRSLVGKGEEEVELPTVMDLIEKIKEMHPVLRNEVFAEDVNVSRNGRYVRFDETLREGDVVAIFPPVSGG 88
441 9.000e-20UniRef50_A0A2N2MVD5 Molybdopterin synthase sulfur carrier subunit n=4 Tax=root TaxID=1 RepID=A0A2N2MVD5_9CHLR  ali  28  3.IELLLFASMKEKIGKSKIEIEANTVQGLLDVLFLQYPAISP--FAKSILVSVNQEFADRNEIIHARDEVAIFPPVSGG 81
442 1.000e-19UniRef50_A0A2D6K766 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2D6K766_9GAMM  ali  32  3.ITIRLFASLREQLGTECCQAEPDAVSNVEEAWRAV---AGDSPQGENVLVAVNMEYVKPGAAVKDGDEVAFFPPVTGG 77
443 1.000e-19UniRef50_Q9HJF0 MoaD (Involved in molybdopterin synthesis) related protein n=2 Tax=Thermoplasma TaxID=2302 RepID=Q9HJF0_THEAC  ali  24  8.VTVKYFAYYRERVGKDSEKIQLDQGSDLIDMLMARYPG---IFNEKNLFVARNYRYADRGEALSDGDVVAIMPHVSGG 85
444 1.000e-19UniRef50_A0A255XPT5 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A255XPT5_9PROT  ali  24  1.MRVRYFAWLRSRLNRAEEAVAPPTLNGLIDYLATLSPGHAAVFEDRSIRAAINQVFADLDASFAPGDEVAFFPPVTGG 83
445 1.000e-19UniRef50_A0A2V9S256 Uncharacterized protein (Fragment) n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9S256_9BACT  ali  35  58.VRILFFGILKDLAGQGGESLDLPDDATLGDVLEARIPRLKEWVSA--IAMSVNQEYAGPEAKLSQGDEIALLPPVSGG 136
446 1.000e-19UniRef50_A0A151B8V3 Molybdopterin converting factor n=2 Tax=cellular organisms TaxID=131567 RepID=A0A151B8V3_9ARCH  ali  37  6.VRVLYFARLRALLGVGEEVVELPEVSTLLEALKSRHEALRGA---EGIMVAVNAEYASAERGLREGDVVALLPPVSGG 83
447 1.000e-19UniRef50_A0A2V6TG73 Molybdopterin converting factor n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6TG73_9BACT  ali  28  3.VAVRFFARYREAAGRDHIELEVPEGGTVWEAVASRFPVLQP--YRPFTLFALGTDYVQPNHPLRPGDEVCLFPPVSGG 81
448 1.000e-19UniRef50_A0A1X7P2F6 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1X7P2F6_9RHIZ  ali  26  1.MKLIYFAWVRERIGLPEEDVELPTVRDLLLWLRERGEGYEEALRHPAIRVAINQEHSRHDEPIAGAREIALFPPMTGG 83
449 1.000e-19UniRef50_A0A1D8P8I5 Uncharacterized protein n=2 Tax=Lutibacter TaxID=358023 RepID=A0A1D8P8I5_9FLAO  ali  31  5...ILLFGIVSDVIGQRSLKMNVPTIEDLRSQLSEKYPKLANY---KSFSVAVNMEYVDDTYELKNTDTIALIPPVSGG 80
450 1.000e-19UniRef50_A0A151EXF1 Uncharacterized protein n=1 Tax=Theionarchaea archaeon DG-70 TaxID=1803813 RepID=A0A151EXF1_9EURY  ali  28  3.ILIKYFAHYREKTGKKEEYVEGDTVGELVAYLEENY-----KIGTESLMIAVNRRVVTEEKHLSQGDEVAIFPPVSGG 77
451 1.000e-19UniRef50_A0A1F9E821 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_38_15 TaxID=1797857 RepI  ali  26  3.VNVLYFAHLKTITQKKEEKIDLPNQSTLLELLKKKYPHF---LDTPYLSAAINEAYTHFNTSLKEGDTVCFIPPVAGG 80
452 1.000e-19UniRef50_A0A2E5G2C1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Phycisphaeraceae bacterium TaxID=2026777 RepID=A0A2E5G2C1_9BACT  ali  33  4.IHVLLFAQVAVDIGQAELQIELPDNATVDDALAALSERYPSALQGHQLAIAVNADYADIGHKLSPGDELALIPPVSGG 82
453 1.000e-19UniRef50_A0A1F2QVQ8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A1F2QVQ8_9BACT  ali  32  8.VHVRLFASLREAAGRSEAELELPPGATAEDAWRSLGEVPALAARRTGLAAAVNRRYAPFSAALADGDELVFIPPVSGG 86
454 1.000e-19UniRef50_A0A2S8SWG0 Molybdopterin synthase subunit MoaE /molybdopterin synthase subunit MoaD n=2 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=  ali  30  3.IPIQLFASLKDAAKASQIEVEIPSVSQLLEIVARDFPALEKWL--PHCRVAVNLDYTTNDQIVRDGDEVALIPPVSGG 81
455 1.000e-19UniRef50_A0A2A5CXA1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5CXA1_9GAMM  ali  25  3MIKIIFFARLRELLEIEQLDFELKTVKDILESLVEKYSVLAEYLEQDQLMIAVNHLTADLNKEVQSGDELAFFPPVTGG 87
456 1.000e-19UniRef50_M1Z1N5 Putative Molybdopterin synthase sulfur carrier subunit n=1 Tax=Nitrospina gracilis (strain 3/211) TaxID=1266370 RepID=M1Z1N5_NITG3 :_  ali  27  1MVTVKYFANLRQMAGKEEDRFELETLEGLTHMIGKTLPQIGEMVRQKKIMISINYDVVPLDTVVKDGDEIALLPPFSGG 82
457 1.000e-19UniRef50_A0A1P8UV32 Molybdopterin synthase sulfur carrier subunit n=15 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1P8UV32_9RHOB  ali  31  1MIDVLYFAWVRERIGLPKERLDAETVAALVDELRAREERYAMAFSDSALRVAVDQELTDFDAPLAGAREVAFFPPMTGG 82
458 1.000e-19UniRef50_A0A285R496 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A285R496_9SPHN  ali  26  1.MDLLYFAWVREAVGTGSERVDPPSVAALLDWLAARSPGHAAAFADRRLRAAVDQVFVALDAPIADAREVAIFPPVTGG 83
459 1.000e-19UniRef50_A0A2S4DIN3 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Candidatus Entotheonella TaxID=93171 RepID=A0A2S4DIN3_9BACT  ali  28  3.IHVKLFALLREIAGTDSVTLDVPEAGQALDKLIQQHPALQPYL--DKVRLALKMDFVDMTASLEEGDELHLIPPVSGG 81
460 1.000e-19UniRef50_A0A1B1FSI2 Molybdopterin synthase sulfur carrier subunit n=43 Tax=Bacteria TaxID=2 RepID=A0A1B1FSI2_9BACT  ali  30  1.MKILLFGIAKDIIGDSQLEWELTTSEDLLEALKQRYPALTKL---RSIALAVNGEHANGTELIQQTDEIALIPPMSGG 79
461 1.000e-19UniRef50_U9TMR8 Uncharacterized protein n=1 Tax=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) TaxID=747089 RepID=U9TMR8_RHI  ali  23  5.ITILYFATARDATNVSSEKISLPSLKDLTDLLKKRHEKLVPVLETS--LYAINMEYVECDYLVKEGDEVAIIPPVSG. 88
462 1.000e-19UniRef50_D0MIB8 ThiamineS protein n=5 Tax=Rhodothermaceae TaxID=563843 RepID=D0MIB8_RHOM4  ali  32  10..RVLLFSTLRERLGSSELEVFVPTGSRLLDQLAAQYPAIAA--YRPVVRLAVNQEYVPESVELHENDEIALITPVSGG 87
463 1.000e-19UniRef50_A0A117SY44 Uncharacterized protein n=4 Tax=Acidibacillus TaxID=1765682 RepID=A0A117SY44_9BACL  ali  24  3.IHVRLFAAAAEACGKEQIEVTVPSIADVRDAIALSYPMLEEILRRA--WFAVNEEYATHDVIIHENDRIAIIPPVSGG 83
464 1.000e-19UniRef50_A0A0D5Y5C2 Molybdopterin synthase sulfur carrier subunit n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A0D5Y5C2_9PSED  ali  25  4..TVKFFARYREALGVDSLRVEFATVDDVRALLARREG--AEVLSEQNLMCARNEELCQLDEPVSDGDEVAFFPTVTGG 80
465 2.000e-19UniRef50_A0A1F8TTR2 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8TTR2_9CHLR  ali  25  4.ITTLFFATLRDRAGVKSAELQIPTVADFKTMLVGKFPALAGLM--NHTLVSINHEYVFDETIIPDRAEIALFPPVSGG 82
466 2.000e-19UniRef50_A0A2N5DSF0 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2N5DSF0_9CAUL  ali  78  1MARVLLFGRLADQAGWREREVEAESLAALRACLANDDAELAEALAGPGVQVAVDKTLVRGEAVLAAGVEVAFLPPMSGG 79
467 2.000e-19UniRef50_A0A1U9KII9 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Acetobacter aceti TaxID=435 RepID=A0A1U9KII9_ACEAC  ali  32  5.VTVLYFAALREQVGRSSEAVALPDVLTVKDFLRQEDAAFEAVFSQSSVRVAVNKVIGDLSTPIQNGDEIAFFPPMTGG 87
468 2.000e-19UniRef50_A0A2E7MNE7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7MNE7_9BACT  ali  32  38.VRVLFFASSSEIVGCKEAETEIAEGATVKRDLMLQYPDL--LRLKNVLSIAVNTEFADDLRVLKAGDEIAFIPPVSGG 116
469 2.000e-19UniRef50_A0A2E0D1P5 Uncharacterized protein n=6 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2E0D1P5_9CHLR  ali  21  4.IKIKFFAKIKDDIGMSELNVSYEGMKTVKETLELIAEEHNEILNRKNYMYAKNMEYCTLDTKVSDGDEIAIIPPVSGG 82
470 2.000e-19UniRef50_A0A1F8RQT5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium RBG_16_68_14 TaxID=1797660 RepID=A0A1F8RQT5_9CHLR  ali  39  3.VHVRLFAGLQDLLGQRNVTLELADGATLREQLGREYPVISPFL--STLVCAVDEEYVPGDHALRDGDDVALIPPVSGG 81
471 2.000e-19UniRef50_A0A1V5W0Z2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1V5W0Z2_9SPIR  ali  29  1MITVRLFASLRDICEFSEREIQLSDSMSVLSYIVEQFPALKA--KEEYLLVALNEEYCDRNSLLKDGDVVAIFPPVSGG 82
472 2.000e-19UniRef50_UPI000C1D8375 molybdopterin synthase sulfur carrier subunit n=2 Tax=Pentapetalae TaxID=1437201 RepID=UPI000C1D8375  ali  24  27.IKVLFFARARDLTGLTDMPLEVPTADDCLNKLIAKFPSLEEI--RECMVLALNEEYTSKSTVVKDRDELAIIPPISGG 105
473 2.000e-19UniRef50_A0A2G9H280 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2G9H280_9LAMI  ali  25  31.IKVLFFARARDLTGMTDMSLEVSPGATALNELISKFPGLEEI--RNCMVLALNEEYTLESTVVKDRDELAIIPPISGG 109
474 2.000e-19UniRef50_A0A2G3ABB3 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Pentapetalae TaxID=1437201 RepID=A0A2G3ABB3_CAPAN  ali  23  41.IKFLFFARARDLTGMTEMPLEVSTAGDCLNKVISRFPRLEEI--RGCILLARNEEYTAESTTVKDGDELAIIPPISGG 119
475 2.000e-19UniRef50_A0A2D6CVX1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6CVX1_9BACT  ali  24  3.VTVRFFAGCREAVKRDEATLSLPDGATLADLLAEEYPAIAH--YAQRVRYSVNWEYAAADAKLDDGDEVAMIPPVAGG 81
476 2.000e-19UniRef50_A0A0P6Y2D6 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Chloroflexi TaxID=200795 RepID=A0A0P6Y2D6_9CHLR  ali  36  4..RVLLFAHLREAVGHHQLVLYLPEGSDLKQALLDRHPELGSRL--SNVIVAVNQVFSGDEDILEEGAEVALFPPVSGG 81
477 2.000e-19UniRef50_A0A2E0YJC7 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E0YJC7_9RHOB  ali  34  1.MDVLYFAWVRERIGEAKETVEAETVADLVKELSEREPRYAMAFSDSSLRVAVDHELLDFDASLKNAREVAFFPPMTGG 81
478 2.000e-19UniRef50_A0A2D7YHK7 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A2D7YHK7_9GAMM  ali  29  3.ITVKFFSLIREAVETEQLVLELTTVEALKNELGLRGEAWKEALSHPNLIQAVNQRVVFQEEGISDGDEVAFFPPMTGG 84
479 2.000e-19UniRef50_A0A1D7U9N2 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1D7U9N2_9BRAD  ali  25  1.MKISYFSWLRTKTGIPNEEIALPTVDDLVRHLAARYPALAEIAARGSMRFTVNRRYVENSHELASDDEVGLFPPVTGG 83
480 2.000e-19UniRef50_A0A1H1EGU7 Molybdopterin synthase sulfur carrier subunit n=162 Tax=cellular organisms TaxID=131567 RepID=A0A1H1EGU7_9BACI  ali  29  1MIDVLFFAELQEIVGNEKVSVEADTVTELKNNLLSTY----NLDNLSNAMVAVNQEYAQADATLKKGDVVAFIPPVSGG 77
481 2.000e-19UniRef50_A0A0J1INE0 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A0J1INE0_BACCI  ali  29  1MIQLLFFAGVKETIGKEAMELEGQTIAQVKEYLLSAFPSL----SLQGVMVAVNEEFAMDEDTVEENDTIAFIPPVSGG 77
482 2.000e-19UniRef50_M7N9Q7 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteria TaxID=2 RepID=M7N9Q7_9BACL  ali  28  1MINLLYFAGIRDLTGVPEEKAPLATVGELLEWAEEKYPG----IRGGGARVAVNEEYALDGDVLAEGDTAAFIPPVSGG 77
483 2.000e-19UniRef50_Q97B89 Molybdopterin converting factor subunit 1 n=1 Tax=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1  ali  20  13.VRVRYFAYFKEKVGKDEEYFELSPGSNVGTLINEVMKKYKNIFNPKDTLIAVNYKYVDQNYNIAEGDTVAIMPHVSGG 90
484 2.000e-19UniRef50_F8IKK9 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Alicyclobacillus TaxID=29330 RepID=F8IKK9_ALIAT  ali  29  3.VDIRLFANVKELAGQDKLELDVPTVSDVLRALRQAYPALHDAL--DHVMVAVNLELADPSRHVRPTDEIALIPPVGGG 81
485 2.000e-19UniRef50_A0A2R6Y2X0 Molybdenum cofactor biosynthesis protein MoaD n=1 Tax=Candidatus Carbobacillus altaicus TaxID=2163959 RepID=A0A2R6Y2X0_9BACL  ali  29  4.IQVLFFAGLRERFGDRHQVAEGLTVEGLLNRLHETYPDLAPFL--KGTMIAVNEAYAARDTSLHPGDQVAIIPPVSGG 81
486 2.000e-19UniRef50_Q1MYT9 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=Q1MYT9_9GAMM  ali  26  1.MKILFFAQLKEQLGIDSVDVEQTTAKQLLQHLVKENPQWQAFLERDDLMCAVDQVMLSPNQPIANTQEVAFFPPVTGG 85
487 2.000e-19UniRef50_A0A1F2U330 Uncharacterized protein n=3 Tax=Acidobacteria TaxID=57723 RepID=A0A1F2U330_9BACT  ali  32  3.VHVLFFGMLKDIVGRPEERVDGSDIARLYELYTARFPRLAE--HARSILFSRNREFVGRTERLQEGDEVAFLPPVSGG 81
488 2.000e-19UniRef50_A0A2G4YN79 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2G4YN79_9PROT  ali  30  1.MEILYFARLRETIGHSCETRDLPSVADLIDHLTTQGPQYVAAFENDVIRVAVDQAYVGLDHSLEGCREVAFFPPMTGG 83
489 2.000e-19UniRef50_A0A2D9QH65 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A2D9QH65_9GAMM  ali  19  7.IQVVYFAKLRELTGLDQETFSISKGSNPTDLLASINEKHQ-IDIGSNFKIAVNDEFSDWDVKLNDGDRLVFIPPVTGG 83
490 2.000e-19UniRef50_A0A2G6JLM0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2G6JLM0_9BACT  ali  27  6.ITLRYFAAARELAGCDCESWELSSLADLRTELVASHPGLAQL----PFVFAVNEDYAELATLLSDGDEVALIPAISGG 82
491 2.000e-19UniRef50_A0A2P7ECX9 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Synechococcus TaxID=1129 RepID=A0A2P7ECX9_9SYNE  ali  36  9.IKVLLFARLSEQAGWREQNLPISKHSTPEAIWQQL--KLGPGVMPAQVRIAINQQFAALDTPLHPGDELAFMPAISGG 85
492 2.000e-19UniRef50_A0A2E4RZ84 Molybdopterin synthase sulfur carrier subunit n=20 Tax=Hyphomonadaceae TaxID=69657 RepID=A0A2E4RZ84_9RHOB  ali  34  1MADILYFGRLSDVTGKDSEKLDIPDTAALRRWLDEEKSADG-AFLDKSVRLAINNEIVVDPHPVSRSDEIAFMPPVGGG 82
493 3.000e-19UniRef50_A0A200Q9U9 Molybdopterin synthase sulfur carrier subunit n=3 Tax=eudicotyledons TaxID=71240 RepID=A0A200Q9U9_9MAGN  ali  25  583.IKVLFFARARDVTGLTEMMLQVPSGSTAQDCLRSIFTKFPKLEEISQCMVALNEEYTPESAVVKDRDELAIIPPISGG 661
494 3.000e-19UniRef50_A0A2T2XGZ9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Sulfobacillus thermosulfidooxidans TaxID=28034 RepID=A0A2T2XGZ9_SULTH  ali  30  29.IVVRYFALFRDITGTDQDTIEGAPISDLLVRIRDKYPDMGRTKRD--VLVSVNRNFASHELQLKDGDEVAIFPPVSGG 107
495 3.000e-19UniRef50_S6D0T3 Molybdopterin synthase sulfur carrier subunit n=17 Tax=Acetobacter TaxID=434 RepID=S6D0T3_ACEPA  ali  30  5.VNILYFAALREQLGREGQQVILPSVATLVQELRQHDAKLDEVFAAPRIRVAINQKLGGFDTCVKPGDELAFFPPMTGG 87
496 3.000e-19UniRef50_A0A2E6GZD5 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6GZD5_9PROT  ali  21  4..KIKYFAAMREKAGVSEEILE-TNCKDALELLNELDKKYNFNLDRDHLKVAINEEYSSFDSSLKENDTLVFIPPVAGG 79
497 3.000e-19UniRef50_A0A2E1VPD9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E1VPD9_9BACT  ali  42  1.MRVLLFAGLAEACGRRQLELDPASVAELWAEIRKQFPQLDWA----GVRVAVDQQYVDAQHRLRGDEEVALIPPVSGG 76
498 3.000e-19UniRef50_A0A1C2JIY6 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Acidithiobacillus TaxID=119977 RepID=A0A1C2JIY6_ACITH  ali  22  1MIHVKFFASVRERVGSAEMQLACPPGGTVEEVLTMVEGQAMTELHDAHLLASLNQQHVPFTASVKDEDEVAFFPPVTGG 80
499 3.000e-19UniRef50_A0A258DEW1 MoaD/ThiS family protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A258DEW1_CAUVI  ali  83  1MARVLLFGRLADQAGWREREVEALDLSTLRASIARTDPDLAGALVAPGVQVAVDKAIVRGEAALSPASEVAFLPPMSGG 79
500 3.000e-19UniRef50_A0A2E8ED12 Molybdopterin converting factor subunit 1 n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2E8ED12_9ARCH  ali  25  6.VNLKFFASFRLLTGTAGTELEIPTTDDLRELINKKYEG----FNEKTVLYAVNGEYVENNARLNEADTIAFFPPVSGG 82
501 3.000e-19UniRef50_UPI000DC255B3 molybdopterin synthase sulfur carrier subunit n=1 Tax=Acidovorax anthurii TaxID=78229 RepID=UPI000DC255B3  ali  34  21.VTVRYFASIREAVGRGAEALAAATPGALRDELIARGGPWAEALARGRVRVALDQVLCGEDAALAEGAEVAFFPPVTGG 101
502 3.000e-19UniRef50_A0A2E7XJ88 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E7XJ88_9GAMM  ali  31  1MIQVKLFASLRELLGKPEVEIQLEGPLVLSELIKSEGDQWFNILSAENVLVAVNHTMVDHQHLVVGGDEVAFFPPVTGG 85
503 3.000e-19UniRef50_A0A0K9Q3Y8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9Q3Y8_ZOSMR  ali  24  29.VNVLFFARARDLTGKSVVSLKIPSAGSTMERLLCMFPRLQEIC--KSMLLAINEEYADESTLLKHGDELAIIPPLSGG 107
504 3.000e-19UniRef50_A0A167DKM4 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillales TaxID=1385 RepID=A0A167DKM4_9BACL  ali  27  1.MKILLFAHLREEFGASSLSLDLGTVTDLFEELEKRYAN----SSLHQVMVAVNEQFVNRDYLIQADDTVALLPPVSGG 76
505 3.000e-19UniRef50_A0A062V1J4 MoaD family protein n=2 Tax=Candidatus Methanoperedens TaxID=1392997 RepID=A0A062V1J4_9EURY  ali  26  4.IRVRLFANLREYTGTKELELEGNTIKEILEILCKRFPGLRNMLFNGNINVFLNGRDIGLGTPVHSDDEIAIFPPVSGG 90
506 3.000e-19UniRef50_Q2JLJ6 Molybdopterin converting factor, subunit 1 n=28 Tax=Cyanobacteria TaxID=1117 RepID=Q2JLJ6_SYNJB  ali  25  15.ITLKLFAIYQEVIGQTEMCLQVTTVGQLCDQLIQRYPSLAPW--RSQTRFGLNLNFVAADTPLSAGDEVVLIPPVSGG 93
507 3.000e-19UniRef50_A0A2M9TZU2 Molybdopterin synthase sulfur carrier subunit n=7 Tax=Alcaligenaceae TaxID=506 RepID=A0A2M9TZU2_9BURK  ali  25  32.IDILYFARIAELTGKRKEQLPLPESVTVNEWLTQLNARYPALSDVRVLKVAVNKKHVPTDTLIHDRDEVAIFEPVTGG 109
508 3.000e-19UniRef50_A0A2V7EYR7 Molybdenum cofactor biosynthesis protein MoaE n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7EYR7_9BACT  ali  28  94.VRVRLFARYREATGRDRIELDLPEGGTVWSAVAERHPELAR--YRPFTLFAVGNEYVAAEHRLRPDDELCLFPPVSGG 172
509 3.000e-19UniRef50_A0A1F2RN81 Uncharacterized protein n=5 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2RN81_9BACT  ali  28  3.VKVLFFGQLKEIIGKTGEDVNLQDGGGLFDRYASQYPRLME--HSSSLLFSKNREFASRNDALHEGDEIAFLPPVSGG 81
510 3.000e-19UniRef50_F0RB41 ThiamineS protein n=9 Tax=Bacteroidetes TaxID=976 RepID=F0RB41_CELLC  ali  26  1.MKILLFGITKDIIGSSVLDVTNKTVGDLHTYLQEKYPDLRKL---SSLAIAVNNAYAEHNSILNDTDEVALIPPVSGG 81
511 3.000e-19UniRef50_A0A0S2FDP8 Molybdopterin synthase sulfur carrier subunit n=80 Tax=Bacteria TaxID=2 RepID=A0A0S2FDP8_9GAMM  ali  43  5..TVLYFASLRDAAGVASESVE-ADAADLRALYDSLRQRHGFALPVERLRVAVDGAFARWDEAPRAGSEVAFIPPVSGG 80
512 3.000e-19UniRef50_T1LIK6 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Mesangiospermae TaxID=1437183 RepID=T1LIK6_TRIUA  ali  29  29.VKVLFFARARDLTGVAEASVEVPSGSTAGECLGRVFPKLDEI--RRSMVLALNEEYAPESAPVADGDELAIIPPISGG 107
513 3.000e-19UniRef50_A0A2E8NIV6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8NIV6_9GAMM  ali  38  5.VSVLFFASLRDEVGESEVELNVEDLDDLRMQLTDRFGVSTVALFEDNVRIAVNKDVIEGRYDFRGGEEVAFLPPVTGG 83
514 4.000e-19UniRef50_A0A0U4F797 Molybdopterin synthase sulfur carrier subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0U4F797_9BACI  ali  28  1MINVLFFAELQEAAGSEKVDVEADSVNELKTRLKSTF----DLANLDNAMTAVNEEYSNEDTMLKSGDIVAFIPPVSGG 77
515 4.000e-19UniRef50_A0A192WQF7 Uncharacterized protein n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192WQF7_9BACT  ali  42  3.VQVRFFATLTDLTGRREDEVELATVSSLWEELGRRYPALGDLDYRP--MVACDLEYARWESSLEGVREVAFLPPVSGG 81
516 4.000e-19UniRef50_A0A0F3IWS8 Molybdenum cofactor biosynthesis protein MoaD n=1 Tax=Elstera litoralis TaxID=552518 RepID=A0A0F3IWS8_9PROT  ali  26  1.MRVRYFAWLRSRLNRAEDEITPPTLNGLLDHLITLSPGHAAVFEDRSIRAAINQVFADLDSAFAPTDEVAFFPPVTGG 83
517 4.000e-19UniRef50_A0A2A9CEX3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A2A9CEX3_9BACI  ali  28  1MITVLFFAKQQEQLGLEKVERSESPVSELKQKLIEDYPELSLA----HTMTAINEEYAEEDQVINDRDVVAFIPPVSGG 77
518 4.000e-19UniRef50_A0A0G8E6Y7 Molybdopterin synthase sulfur carrier subunit n=149 Tax=Bacteria TaxID=2 RepID=A0A0G8E6Y7_BACCE  ali  30  1MITILLFANLREEVGLDRFVISEKTVQQLKEWLKANY----SLQSLDRVMVAVNEEFVTNEEMIRAGDIVAFIPPVSGG 78
519 4.000e-19UniRef50_UPI0007848498 MoaD/ThiS family protein n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=UPI0007848498  ali  24  31..NVLLFASLKERVGKNQVKVQVTEVSTFLQNLFVQYPELKP--FSHNLLISINQTYASPGQIIHPDDEIALFPPVSGG 108
520 4.000e-19UniRef50_A9B5I6 ThiamineS protein n=1 Tax=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) TaxID=316274 RepID=A9B5I6_HERA2  ali  28  3.ISIRLFAGLREALNQSSLNLDVATVGTALAQLAELHPKL----PLTGLAYAINRQYVTLEATLQPNDELALIPPVSGG 79
521 4.000e-19UniRef50_A0A0S2KD37 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Pseudohongiella TaxID=1524249 RepID=A0A0S2KD37_9GAMM  ali  26  1MLTIQYFASVREQLGRAGEEMALPTVADLIDVLQSRGAPWSLLSDQQQVLVAVDQAVADRGHRLAGNEEIAFFPPMTGG 83
522 4.000e-19UniRef50_D0D0A1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=D0D0A1_9RHOB  ali  31  471MIDVLYFAWVRERIGLPKERVEATTVRELVEELRAREERYEAAFADSALRVAVDQELADFDAPLAGVRELAFFPPMTGG 552
523 4.000e-19UniRef50_A0A0C1Y839 Molybdopterin synthase sulfur carrier subunit n=106 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1Y839_9CYAN  ali  23  7.VTVKLFAVYQEAYKVPELMLELPTVAGVCDRLIAEHPELAQ--FREITRFGVNLQFVEPDTILQDGDEVVLIPPVSGG 85
524 4.000e-19UniRef50_A0A0D9VH52 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Poaceae TaxID=4479 RepID=A0A0D9VH52_9ORYZ  ali  32  55.VKVLFFARARDLTGLAETTLEVAAGSTAGDCLAAEFPKLEEI--RRSMVLALNEEYAPEAAAVGDGDELAIIPPISGG 133
525 4.000e-19UniRef50_A0A0K2SG06 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A0K2SG06_9FIRM  ali  35  3.VRVLYFAAARDAAGRKEEALELPEGATLLDELTRLHPEIGRL--RPALRVAVDESYQAVEYVLRGGEEVALIPPVAGG 81
526 4.000e-19UniRef50_I2EUC0 Molybdopterin synthase sulfur carrier subunit n=47 Tax=Bacteria TaxID=2 RepID=I2EUC0_EMTOG  ali  26  3.IKILCFGITRDIIGQFEYATSLATVADLKQHLSTNFPTFATL---KSLRVAINSEYAEDSAMLKENDEIVLIPPVSGG 80
527 4.000e-19UniRef50_A0A1E2VCE5 Cyclic pyranopterin monophosphate synthase n=17 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E2VCE5_9GAMM  ali  24  189.VHVRFFAELREQLQMEACDVPLPTVAALLNWLVAQASERAALQQQPQLLMAVNQEMVKPMHPLQVGDEVAFFPPVTGG 271
528 4.000e-19UniRef50_UPI000B8482DD MoaD/ThiS family protein n=1 Tax=Pedobacter hartonius TaxID=425514 RepID=UPI000B8482DD  ali  36  35.VEILLFGRLTELLGQSRLQLEMADTNSVSKRLLDQYP----ALQHIRYQIAVNQEIIHGNKPLTDGMTVALMPPFSGG 109
529 5.000e-19UniRef50_Q3AVN8 Molybdopterin synthase subunit MoaD n=10 Tax=Synechococcus TaxID=1129 RepID=Q3AVN8_SYNS9  ali  42  1MLRVLLFASLRDRAGWEERSIPVSTAAQVWDQL--------ELGPLESVCVAVNQELVRSDQPLRAGDELAFLPPFTGG 75
530 5.000e-19UniRef50_A0A1H4CSK4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A1H4CSK4_9BACT  ali  28  3...ILLFGVVKETAGCAVLDCPIKDVATLKRWLYEQYPSLQQL---SSLMIAVNRSYASDDQEFTDRDEIAVIPPVSGG 77
531 5.000e-19UniRef50_A0A1A9HZK3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1A9HZK3_9BACT  ali  25  3.IAVLAFGIVKEIFGAASVHRELHDGATVLELLAASYPALKKL---STCLIAVNNEYAGDDQVIHPDDEIAVIPPVSGG 80
532 5.000e-19UniRef50_A0A1W9Q8C9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Sorangiineae bacterium NIC37A_2 TaxID=1970199 RepID=A0A1W9Q8C9_9DELT  ali  33  3.VRVLFFAGLRDELGIDSLEANAPTVETVIEALDQS----PSSFSERGVRAAVNEEFTTFDHALREGDTVAFIPPVSGG 80
533 5.000e-19UniRef50_A0A0N9X127 Molybdopterin synthase sulfur carrier subunit n=16 Tax=cellular organisms TaxID=131567 RepID=A0A0N9X127_PSEFL  ali  24  3.ITVKFFARYREALGVDAVKVDGATVDDVRVLLAQRDG--ADVLKEQNLMCARNEELCQLDEPLEEGDEVAFFPTVTGG 80
534 5.000e-19UniRef50_A0A2E6VW71 Uncharacterized protein n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VW71_9DELT  ali  29  11.IRLLYFAVIKDLVGKNQEDMVLDGYATVRQLLAEHYPTTEGVLQA--CRVAVNQDFVDLDHALQDDDEVVFIPPVAGG 89
535 5.000e-19UniRef50_J1FCS5 Sulfur transfer protein ThiS n=4 Tax=Bacteroidetes TaxID=976 RepID=J1FCS5_9BACT  ali  30  3.VKVLAFGIAKDIFGSSSTAVELATVEALRTALEMQYPRLKQL---SSFMIAVNDEYAEAGQELAPEDEVAIIPPVSGG 80
536 5.000e-19UniRef50_A0A1Q4R813 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Q4R813_9CYAN  ali  25  7.ISVKLFAIYQETYQQDQLELQLATVKTLADHIFSEHPELQEW--RNVTRYGVNMAFVDENTVLKDGDEIVFIPPVSGG 85
537 6.000e-19UniRef50_A0A2J8AJZ0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AJZ0_9CHLO  ali  35  3.IKVLFFARSREVAGVSEQTFELADGADLLADITSAYPALQSVM--KTCVFALNQEYVRDKEALKEGDEVAIIPPLSGG 83
538 6.000e-19UniRef50_A0A2E6ETE8 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6ETE8_9RICK  ali  31  4..TVRLFAMLRERRGTGSLNVEAKPGESVGALFARLFPANDEDGAIPSVLFAVNREYVLRDYVPEDGDEVAFIPPLAGG 80
539 6.000e-19UniRef50_A0A1H4S6X2 Molybdopterin synthase catalytic subunit/molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1H4S6X2_  ali  37  3.VNVLCFGVLREAIGVSEI-VEVPDLTTVADLLVYFQERSREDLQASRIAVAVNREYVPREHVLLDDDEVALLPPVSGG 81
540 6.000e-19UniRef50_A0A1N6G7S0 Molybdopterin synthase sulfur carrier subunit n=16 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6G7S0_9BACT  ali  36  1.MRVLLFGIMKDIVAAKTLTIELPTVGDLKRWLKQEYPAVQNL---KAVMIAVNKTYAADETILSPEDEIAIIPPLSGG 77
541 6.000e-19UniRef50_UPI00083877FC MoaD/ThiS family protein n=1 Tax=Paenibacillus sp. GM2 TaxID=1622070 RepID=UPI00083877FC  ali  34  1.MKILCFAHLSEQLGTSSMEIELGSAADFIAELKLRYP----ALLLDHVMIAVNEQFVEPTSVIAANDTVALLPPVSGG 76
542 6.000e-19UniRef50_A0A2E8R9J0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E8R9J0_9CHLR  ali  25  13.IEVLFFASYREKAGVKSYFFEISAGSNLKELIVQKFPKLHS--DPTKIVAAINEEFSDQSQILCEGDIVALIPPVSGG 91
543 6.000e-19UniRef50_A0A1G1LE51 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RIFCSPLOWO2_12_FULL_50_11 TaxID=1801834 RepID=A0A1G1LE51_9BACT  ali  28  3.MTIKLFAVLKEIAGQGEIHLEVPSVISCGEVVSRLHEEIPSLVFLEHCLVAVNGKYADDGASVSVEDEVAILPPVSGG 81
544 7.000e-19UniRef50_A9GF37 Molybdopterin converting factor, subunit 1:MoaD n=15 Tax=Sorangiineae TaxID=80812 RepID=A9GF37_SORC5  ali  28  6.VRVLAFAGARDVLGAGEVALPLATAAELLEHVCARYPGLGP--YKGSIRVAVNGVYATPSDPVGFGDEVALIPPVAGG 84
545 7.000e-19UniRef50_B5JMX9 ThiS family, putative n=3 Tax=Bacteria TaxID=2 RepID=B5JMX9_9BACT  ali  23  4..TITYFALLRDQRGLDTETIDSPTPAELYTQLAEQH---SFTLPSSALKVAVNDDFAHWTTPLKDGDTIVFIPPVAGG 79
546 7.000e-19UniRef50_A0A2E5VAZ1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E5VA  ali  22  1MIKVKYFAVFREQSGCDNEEIELESVKQIFEFLADKYNFLDSI---KNCKVAINGNLVDWDSSIKENDTIFFFPPVAGG 80
547 7.000e-19UniRef50_A0A256XZ73 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Archaeoglobales archaeon ex4484_92 TaxID=2012529 RepID=A0A256XZ73_9EURY  ali  37  1MVKVKLFANFREIAGVREVEIDARDVYELLNKLVVEFPKMRELVFREYVNIMVNEDLVRGNKDLSPSDVVAIFPPVSGG 84
548 7.000e-19UniRef50_E1IIL5 Molybdopterin converting factor, subunit 1 n=3 Tax=Bacteria TaxID=2 RepID=E1IIL5_9CHLR  ali  29  1.MQIRFFAGHRDIVGQTSRQLEGTTLAQLWHTLVAEYPQLEP--YTGRLLYAVNQEFAEPERILGEGDEVAFIPPVSGG 79
549 7.000e-19UniRef50_A0A2E9RUY1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Opitutae bacterium TaxID=2026771 RepID=A0A2E9RUY1_9BACT  ali  27  11.VRLRYFAVLRERAGISSEERESTTVEELYDEIKE---EKGLDLEKKFIRIACNGDFVDFNYSLSDGDEVVFIPPVAGG 87
550 7.000e-19UniRef50_A0A2D6H6K4 MoaD/ThiS family protein n=1 Tax=Blastomonas sp. TaxID=1909299 RepID=A0A2D6H6K4_9SPHN  ali  44  27MAKLLFFGRLGDLAGGIERSIEPHSVAALIGVLEAGDRLLGSALLEDRLRYALNGTIVDRDAMVADGDELAFLPPVSGG 108
551 8.000e-19UniRef50_A0A2T0XFG5 Molybdopterin synthase subunit MoaD n=1 Tax=beta proteobacterium MWH-P2sevCIIIb TaxID=323426 RepID=A0A2T0XFG5_9PROT  ali  24  5.ITLLYFAQFRELFGCSQETLDLPTLNDLIQLLCQRGDVWQEQLGDKAFRAAINQDMVEVTATIPAHAEIALFKPVTGG 87
552 8.000e-19UniRef50_A0A2H0LH20 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_9 TaxID=1974749 RepID=A0A2H0LH  ali  30  3.IRVRLFASLRDAADTGECWLELAPGEDAKAALAARYPRLQDLV--EYARLSVNWEYRPWETPLQDGDEIGFLLPVSGG 81
553 8.000e-19UniRef50_A0A166I8C6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A166I8C6_DAUCA  ali  25  527.IKVLFFARARDLTGLTEMSLDVSTTHDCLNKLIAKFPQLDEI--RGCMVLALNEEYTTESATVKDKDELAVIPPISGG 605
554 8.000e-19UniRef50_A0A1B6A5Q2 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacillales TaxID=1385 RepID=A0A1B6A5Q2_9BACI  ali  20  3.IKIKFFAGIAEATRKREHTLHLPTVKDLIHLLTNEFPMAAEMIKRS--MVSINHDYAKPDQNITETDEIALIPPVSGG 81
555 8.000e-19UniRef50_UPI000A02E713 cyclic pyranopterin monophosphate synthase MoaC n=1 Tax=Patulibacter minatonensis TaxID=298163 RepID=UPI000A02E713  ali  30  18.VDVRVFAGLREYAGTSRTTVEVPGGSTARDAVEALWSALGRPDPGRAMVLAVNRDYVADDAVLHDGDELALIPPVSGG 95
556 8.000e-19UniRef50_A0A0Q0XIP6 Uncharacterized protein n=3 Tax=Acidiplasma TaxID=507753 RepID=A0A0Q0XIP6_9EURY  ali  28  3.INVRYFASIRDITGRDEECIEIDDINELKTILFKKYPEL---LDRRQIFFAVNEEYYNG-QRLKDSDNIAVFPQVSGG 78
557 8.000e-19UniRef50_A0A2A2TLG4 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Cyanobacteria TaxID=1117 RepID=A0A2A2TLG4_9CYAN  ali  23  8.ITVKLFAAYQEAYKVPELKLEFPEVQTVQEHLQTQHPELAKW--RNVTRFGINLLFVEPDTILQNGDEVVLIPPVSGG 86
558 8.000e-19UniRef50_A0A0N1LIR5 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N1LIR5_9CAUL  ali  45  1MAVVKLFGAFAETAGWRDAEIDAATLDALRQVLVADHPGLVDRLDHPSTFVVLNGAILPGDRALTPTDEIAFGPPVSGG 84
559 9.000e-19UniRef50_K9PW34 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Cyanobacteria TaxID=1117 RepID=K9PW34_9CYAN  ali  25  1MINVKLFAIYQETYQQEQLTLQLATVGTLADKIFNAHPELEQW--RSVTRYGVNMEFVDENTTLQDGDEVVLIPPVSGG 82
560 9.000e-19UniRef50_A0A1J0GYY1 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A1J0GYY1_VIRHA  ali  28  1MIEVLFFAELREKVDSGKIPMDAASVKELKEMLVAKY----ELKTLDNVMIAVNEEYTTENTILADDDVVAFIPPVSGG 77
561 9.000e-19UniRef50_A0A1Z9II60 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Rhodobacteraceae bacterium TMED160 TaxID=1986860 RepID=A0A1Z9II60_9RHOB  ali  30  1MIDLIYFSWIRERIGKSGESIESSTVFELIEELRQKDTRYFEVFSDGSFRVAVNQELASFDAPLIGAKEIAFFPPMTGG 82
562 9.000e-19UniRef50_A0A2D6LKL1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D6LKL1_9BACT  ali  29  5.IHVHLFATLKQQIGADAVPLELATAGDAVTVLTGKHPELAGLF--KKTALAVNCTYIKSDHVLSDGDELALIPPVSGG 83
563 9.000e-19UniRef50_A0A2K8NA82 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Kyrpidia TaxID=1129704 RepID=A0A2K8NA82_9BACL  ali  32  116.VNVLWFAELADRMNERETVIELPEVRDLRDRVGDQFGHIADLL--DRCMVAINGEYAGPERVLKSGDQVAFIPPVSGG 194
564 9.000e-19UniRef50_A0A2E6G9K0 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2E6G9K0_9GAMM  ali  34  4.VKLKFFGYLSDL---SEEVLSATTPTQIRSKLAIKFPKLASELHSPSLLLAVNKIIVNWDEPLASGDEVAFLPPVTGG 81
565 9.000e-19UniRef50_A0A1Y3QF31 Uncharacterized protein n=1 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3QF31_9FIRM  ali  29  3.VTVRTFAALAERLGQRTLTLELPTVEDVWRRLVAGCPDIER--FERRLLVAVNLKYATWQTSLAEGDEVAFLPPVSGG 81
566 9.000e-19UniRef50_A0A127F672 Molybdenum cofactor guanylyltransferase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A127F672_9GAMM  ali  31  224..RIRYYAVLREQAGCHEETIDAATPAELYAQLARRHP---FKLAPAQLKVALNAEFSDWDTNLRHGDTVVFIPPVAGG 299
567 9.000e-19UniRef50_A0A2N2PXJ1 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-1 TaxID=2013723 RepID=A0A2N2PXJ1_9CHLR  ali  33  7.IRVRAFAVLREALGTAETSITLADVAGLLARLATIYPD--ANLPDRRFSVAVNRAYAPPERVLADGDEVALIPPVGGG 85
568 9.000e-19UniRef50_A0A2E7E8X2 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E7E8X2_9GAMM  ali  34  8.VKILLFARIRDQLGIDSVDIDKPTVAELRLLMQRQFPDHSALFEDGFSLVAVNQEITTGARRLRESDEVAFLPPMTGG 87
569 9.000e-19UniRef50_A0A0D8ZZI9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A0D8ZZI9_9PSED  ali  21  3.ITVKFFARYREAMGVDSLQVDFATVDDVRECVARRDG--AVVLTEQNLMCARNEDLCQLDEPLVDGDEVAFFPTVTGG 80
570 9.000e-19UniRef50_Q7A441 Molybdopterin synthase sulfur carrier subunit n=222 Tax=Bacteria TaxID=2 RepID=MOAD_STAAN  ali  24  1.MKVLYFAEIKDILQKAQEDIVLETVQQFEDLLFERYPQ----INNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG 77
571 9.000e-19UniRef50_D0LRJ1 MoaD family protein n=1 Tax=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) TaxID=502025 RepID=D0LRJ1_HALO1  ali  25  3.IQVRYFAVFRERLGRDEEIIELPEGADVAAALAERHPSVAQL--AGKYQTAVNQSMVPSDTALADGDELVLIPPVAGG 81
572 9.000e-19UniRef50_UPI000DAD3760 MoaD/ThiS family protein n=1 Tax=Phenylobacterium kunshanense TaxID=1445034 RepID=UPI000DAD3760  ali  46  20.VRVLFFGKVSDRLG-RELTLAGCPLSRLRAELCARLPGAAEALAEPGVRAAVAQQMVVGDTAVRPGDEVAFFSPFSGG 101
573 1.000e-18UniRef50_A0A2H3ZBZ6 Molybdopterin synthase sulfur carrier subunit n=9 Tax=Liliopsida TaxID=4447 RepID=A0A2H3ZBZ6_PHODC  ali  28  45.VKVLFFARARELTGLTDISLLMPPRSTARDKLLNKFPKLEEIY--NSMVVALNEEYAPESTVLRNSDELAIIPPISGG 123
574 1.000e-18UniRef50_UPI00068F9AD5 hypothetical protein n=1 Tax=Solirubrobacterales bacterium URHD0059 TaxID=1380390 RepID=UPI00068F9AD5  ali  32  3.VSVRLFAGLRERAGRDELELDLPDGARVADALAQV----QHLAPGVSLVLAVNREYADADMVLSAGDELAVVPPVSGG 76
575 1.000e-18UniRef50_A0A142HVZ9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A142HVZ9_9SPHI  ali  25  3.INILAFGIAREIFGAESIISTLPTTAGLKNQLEAAYPRLKQL---KSYLVAVNNEYAEDGAVITERDEIAIIPPVSGG 80
576 1.000e-18UniRef50_A0A061P1I2 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillales TaxID=1385 RepID=A0A061P1I2_9BACL  ali  22  1MVDVLFFAGMKEKIGQATVDLAGKTVRELKQWVEQTYTLPKGSL--ERTMIAINEEFVEDTDYVQSGDTVAFIPPVSGG 79
577 1.000e-18UniRef50_W1NWL0 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Magnoliophyta TaxID=3398 RepID=W1NWL0_AMBTC  ali  28  32.IKVLFFARARDLTGFTNTVVSVKPGCTTLDELFSKFPSLREI--KDSMALALNKEYAPGNTILNNGDELAIIPPISGG 110
578 1.000e-18UniRef50_UPI0005F84F20 MoaD/ThiS family protein n=1 Tax=Teredinibacter sp. 1162T.S.0a.05 TaxID=1286364 RepID=UPI0005F84F20  ali  28  6.ISLLYFAKLADDLGVTNEQYSISSLGELKLQLSQRGEQWQD-LKAAHIKCALNQTLCDDNTLVKFGDEVAFFPPVTGG 85
579 1.000e-18UniRef50_A0A0F6W942 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Myxococcales TaxID=29 RepID=A0A0F6W942_9DELT  ali  25  3.VTVLYFAGARDLAGRAEERVDVPTVGALAAWIEQRVPALAG--RGGSLRWARNEAFAAMSDAIEEGDVIAIIPPVAGG 82
580 1.000e-18UniRef50_A0A0G3G4T5 Molybdopterin synthase sulfur carrier subunit n=25 Tax=Proteobacteria TaxID=1224 RepID=A0A0G3G4T5_9GAMM  ali  26  3.VSVHYFARLREELGRQGEEVALPTVGELWRHLHQDAP-------PERLMAAVNQEQASLETPVRDGDEVAYFPPVTGG 77
581 1.000e-18UniRef50_A0A2U8FWS9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Aquabacterium olei TaxID=1296669 RepID=A0A2U8FWS9_9BURK  ali  30  1MITIRYFASLREKLGDGDAELGTPTVGGVREALMARSPLHAEALARAGIRVSCDHELCDDAHAVTERAEVAFFPPVTGG 84
582 1.000e-18UniRef50_Q1J1K2 Molybdopterin synthase sulfur carrier subunit n=13 Tax=Deinococcus TaxID=1298 RepID=Q1J1K2_DEIGD  ali  38  3.VNVVFFARLKHETGLEAATIEAPAGATVRELAAQVEQTYG--LSLRGCMVAVNETYAQPEQVLRDGDEVAFLPPVAGG 78
583 1.000e-18UniRef50_A0A2V5UH20 Uncharacterized protein n=10 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5UH20_9BACT  ali  26  32.IRVQFHAQLRDLVGMRELDVDIAEGATVHDLLEKIYPALRP--HNKSILIGVGVEFVDRNYKLKPGEEIAIMPPVQGG 110
584 1.000e-18UniRef50_A4RS06 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A4RS06_OSTLU  ali  29  4.ITVLFFARARELAETSSASVDLPTVATARARLLELYPQLESVLL--TAVFALNQSYVDRDTALKPGDELAVVPPISGG 88
585 1.000e-18UniRef50_UPI0003725711 molybdopterin converting factor subunit 1 n=1 Tax=Thiofilum flexile TaxID=125627 RepID=UPI0003725711  ali  29  3.IKVLFFGSLKEQINKAQVLVDYVEPLTAAQLWQQV---TGKEAIPNTVRVAVNQSYSDASTILHEGDEVAFFPPVTGG 77
586 1.000e-18UniRef50_A0A2U2J082 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Sphingosinicella sp. QZX222 TaxID=2068657 RepID=A0A2U2J082_9SPHN  ali  44  23.MRILFFGRLGEQLG-SELEIDSPTIAELRESLCSRSELFREALGRPGVRACVDQVIVPDDVQLRPGQEVAFIPPLSGG 103
587 1.000e-18UniRef50_A0A2R6BQV5 Uncharacterized protein n=8 Tax=Candidatus Marsarchaeota group 2 TaxID=2203771 RepID=A0A2R6BQV5_9ARCH  ali  32  3.VTVRYFARLREMLGKSSDEFELSTIMDLLNLLSTRYPNLKSAVFENDYQVLVSGQHVEPNRKLHDGDIVAILPPVAGG 91
588 1.000e-18UniRef50_B4X176 Molybdopterin synthase sulfur carrier subunit n=12 Tax=Alcanivorax TaxID=59753 RepID=B4X176_9GAMM  ali  26  1MIEIRFFAALRERVGSDSLTVTPPTVAALVAWLADDNASVAGALEAPRYMVAVNEVLSQEQAAVRDGDVVALFPPVTGG 84
589 1.000e-18UniRef50_U5QLE4 Molybdopterin converting factor, subunit 1 n=2 Tax=Gloeobacter TaxID=33071 RepID=U5QLE4_9CYAN  ali  28  3.IHVRLFASYREAFERDELELEVPTCTQIQTQLAAEQPVLERW--GSVVRYGVNCRFVPPETPLTDGDELVLIPPVSGG 81
590 1.000e-18UniRef50_A0A0D3E8V9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Brassicaceae TaxID=3700 RepID=A0A0D3E8V9_BRAOL  ali  26  91.IKVLLFARARELTGVPDLKLKMPSGSTTKDELVIKFPKLEDV--RSCVVLALNEEYTTDSAIVKHRDELAIIPPISGG 169
591 1.000e-18UniRef50_A8FCP4 Molybdopterin synthase sulfur carrier subunit n=48 Tax=Bacillales TaxID=1385 RepID=A8FCP4_BACP2  ali  36  1MISVLLFAGLADKAGKQQIIIDQTTVDEIKLELQEVYG----VDAAQNVMVAVNERYTRGNAEVRSGDTVAFIPPVSGG 77
592 1.000e-18UniRef50_A0A1B5E742 Molybdopterin synthase sulfur carrier subunit n=256 Tax=Pseudomonadales TaxID=72274 RepID=A0A1B5E742_9PSED  ali  30  3.INVLFFARYAEATGFDSLEMEGATVDAVRLALAA-DPEFA-VLNESSLMCARNEELCGLDEPVQAGDEVAFFPPVTGG 80
593 1.000e-18UniRef50_A0A1Z8NFG3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Synechococcaceae TaxID=1890426 RepID=A0A1Z8NFG3_9SYNE  ali  35  8.IDVLLFAALREQAGWARRTVLLTGSATPLQCWKQL--QLGSEQIPTNIRVAINQRFAAADSSLQAGDELAFLPPISGG 83
594 1.000e-18UniRef50_A0A2E5E832 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5E832_9CHLR  ali  23  9..TVIFFAGLRERAGTRSVQVDVTAGMTVGDAVAARSAAPNDPAPVSSVMLALNGRYVESEHLVQTGDELALIPPVSGG 86
595 1.000e-18UniRef50_Q9RR88 Molybdopterin synthase sulfur carrier subunit n=27 Tax=Deinococcus TaxID=1298 RepID=Q9RR88_DEIRA  ali  32  3.VRAVFFARLRREVGLEELTLDVPDGADVRAV--AEHLEQERGVSLRGCMVAVNETYASPEHLLREGDEVAFLPPVAGG 78
596 1.000e-18UniRef50_A0A161IPM6 Molybdopterin synthase sulfur carrier subunit n=12 Tax=Bacillaceae TaxID=186817 RepID=A0A161IPM6_9BACI  ali  32  1MIHILLFANLAQQAETEKVSIEVNSVEEVRTLLQQKVGKLTGI---ENALVAVNEEYVELTDQVKDGDTVAFIPPVSGG 79
597 1.000e-18UniRef50_A0A267FN92 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267FN92_9PLAT  ali  23  6.VKLRFFAKSKELVGCSEADIALATGASLKDQICTLFPCLAQL--NGCFVLSVNQEYVHPEDSVKSGDELAVIPPISGG 89
598 1.000e-18UniRef50_UPI0009DA96A8 molybdopterin converting factor subunit 1 n=3 Tax=Acetobacter tropicalis TaxID=104102 RepID=UPI0009DA96A8  ali  26  38.VTILYFASLREQLGRERETAEGESVTSLLSALRAQDSALNDLFEQPRIRVAINQALASFQDTVRPGDELAFFPPMTGG 120
599 1.000e-18UniRef50_A0A2E8XDE3 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A2E8XDE3_9BACT  ali  19  1.MKIIYFAKIRELIGKSEEEVSFPTIEDLIVFLKNHNKIYHNVFENYDFLIACDEELVDMNYXINKTKEIAIFPPVTGG 82
600 1.000e-18UniRef50_Q8ZYL1 Molybdenum cofactor biosynthesis protein D/E n=14 Tax=Thermoproteaceae TaxID=2267 RepID=Q8ZYL1_PYRAE  ali  24  3.IHIKYFSALRDITGKTSETIEIPTLGDVINWFFKNYPK--AEVFKEELLVLVNGRSLDWSYELKEGDEVALMPPVSGG 81
601 1.000e-18UniRef50_A0A2X2GRD2 Molybdenum cofactor biosynthesis protein E n=2 Tax=Rhizobium radiobacter TaxID=358 RepID=A0A2X2GRD2_RHIRD  ali  28  2MARIVYFAWVREKIGTDEEELDIPTAGELIAWLATRGENYEAAFEFPNIRVAVNQEHVEHDESIVGAREIGIFPPMTG. 84
602 1.000e-18UniRef50_A0A0U5F120 Molybdopterin synthase sulfur carrier subunit n=30 Tax=Acetobacter TaxID=434 RepID=A0A0U5F120_9PROT  ali  26  4.VTILYFASLREQLGRERETAEGESVTSLLSALRAQDSALNDLFERPRIRVAINQALASFQDTVRPGDELAFFPPMTGG 86
603 1.000e-18UniRef50_A0A0K2GA93 Molybdopterin synthase catalytic subunit (Modular protein) n=12 Tax=Nitrospirae TaxID=40117 RepID=A0A0K2GA93_NITMO  ali  31  29MVTVKLFGMTKSLAGQGSLSIPMTNVKDLVQLLDGSYPQIGELIHKKKVLVSVNQDIAHEETEIKDGDEIALLPPFAGG 111
604 1.000e-18UniRef50_A0A0G4FA34 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4FA34_9ALVE  ali  30  10.VKVLLFAGCRDKVGKEAIEVAVKTASHLKEQMVSQFPQLKEAVSTS--LFAVNQDFAEESTEISEKDEVALIPPISGG 93
605 1.000e-18UniRef50_A0A090YZT4 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A090YZT4_BACMY  ali  23  1MIEVLLFAHLQEEISKPALQIDCETVAELKDILVKEY----NVAISNQIMIAVNEEYANEDDIIQTGDVVAMIPPVSGG 77
606 1.000e-18UniRef50_A0A1X1QMT6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Cycloclasticus TaxID=34067 RepID=A0A1X1QMT6_9GAMM  ali  21  3.IKVLYFASLKELFGHADEQVNLDTVGDVWTFVSNGNG------VSQQVLFSLNQEYADADALVKNGDEVAFFPPVTGG 77
607 1.000e-18UniRef50_A0A157RMA3 Molybdopterin synthase sulfur carrier subunit n=32 Tax=Alcaligenaceae TaxID=506 RepID=A0A157RMA3_9BORD  ali  32  6.IELLYFARVAEMLGRRGETLPLPEPADLRAALTARYPQLQGV---ARLRIAINQTHVKGDAPLAAGDEVAVFEPVTGG 83
608 2.000e-18UniRef50_A0A1M4Y7A6 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Ferrithrix thermotolerans DSM 19514 TaxID=1121881 RepID=A0A1M4Y7A6_9ACTN :_  ali  32  3.VKVLFFARAKEIAGKAETESDAATIDLLLKELVTTYPELESLLSVS--RLWVNDEPADVNQPLRSGDQVAILPPVSGG 79
609 2.000e-18UniRef50_A0A2A4NUV4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A4NUV4_9BACT  ali  36  3.IKVLLFAGLRDAAGGDSIELAVATVAELRTALRVEFPELA----TQVFKVAVDHCYAADGQALATGCEIALIPPVSGG 78
610 2.000e-18UniRef50_A0A2E5UJA8 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E5UJA8_9BACT  ali  26  3.IHTLFFASYRESIGSRGLDVTLATVADLIAELRSRGNEF--TCLRETVVIAVNKVYMEAGTVLTDGDEVAFIPPVAGG 81
611 2.000e-18UniRef50_A0A2D7TD76 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7TD76_9PROT  ali  25  1MV-IKYFSWIKEHIGKSEEQIILPSINQLINYLNEMDEKYKLLYEKKEIKIAVNKTYSSFDTNISNSDEIAFFPPVTGG 83
612 2.000e-18UniRef50_A0A1M6J9V8 Probable molybdenum cofactor guanylyltransferase n=4 Tax=Rubritalea TaxID=361050 RepID=A0A1M6J9V8_9BACT  ali  20  195.IELRYFAQLKEITGTDSEQTESVTPSGLYEELKAKY---HFPHKQKQLMLAINGDFADWATPLQEGDEVVFIPPVAGG 271
613 2.000e-18UniRef50_A0A2D9Y1B9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Aquimarina sp. TaxID=1872586 RepID=A0A2D9Y1B9_9FLAO  ali  31  6.IKTLYFGRLAEITNKNEEMLEVASDQTVKELLHSISQNYKG-LEKLSFKIALNQKIVEQDEPITNATEIALLPPFSGG 82
614 2.000e-18UniRef50_A0A1W7A8J6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Macrococcus canis TaxID=1855823 RepID=A0A1W7A8J6_9STAP  ali  28  20MMKVLYFAHIKAKLDRTEDQFTFATVQQFRNHLYETYP----IIQSEKFQIAVNEEFVRDEDIINNQDTVALIPPVSGG 97
615 2.000e-18UniRef50_A0A2S5A2F1 Molybdopterin synthase sulfur carrier subunit n=38 Tax=Bacteroidetes TaxID=976 RepID=A0A2S5A2F1_9SPHI  ali  30  4..HILLFGATKDIIGSSIYSISFKTVGELREHLYKQFPSLEKL---NSLMIAVNMNYAEDLLELKAGDEIALIPPVSGG 79
616 2.000e-18UniRef50_A0A2P1PTU5 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PTU5_9GAMM  ali  29  1MIHVRYFASFAEATGRDAETIDHQDGAALFATLSARF---QFRMPMARVRLAVNDHFVDWTHRLQDGDHVVFIPPVSGG 80
617 2.000e-18UniRef50_A0A1F2Y0Q8 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1F2Y0Q8_9ACTN  ali  34  4..NVRLFAALRERAGAAKLEVELADGATVGDVW----PLLDLGDEPAGILYAVNRAYAERTEGLAEGDEVAVIPPVSGG 76
618 2.000e-18UniRef50_A0A142XTK8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Gemmata TaxID=113 RepID=A0A142XTK8_9BACT  ali  32  4..TVKLFAAMRDLAGSDTVEVELPTVGDLRREIAKQIPLARTLLLRSN--IAVNHEAAENEQPLQTADEVAVIPPVSGG 81
619 2.000e-18UniRef50_A0A2A5AWN6 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5AWN6_9FLAO  ali  32  1.MKLKYFGMTAEASGKDEELLDYSSVKELKADLLAKYPNLLEI----NFKVAVNQEIVNDDYKLSGNEEIALLPPFAGG 76
620 2.000e-18UniRef50_A0A2E8CUL9 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E8CUL9_9BACT  ali  24  1MVRVIFFSVLRELTGVEEAEISMTQVSDILQQVYHDYPRIESW--NTKLLIAINGEFADRSDLLGDGDELALMPPVQGG 81
621 2.000e-18UniRef50_A0A024UMH1 Molybdopterin synthase sulfur carrier subunit n=11 Tax=cellular organisms TaxID=131567 RepID=A0A024UMH1_9STRA  ali  29  5.VKVLYFAAAREMVGRREESLELQTTETLRRILCEKYPRAAQYLKD--ITIAINLEYVAEGDVIAHGDEVALIPPISGG 90
622 2.000e-18UniRef50_A0A251W8I0 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Alkalinema sp. CACIAM 70d TaxID=1934309 RepID=A0A251W8I0_9CYAN  ali  23  4.ITIKLFAVYQEAYGCADLHWQLPTVGELFDRILAEHPQLEAW--RNLTQFGVNLAFVSPETLLQDGDEVVLIPPVSGG 82
623 2.000e-18UniRef50_A5GWZ1 Molybdopterin converting factor subunit 1 n=3 Tax=Synechococcus TaxID=1129 RepID=A5GWZ1_SYNR3  ali  30  8.ITVRLFAALREQAGWDQRSWPLTSGANALSVWQALG--FGDAIPDGT-RVAINQEFESPRQQLQQGDELAFLPPISGG 82
624 2.000e-18UniRef50_A0A2W5XSV9 Uncharacterized protein n=1 Tax=candidate division WPS-2 bacterium TaxID=2052317 RepID=A0A2W5XSV9_9BACT  ali  25  86.VHVRFFASHREAIGRDRVDLQLATAADAYASICRQFPSMRP--EHAGIAFAVNQQHVKPAAVLKNGDELAILPPVAGG 164
625 2.000e-18UniRef50_A0A2W1B618 Molybdopterin synthase catalytic subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1B618_9CHLR  ali  24  1MITVKTFAALREIIGSASVAIDVSSDASVRDVIKAVSERYGIGIIASQIIIAVNMEYVSFDHPVHESDEVALIPPVSGG 81
626 2.000e-18UniRef50_B3QZC4 MoaD family protein n=2 Tax=FCB group TaxID=1783270 RepID=B3QZC4_CHLT3  ali  26  7.VTVRCFSLVSDALGKSAFELDLPHGATAKLVLEKVRERMPAELNALPIRIAVNQEYILGDAELQHQDEVALIPPVSGG 84
627 2.000e-18UniRef50_A0A2A4TVJ7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TVJ7_9BACT  ali  25  3.VTVLFFASAREAIGMSETTITISSGASIEVLIASEFEPLTALL--SSMRFALNEEFSRRDAVLNDGDVVAVLPPVSGG 79
628 2.000e-18UniRef50_A0A132N3F7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Streptomyces thermoautotrophicus TaxID=1469144 RepID=A0A132N3F7_9ACTN  ali  34  3.ISVLYFGVLREQLAKTAETIVLPDGSTLLDTLRERYPSLDRV--KHMIKVAVNEDLASMEHVLREGDEVALLPPIAGG 81
629 2.000e-18UniRef50_A0A1F6LLK0 Uncharacterized protein n=1 Tax=Candidatus Lindowbacteria bacterium RIFCSPLOWO2_12_FULL_62_27 TaxID=1817870 RepID=A0A1F6LLK0_9BAC  ali  30  3.IKVLLFAAARDIAGQTEICMDLPTLTDVQTRLKTEYPALSQLLA--VCRYAVNADYQPSDVRLPDGAEVGVIPPVSGG 81
630 2.000e-18UniRef50_M4F9Z1 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Brassiceae TaxID=981071 RepID=M4F9Z1_BRARP  ali  28  25.IKVLLFARARELTGVPDLTLKMPSGSTTKDELVIKFPKLEEV--RSCVVLALNEEYTTDSAIVKHRDELAIIPPISGG 103
631 2.000e-18UniRef50_A0A2D7C315 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7C315_9PROT  ali  25  1.MKVLYFSWIREILGKREETIDIPTVMQLLDWQRNRGNDYAIVFERSEVRIAIDLQHVKNDTHLKNPKEIAFFPPVTGG 86
632 2.000e-18UniRef50_A0A0E3UIW8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Verrucomicrobia bacterium IMCC26134 TaxID=1637999 RepID=A0A0E3UIW8_9BACT :_  ali  20  1.MTVLYFAQTRRLAGLASETLALSSAEALWNEILARHPALAPL--RSVTRLARNGEFTTVDTVFAPGDEIALIPPVSGG 79
633 2.000e-18UniRef50_A0A2X1BXB3 Molybdopterin converting factor subunit 1 n=1 Tax=Brucella melitensis TaxID=29459 RepID=A0A2X1BXB3_BRUML  ali  23  3.VKLVYFAWVREKIGKGEEFIELPSVGELIARLKARGEEYDAAFEHETLFAPPSIRNTRDNELVKDGDEVALFPPMTGG 84
634 2.000e-18UniRef50_A0A2W5TD15 Molybdopterin converting factor subunit 1 n=1 Tax=Archangium gephyra TaxID=48 RepID=A0A2W5TD15_9DELT  ali  28  3.VTVRLFAAARERAGVGSVDVELATGASVKQLLVAVKPALASLV--PHLRVAVNQEFAGVESIVEEGAEVALIPPVAGG 81
635 2.000e-18UniRef50_A0A172YEF7 Cyclic pyranopterin monophosphate synthase n=39 Tax=root TaxID=1 RepID=A0A172YEF7_9GAMM  ali  28  192.VQVRFFAELRERLQCDSLSVDTPTIIALKQALIARDSRFA-ALDEPRVLCALNRRMSKFDASLSPGDEVAFFPPVTGG 273
636 2.000e-18UniRef50_A0A212RK95 Molybdopterin synthase catalytic subunit n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A212RK95_9CHLR  ali  30  5.VQVRLFATLKDRAGREVITVRLPDGASVADLLRAVYPSLQPYL--PSTVVAINHEFAFPEDDVRPGDEVALFPPVSGG 83
637 2.000e-18UniRef50_A0A1Z8MUQ8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Planctomycetaceae bacterium TMED10 TaxID=1986833 RepID=A0A1Z8MUQ8_9PLAN  ali  34  29.ISVQLFAVARDLAGCDSVTLAVPDGATLREKLFAHVPALAPL--TGSLQIAVDQEYAIDTTPLTAHQEVAIIPPVSGG 107
638 2.000e-18UniRef50_A0A2E9WQM7 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Parcubacteria group bacterium TaxID=2026774 RepID=A0A2E9WQM7_9BACT  ali  33  4..KVLFFGILEDIVGSKELIIESNSSDELLKNIKKQYPELE----NKTFQIAVNQQIINTNTTLNDGDEIALLPPFAGG 77
639 2.000e-18UniRef50_A0A2K9MIL4 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2K9MIL4_9RHOB  ali  34  1.MDVLYFAWIRERIGSAKERVEAPTIRDLVAELVAGNERHAAALSDSAVRVAADQEMVDLDHPLSDVREVAFFPPMTGG 81
640 2.000e-18UniRef50_A0A2E7ETW4 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7ETW4_9PLAN  ali  26  3.IEVRLFAVARQLANQETIAVSCPTIADLKQAIIEQLPELATIL--DHVRFAVNSDYADEKTQLSSTDEVACIPPVSGG 81
641 2.000e-18UniRef50_B6SXF8 Molybdopterin synthase sulfur carrier subunit n=86 Tax=Magnoliophyta TaxID=3398 RepID=MOC2A_MAIZE  ali  30  15.VKVLFFARARDLTGVADSAVEVPPGSTAGECLAAQFPKLEEI--RGSVVLALNEEYAADSAAVADGDELAVIPPISGG 93
642 2.000e-18UniRef50_Q12W49 Molybdopterin synthase small subunit n=34 Tax=Methanosarcinales TaxID=94695 RepID=Q12W49_METBU  ali  24  22.VKIKLFANLREIAGVSELELEGENIQEILDILQNDHPQIQELIYDDLINGNNIQHLEGSDTVLNEGDEIAIFPPVSGG 112
643 2.000e-18UniRef50_A0A239MA21 Molybdopterin synthase subunit MoaD n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239MA21_9BACT  ali  34  1MIVVKAFGHVKEVLG-SELEVELIDVKSLRDYLGNEYP----TIVWSTVAIAVNKKYVQDPDPISPGDEIALIPPVSGG 76
644 2.000e-18UniRef50_A0A2D5U691 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Porticoccaceae bacterium TaxID=2026782 RepID=A0A2D5U691_9GAMM  ali  43  1MIKLLFFGRLGDFAGDVAPQIEATEGLTVRESLAADYPALAAELSQPQVLVSLDQRIARWDQVISDGAELAFLPPVTGG 82
645 2.000e-18UniRef50_A4A3E1 Molybdopterin synthase subunit MoaD n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A4A3E1_9GAMM  ali  39  1.MKILFFARLKEQLGKEWVEIPPADVGALRQKLQLVNAELAESLEDPNVFCAVNQKVVGEKHRLASSDEVAFFPPMTGG 83
646 2.000e-18UniRef50_Q54NM8 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Dictyostelids TaxID=33083 RepID=MOC2A_DICDI  ali  23  6..KILLFAKVKEVIGKDSIFIDLPTSFNLIRKLKHIYPQISSTLEVS--LLAVNQEYISRDQKINSNDEIAIIPPVSGG 86
647 2.000e-18UniRef50_UPI000D78A334 molybdopterin synthase sulfur carrier subunit n=1 Tax=Glaciecola sp. KUL10 TaxID=2161813 RepID=UPI000D78A334  ali  29  1MVKVLFFAQVREKLQRDSYDLEALSINELIKVLVNNDDAF-EYLKEPHLFVAVNQTLCSRDQTVNDLDEVAFFPAVTGG 81
648 2.000e-18UniRef50_A0A2E7UJ15 Uncharacterized protein (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E7UJ15_9ACTN  ali  28  1.MKIKLFAQLKDDFGSSTLDLKPCNVSKIREILRSEF-----NLETENCMCAVNMKYVRDDIFVSDQDEIAFIPPVSGG 76
649 2.000e-18UniRef50_A0A0P1MMF8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A0P1MMF8_9BACT  ali  33  1.MKVLFFGRLKESIGLDQVEVQGVSVNELKRYLNENFPILGKEI----FAIAVNYKIINDDASLKEEDEVALIPPIAGG 75
650 2.000e-18UniRef50_UPI000C1CB8D8 MoaD/ThiS family protein n=1 Tax=Chryseobacterium camelliae TaxID=1265445 RepID=UPI000C1CB8D8  ali  38  3.IRIIAFGQIAEITGT-EILTDAPDISALRKELKERFPE----LEHKKFAVAVNKKITEENLALQEGDTVALMPPYSGG 75
651 3.000e-18UniRef50_A0A2E9DAL1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9DAL1_9CHLR  ali  24  3.INILLFANLREIAKQSSLQLDVSEVSDVIDIVKKEIPDIAPYF--ESIMIAVNMTYVENSYKLNNNDEMALIPPASGG 81
652 3.000e-18UniRef50_A0A257WGS7 Uncharacterized protein n=1 Tax=Planctomycetales bacterium 12-60-4 TaxID=1970541 RepID=A0A257WGS7_9BACT  ali  41  47.IHVRLFARAKDLAGTDRCELPATTLGDLRALLLQCFPDL--IPLGPRLLAAVDTDYAADSLPLKSGVEVAFFPPVSGG 126
653 3.000e-18UniRef50_Q9S7A3 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Brassicales TaxID=3699 RepID=MOC2A_ARATH  ali  28  18.IKVLLFARARELTGVPDLTLKMPSGSTCLDELVLKFPSLEEV--RSCVVLALNEEYTTDSAIVQHRDELAIIPPISGG 96
654 3.000e-18UniRef50_A0A1B1L9H1 Molybdopterin synthase sulfur carrier subunit n=174 Tax=Bacilli TaxID=91061 RepID=A0A1B1L9H1_BACTU  ali  29  1MITILLFANLREEVGSDRLVISEKTVQQLKEWLKVSY----CLQSLDKVMVAVNEEFVMNEEMIKAGDIVALIPPVSGG 78
655 3.000e-18UniRef50_A0A1C0V3L3 5-formyltetrahydrofolate cyclo-ligase n=2 Tax=Limnothrix TaxID=132605 RepID=A0A1C0V3L3_9CYAN  ali  21  200.ITIKLFAVYQETFGKSELIWELPTAGEVCDLMIQKHPNLGHW--RNMTRFGINFQFVPDSTLLRDGDELVLIPPVSGG 278
656 3.000e-18UniRef50_A0A1G1K3N4 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RIFCSPLOWO2_01_FULL_45_10b TaxID=1801827 RepID=A0A1G1K3N4_9BACT  ali  29  1MIKVLFFAQLKDAFGVGERTMEAREGTTVSEFIQSLFEETAARLKGLPMLYSINEDFVDENQALRDKDTLALLPPVAGG 80
657 3.000e-18UniRef50_A0A218ZW40 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon B_DKE TaxID=1961136 RepID=A0A218ZW40_9EURY  ali  31  4..KVKYFARFRELAGKGEEDFEVGDVLDLKKMILNDHPLL--LSYESSMIVARNDNFARDEEYLRAGDEIDFFPPVSGG 81
658 3.000e-18UniRef50_A0A0Q7YZW4 Molybdopterin synthase sulfur carrier subunit n=60 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0Q7YZW4_9RHIZ  ali  21  3.VKLVYFAWVRERIDKPEEEIDIPTGRDLLNHLKTLGEEYEAALQPEVIRLAINQEHVDHDEPITGAREIGIFPPMTGG 85
659 3.000e-18UniRef50_A0A2E6ACA3 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E6ACA3_9GAMM  ali  24  3.IYVKYFASIRDIMGTECANLDIEESISVDELWQGL---IVGKETPQKVLVAVNYEYVNMNYKLKEGDEVAFFPPVTGG 77
660 3.000e-18UniRef50_A0A164CHG7 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Synechococcus TaxID=1129 RepID=A0A164CHG7_9SYNE  ali  35  12.VKVLLFASLRDQAGWSDISLHGPAVQTAREIW----DQLELGDLPQVVLVAINHHIVSADHPVKAGDELAFLPPFTGG 87
661 3.000e-18UniRef50_G4CQT5 Molybdenum cofactor biosynthesis protein small subunit n=17 Tax=Proteobacteria TaxID=1224 RepID=G4CQT5_9NEIS  ali  27  1MISILYFGVLKQRLQTEHETIEWPNGNDLLKLLRARGEEWNDALAEDKIRIVINKQISPWSAEIPDGAEVGLLPPVTGG 82
662 3.000e-18UniRef50_A0A2H6AQB2 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6AQB2_9BACT  ali  25  6.VRVKVFASIRDALGEGEFVLSLPSVESLIKYLKAKYPQIADILDCS--FIALNEEYALREASLRGGDTLAIIPPVSGG 84
663 3.000e-18UniRef50_A0A2G2JCC3 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Oceanobacter sp. TaxID=2030817 RepID=A0A2G2JCC3_9GAMM  ali  25  3.IRVLFFAKIKESLGVNFIDLKLTTIEEIRNSLFCEFIENKSLFLPKNSLVAVNQEIITENIMINQNDEVAFFPPVTGG 83
664 3.000e-18UniRef50_A0A2D9SPR8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D9SPR8_9GAMM  ali  26  1MIKVVFFASLRERFQSTGLTVEXDQIAXVAALIXVLGTPFGSIFAEQKLMVAVNQEVVDVDGAITEGDEVAFFPPVTGG 83
665 3.000e-18UniRef50_F8EIB4 ThiamineS protein n=7 Tax=Bacteroidetes TaxID=976 RepID=F8EIB4_RUNSL  ali  24  4..TILSFGIAKEIIGQLELSVQLPTVADLKQFLSAEFTDFQKL---ASLRVAVNTEYADDSARLHPNDEIVLIPPVSGG 80
666 3.000e-18UniRef50_A0YDA7 Molybdopterin converting factor subunit 1 n=1 Tax=marine gamma proteobacterium HTCC2143 TaxID=247633 RepID=A0YDA7_9GAMM  ali  22  1MVQVMFFSLIRERLDTDKLSLSLPTLLAFTEHLIDTHDAWREVLTSANIIKSVNQRVVDNDCCLSDGDEIAFFPPVTGG 84
667 3.000e-18UniRef50_A0A0C2HDE1 Molybdopterin synthase sulfur carrier subunit n=6 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0C2HDE1_9STAP  ali  25  1.MKVMLFAGLKEKIGQSRIILDGPTAGELKQAIYTQFPSLEG----DVFQVACNESFVKDDQVIDEDDEVALIPPVSGG 77
668 3.000e-18UniRef50_A0A0A3IV83 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacillales TaxID=1385 RepID=A0A0A3IV83_9BACI  ali  28  1MIKLLFFAQLQEEIGHHSFEIEDATVQQLKEYVLKEYP----MVNLQHAMVAINEQFSSDKDLVHDGDIVAFLPPVSGG 77
669 3.000e-18UniRef50_A0A067Z1W8 Molybdenum cofactor guanylyltransferase n=33 Tax=Proteobacteria TaxID=1224 RepID=A0A067Z1W8_GLUOY  ali  24  200MITLEYFAQLRELAGTREQSLEFATVGPLYEELREKY---AFPFEASKLRVAINGDFAPWTQTLKDGDHIVFIPPVTGG 279
670 3.000e-18UniRef50_A0A2E9UPS7 D-inositol-3-phosphate glycosyltransferase n=29 Tax=Actinobacteria TaxID=201174 RepID=A0A2E9UPS7_9ACTN  ali  32  1MATLRLFASIREIAGTSEITFEAGTVEELISEAIKNFGK-DFASLVPNCRIWVNGNPANMEDAVTSADEVALLPPVSGG 78
671 3.000e-18UniRef50_A0A081SHI3 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Chlorobiales TaxID=191411 RepID=A0A081SHI3_9BACT  ali  23  3.ITVKFFAVGREIVGSDALVLTLPDGATLLWYLKETYPQFQTL---KSLLIAVNEDYAEPHLPLAETDDVAVIPPVSGG 80
672 3.000e-18UniRef50_A0A2D6BTZ5 Molybdenum cofactor biosynthesis protein MoaE n=7 Tax=Bacteria TaxID=2 RepID=A0A2D6BTZ5_9DELT  ali  39  5...VKLFGSIREATGAEELAVPLADVSALRSLLVEQEPAFALAHGEERLRVSVNMEIVTGDPPLSDGDEVAFLPPVAGG 85
673 3.000e-18UniRef50_A0A1F9ZKG9 Molybdopterin converting factor subunit 1 n=4 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A1F9ZKG9_9EURY  ali  29  5.VHVKLFSSFREIVGAKEEDLQLDDGATLLEHYIAKFPQMGK--FREHIILSVNKEYGAPTKVLKAGDEVSFLPPVSGG 83
674 3.000e-18UniRef50_A0A2D6PVT4 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PVT4_9BACT  ali  37  9.IRVLLFGLLAEAAGATEAILDLPPGSRVADLLVARFDGLARSL--ESVAYAVNTSYVVPGHVLSDGDEVALIPPVSGG 87
675 3.000e-18UniRef50_F4KRQ5 ThiamineS protein n=5 Tax=Bacteroidetes TaxID=976 RepID=F4KRQ5_HALH1  ali  26  3.IKILAFGITRDILGGSSLEMQIPGVADLRATLYAQYPALQKL---STLAIALNTEYASDEELIGEKDEVVLIPPVSGG 80
676 3.000e-18UniRef50_A0A2E2YRL1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E2YRL1_9GAMM  ali  34  3.VTVKFFASLRDVTGFEEIEFKGASLADLIVSLKKAHEAFVE-ITAKNVKVALNQELIDDSVTISDGDEVAFLPPVTGG 83
677 3.000e-18UniRef50_A0A2S7K320 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Marinicaulis flavus TaxID=2058213 RepID=A0A2S7K320_9PROT  ali  44  1MARLLFFGKLADAAGARARQVETRTIDDLVAVLGDEDAALGASLNEKSVRFIVNETLASRDAAIGDKDEIAFLPPVSGG 83
678 3.000e-18UniRef50_A0A293NIM0 Molybdopterin converting factor subunit 1 n=1 Tax=Porticoccaceae bacterium TaxID=2026782 RepID=A0A293NIM0_9GAMM  ali  41  4.IKLLFFGRLSDFSGVPD-TISAATPREILELLQQDFPILAAELRDPHVLIAVNKTIGDWDSELTNGCEVAFLPPVTGG 81
679 3.000e-18UniRef50_A0A1T4ZXR0 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1T4ZXR0_9SPHI  ali  34  3.VKVLIFGQLTDITGVSELQLDVSDRDELITALNRQYPGLADS----KYAIAVNKQVINENIGLTDNSTVALLPPFSGG 77
680 3.000e-18UniRef50_F4C4A9 ThiamineS protein n=4 Tax=Bacteroidetes TaxID=976 RepID=F4C4A9_SPHS2  ali  37  3.ISILFFGQLTDITGCSQLKMDVEDTDQLNAVLTDQYPLLTQT----KYVIAINKKIIRTKVALSQEVEVALLPPFSGG 77
681 3.000e-18UniRef50_UPI000D558C10 MoaD/ThiS family protein n=1 Tax=Phyllobacteriaceae bacterium Water-Bin73 TaxID=2015206 RepID=UPI000D558C10  ali  37  1.MRICFYGRLADLLGSRSLDDAPTDGAALRDWLIQNHQQLSEGLTHPGTRLVLDNEITDWDAPLSGAHDIAIIPIVSGG 81
682 4.000e-18UniRef50_L7N6B4 Molybdopterin synthase sulfur carrier subunit n=30 Tax=Terrabacteria group TaxID=1783272 RepID=MOAD_MYCTU  ali  32  1MIKVLYFGAVREACDTPREEVEVTDVGNLVDQLQQKYPRLRDHCQR--VQMAVNQFIAPLSTVLGDGDEVAFIPQVAGG 83
683 4.000e-18UniRef50_A0A2E7VUF3 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7VUF3_9CHLR  ali  26  5...VKFFGQHKEELNKSEIEIELKTLDNLIQILKNKEPKFAKF---DSYAIAVNLNYENLNYTIEDGDEIAIIPPVSGG 80
684 4.000e-18UniRef50_A0A1G6EAQ6 Molybdopterin synthase catalytic subunit/molybdopterin synthase sulfur carrier subunit n=1 Tax=Flavobacteriaceae bacterium MAR_20  ali  23  1.MKVLFFGISKDIVGQRELSHNNETVESILERLKADYPDLSKI---SSLAISVNQKYADITTIVKKNDVIALIPPVSGG 79
685 4.000e-18UniRef50_A0A1Q7SQG5 Molybdopterin converting factor subunit 1 n=2 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A1Q7SQG5_9ARCH  ali  27  1MIRVKYFAQAREAAGTKSEEFSLSSVETALSKAFETHPKLRP--FEKSIKVALNEEITQNDAKLQEGDRVALLPPVVGG 82
686 4.000e-18UniRef50_A1AWX7 Molybdopterin synthase sulfur carrier subunit n=27 Tax=Proteobacteria TaxID=1224 RepID=A1AWX7_RUTMC  ali  24  1.MKILYFASLKESLKLSSEEIILTTNTTTAQLKKQLIDRHGKRHFPNNILCAVNQEIANDAVIISETDKVAFYPPVTGG 78
687 4.000e-18UniRef50_A0A258RQP8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Sphingomonadales bacterium 28-55-16 TaxID=1970589 RepID=A0A258RQP8_9SPHN :_  ali  21  1.MKLVYFASVREAIGLSSEDRDVPTVGDVVVWLRGQSAEHGHALNDSRLRFALDQNMVTADALLADGQELAIFPPVTGG 83
688 4.000e-18UniRef50_A0A2A5CQ61 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5CQ61_9BACT  ali  27  151MIKVKCFSQVKYALGTNELILELDSGTTTSKLEQLVREMAEGKLDDISLRVAVNQKYVPNEVELQDGDEVAFIPPVQGG 231
689 4.000e-18UniRef50_D8PDJ8 Molybdopterin converting factor, small subunit n=6 Tax=Bacteria TaxID=2 RepID=D8PDJ8_9BACT  ali  29  1MVTIHLFGMTKMLAGQGTLSLSLHDGKRVKDLIDAAYPKIGELLQKKKVLVSVNQEIAHEDLEVKDGDEIALLPPFAGG 83
690 4.000e-18UniRef50_A0A0C5XLN1 Molybdopterin synthase sulfur carrier subunit n=22 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0C5XLN1_9SPHN  ali  28  5..TLVYFAWVREAIGRDEERVERPTVATLIAALAARGGGYAEAFARPRLRAALDQHFVPMDSPIGDAKELAIFPPVTGG 86
691 4.000e-18UniRef50_K9P9D4 Molybdopterin converting factor, small subunit n=10 Tax=Cyanobacteria TaxID=1117 RepID=K9P9D4_CYAGP  ali  35  9.VRVRLFAGLRERAGWGERLIPLTTAAGLWRQLADTSPGEDSAELPAAVRVAINQAFAAPDSPLAPGDEVAFLPPITGG 91
692 4.000e-18UniRef50_M5R2D9 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Bacilli TaxID=91061 RepID=M5R2D9_9BACI  ali  32  24MISVLLFAGLAEKAGKQQIIIDQTTVDEIKIELQEVYG----VDTAQNVMVAVNEIYTRGNAEVRSGDTVALIPPVSGG 100
693 4.000e-18UniRef50_A0A2E5YLR5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5YLR5_9DELT  ali  28  66.ITLKLFGSLREAAGNSTLQVELEEGADVWNWLAECHPRVERL--GDRLAASVNLEIGDLGDVLEDGDEVAFLPPVAGG 144
694 4.000e-18UniRef50_A0A2E0RB43 D-inositol-3-phosphate glycosyltransferase n=14 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E0RB43_9ACTN  ali  28  1MATLRLFASIREIAGTSSLEVDVNNVSDAIAEACAQFGDDFAALV-PSCRIWVNGNPAEPTDSVTAQDEIALLPPVSGG 78
695 4.000e-18UniRef50_A0A170PHR5 Putative molybdenum cofactor biosynthesis protein D/E n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A170PHR5_9CHLR  ali  29  3.IEIRLFATLKDRAGSDRIRVRLPTVGLLLEAVGADYPALAPALR--SALVAVNRAFAGSETPVTLGDEVAIFPPVSGG 82
696 4.000e-18UniRef50_Q67JI8 Molybdopterin converting factor-like protein n=4 Tax=Bacteria TaxID=2 RepID=Q67JI8_SYMTH  ali  33  2....KLFAAAADAVGRRTLEWAGRTTAQLLEILTQQYPNLARL--APVLSVAVNREYAPADRVLADGDEVALIPPVSGG 76
697 4.000e-18UniRef50_A0A1Y0MAT0 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1Y0MAT0_9FLAO  ali  28  4..KILFFGITTDLVGVSNLDLVLPDASTVLDLLKKKYPQLENL---DSYAIAVNESYATGDLILNEKDTVAVIPPVSGG 80
698 4.000e-18UniRef50_A0A1H3PLW9 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A1H3PLW9_9BACI  ali  35  1MIKVLLFADLEERAGQRIVEIPTAEIADIRRYLLDKFPQLSASIR--TAMPAINEEYAADQAVASSGDEVAFIPPVSGG 79
699 4.000e-18UniRef50_A0A1Q3SXK1 Uncharacterized protein n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SXK1_9CHLR  ali  27  7..KLKLFAAFRETVGQGELDWPLQTAGEVLDSLVGEYPALAG--GAKSALVMVNRRYATRQTALQPGDEVAFLPPVGGG 84
700 4.000e-18UniRef50_A0A1F5DEM1 Molybdopterin converting factor subunit 1 n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_60_20 TaxID=1797380 RepID=A0A1F5DEM1_  ali  21  3.VKVRYYASFRDVTGKQEEWLDVPEGTTVQGIREHVRGLYESIARREQVLVAVNGAFPALDRVIEEGDDVAFFPPVSGG 80
701 4.000e-18UniRef50_W0F4R6 Molybdopterin converting factor n=4 Tax=Bacteroidetes TaxID=976 RepID=W0F4R6_9BACT  ali  37  1.MQLLFFGSLSEIAGAAGRADLVADTDALKEKLQRQYPLLKDL----KYAVAVDKKIIHSNTVLHDGCTVALLPPYSGG 74
702 5.000e-18UniRef50_L5N3I3 Molybdopterin synthase sulfur carrier subunit n=8 Tax=Bacillaceae TaxID=186817 RepID=L5N3I3_9BACI  ali  29  1MNRILFFAGLKEQIGEGEWSFDAATVEDLKETVRQEFG----VEQVMTSMTAVNEEFAQKETIVKEGDTVAFIPPVSGG 77
703 5.000e-18UniRef50_A0A2D5ZLA4 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D5ZLA4_9BACT  ali  25  20.VRVLFFASWKEVAGGPEIELRLPTAADALEAIIARWPALASRASHATL--AINHAYAAPNQALNPGDELAIVPPVSGG 98
704 5.000e-18UniRef50_A0A2E3RR75 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RR75_9BACT  ali  27  47MITLVLLARLAEIAGTAEVSMAGATVADAVEQLRERHPGLFDLLEAS--VPAIDDEYVPMDTPVKDGMTIALIPPVSGG 128
705 5.000e-18UniRef50_A0A2E0PLL8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Opitutae bacterium TaxID=2026771 RepID=A0A2E0PLL8_9BACT  ali  31  50.VTILYFGQLKEQAGTAREVIDSKTVSEIYQQLKERH---GLSLSFENLRAARNETFCEGTDPVRADDVIAFMPPMSGG 126
706 5.000e-18UniRef50_T0C8U5 Molybdopterin synthase sulfur carrier subunit n=10 Tax=Alicyclobacillus TaxID=29330 RepID=T0C8U5_ALIAG  ali  29  4..RIALFANLREHFQTRELTLTVPTVAQLLPILCEEYPEAKPSL--EKVMVAVNQVLVPAQTVLQETDEIALLPPVGGG 81
707 5.000e-18UniRef50_A0A1E4IM86 Molybdopterin synthase sulfur carrier subunit n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1E4IM86_9BURK  ali  23  1.MRLKYFAWLRSSMGCDAEEIALPTVGQLLDWLPTRGERFRSAFEIDVVLVSVNSEYAHRDHPVHDEDEVLLVPPIAGG 83
708 5.000e-18UniRef50_A0A1G7KBZ1 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1G7KBZ1_9BACL  ali  30  5...IRLFASLAETLGATSLTYHVETAGKLKELLSASYPDAASQIAIS--MVAVDQEYAPDDTIINDAAEVAIIPPVSGG 82
709 5.000e-18UniRef50_A0A2K8Q451 Molybdopterin synthase sulfur carrier subunit n=41 Tax=Bacteria TaxID=2 RepID=A0A2K8Q451_9GAMM  ali  27  1MIKVKFFAVLRERLGTSEMALEPTTVEDIXXXXXXXXXXXXXXXXXXXXXCAVNQDMLPLSTSVKAGDEVALFPPVTGG 82
710 5.000e-18UniRef50_UPI0009FDB57F MoaD/ThiS family protein n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI0009FDB57F  ali  26  48.MKIQVFARLREILGNGQIDLPMSTAGELRAVIAGRWPDAAAILAKS--LVAVNNEYVSDDRPIGPTDAVALIPPVSGG 126
711 5.000e-18UniRef50_A0A2E0ARE9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2E0ARE9_9PLAN  ali  26  3.VEIKLFASAREQLGVEVVRVDMSTVGDLRNAMTAAYPELGSMLQQS--LFAVNADYANDATVIQVSDEVACIPPVSGG 80
712 5.000e-18UniRef50_A0A0P1LLD7 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0P1LLD7_9BACT  ali  36  1.MKVLFFGRLKEIVGTPELKIDVDDIESLRKVLIEKFPKLK----DEVFAIAVNYEIINGNIPLDRNDEIALLPPIAGG 75
713 5.000e-18UniRef50_Q3BWM4 Molybdopterin synthase sulfur carrier subunit n=49 Tax=Gammaproteobacteria TaxID=1236 RepID=Q3BWM4_XANC5  ali  35  5.VTVLYFASLREAAGIADERVQ-SGAQDLRSLYAELDARHGLRWTPAQLRVAVDGAFARWEDALRDGSEVVFIPPVSGG 81
714 5.000e-18UniRef50_A0A2E5QHG8 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5QHG8_9CHLR  ali  16  8.ITIKFFASIREKINNHSVTWSTSPGTSIQDIILRISEEFGEKLVLKSCLYALNGEYVDITEKIKNGDEIAVIPPVSGG 86
715 5.000e-18UniRef50_A0A2E8J7B0 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8J7B0_9GAMM  ali  32  1MIKVTYIGMLATNLKQDEEEVELTDVADLIDSLCERRAEWSRSLRQKNLLISVNHSMVKADQALSDGDEVILFPPMSGG 84
716 5.000e-18UniRef50_U1FXA7 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Staphylococcus TaxID=1279 RepID=U1FXA7_9STAP  ali  24  1.MQILYFAELKEILKKNTEIIEINDVKQLKETINAKYPE----VSEKTYQIAVNEEFVQDNDTVKNMDIVALIPPVSGG 77
717 5.000e-18UniRef50_A0A2V8XDN6 Molybdopterin converting factor n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8XDN6_9BACT  ali  20  3.ISVRAFASYREAIGAPSVRMDVPTPSQVWDRLLGRYPRLAGL--PKPHAFAINEEYIEESYALRERDELVLIPPVSGG 81
718 5.000e-18UniRef50_A0A2E0EVQ9 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Porticoccaceae bacterium TaxID=2026782 RepID=A0A2E0EVQ9_9GAMM  ali  41  9.VKVLFFGRLGDKVNCTEIE---ATPKKVRSLLSEDNVNLGKQLAAAQVLVAVNKVIVGWDYPINDGDELAFLPPVTGG 90
719 5.000e-18UniRef50_A0A1H6ZZ76 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Deinococcus reticulitermitis TaxID=856736 RepID=A0A1H6ZZ76_9DEIO  ali  33  4..TVVFFARLKRELGVEAVTLDVPDGADVRAVAAQLERERGVSL--RGCMVAVNETYATPDHVPQDGDEVAFLPPVAGG 78
720 5.000e-18UniRef50_A0A2N5WX98 Molybdopterin synthase sulfur carrier subunit n=5 Tax=Halieaceae TaxID=1706372 RepID=A0A2N5WX98_9GAMM  ali  29  1MLNVLFFGRIREELDCAQLTVAPDDLDALQKHLETMHDRWQTVLGQDNLIRAVNHAVVSVNVPLVDGDEVAFFPPVTGG 84
721 5.000e-18UniRef50_A0A1I7KN25 Molybdopterin synthase catalytic subunit n=6 Tax=Alicyclobacillus TaxID=29330 RepID=A0A1I7KN25_9BACL  ali  31  4..TVHLFAGLAEIAG-PAVTIELATAGEIRRALQQRLPQLASDLEHA--LIAVNQQYADDDQVVSDGDEIALIPPV... 77
722 5.000e-18UniRef50_E0THH4 Molybdopterin converting factor, subunit 1 n=1 Tax=Parvularcula bermudensis (strain ATCC BAA-594 / HTCC2503 / KCTC 12087) TaxID=31426  ali  44  1MVRVLFFGRLGERFG-AERDVEAATVADLIETVCGAHPGAREALMHPSVSIVLADSVVNRDERLKDAVEVAFLPPVSGG 81
723 6.000e-18UniRef50_A0A1D2UES4 Uncharacterized protein n=3 Tax=Acidobacteriales TaxID=204433 RepID=A0A1D2UES4_9BACT  ali  29  3.VNVLYFGTLKDLFALPHEPLDVPDGATVLSLLRARTSKQSEVWRA--LAVAVNREYAGPATVLHEGDEVALLPPVSGG 81
724 6.000e-18UniRef50_A0A0T5ZMH2 Molybdopterin converting factor subunit 1, molybdopterin synthase catalytic subunit n=3 Tax=unclassified Chloroflexi (miscellaneo  ali  30  3.VTVRLFALQRQQLGTREVRLELPEGATIWETLAAAHPVLEPA--RDSVRFARNGEYASSDETLADGDELAVIPPVAGG 81
725 6.000e-18UniRef50_A0A1G3QJU7 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3QJU7_9SPIR  ali  24  3.IRIKTFATIREACGFEEKELEGISVKEVVQQLKKSYRQLNDL--DGALLFAINEEYCHDDAALSDDDTLAIFPPVSGG 81
726 6.000e-18UniRef50_A0A2D5NGQ0 Molybdopterin converting factor n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NGQ0_9BACT  ali  29  10.VTLRCFAAVRDILDTDTVTVEIEAGTTARGMLEKLGQQH-PALLRVPVAFAVNRDYARADSVLSDGDEVAFIPPISGG 86
727 6.000e-18UniRef50_A0A2E1D0V5 Molybdopterin synthase sulfur carrier subunit n=2 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E1D0V5_9PROT  ali  25  4..KIFFFAELRERMNREFIESEVKNVRELQEKLEEKFEVLRGCFAESKIKIAINHEYRSLDAELRDGDEVAFFPPVTGG 84
728 6.000e-18UniRef50_UPI000A324A69 MoaD/ThiS family protein n=1 Tax=Bordetella genomosp. 9 TaxID=1416803 RepID=UPI000A324A69  ali  28  60.INILYFARVAELTGRRAEPWPLQTGHALLDSLERRYPQLAPA---TRLKLAVNQTHAKPGVTIRAGDEVAVFEPVTGG 138
729 6.000e-18UniRef50_A0A2N2NX06 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-2 TaxID=2013725 RepID=A0A2N2NX06_9CHLR  ali  23  18..KILFFAKLKELIGASQIKFDISTIQDLKNRLIKEYPQLQDYL--PIMLISINQNFAFNTDVIPENAEVACFPPVSGG 95
730 6.000e-18UniRef50_A5GPP8 Molybdopterin converting factor subunit 1 n=17 Tax=Cyanobacteria TaxID=1117 RepID=A5GPP8_SYNPW  ali  36  12.VQVLLFASLRDRAGWSSRPFTLSTPQAIWQLL-----DLGAW--PGGVRVAVNQSFVAADHPLNDGDELAFLPPFTGG 87
731 6.000e-18UniRef50_A0A1V5JP78 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Bacteroidetes bacterium ADurb.BinA012 TaxID=1852815 RepID=A0A1V5JP78_9BACT  ali  33  5.VRVLYFGAAQEATGKSEETIMAADTASLRNQLISRYPALKQI----PFRMALNRTLLKGDSGLQKSDTIAIMPPFQGG 78
732 6.000e-18UniRef50_A0A2H9QVZ8 Molybdopterin synthase sulfur carrier subunit n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9QVZ8_9E  ali  20  3.ITVKFFAGHRDAVGKEKIKMNVKKINDVMNSLIKRYPALEQL--KDYTIASLNHSYAKLNEKLKEGDELAFFPPVGGG 81
733 6.000e-18UniRef50_A0A080JUT2 Molybdopterin converting factor, small subunit n=13 Tax=Snodgrassella TaxID=1193515 RepID=A0A080JUT2_9NEIS  ali  34  26MITVIYLARFAEELGMAQEELACSDSNTLLAYLRQRGIPFSEVLAEGKVKIAVNNIIQHGNTAIRDGDSIALLPPVTGG 107
734 6.000e-18UniRef50_A0A258GZH5 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium 32-64-14 TaxID=1970492 RepID=A0A258GZH5_9PROT  ali  40  5...VLLFGRLKDAFGASSIAMPVGTAAELRAMLAYLNPDLADMLRAKTVRIAVNHEMVADETRISVGDEVALLPPLSGG 84
735 7.000e-18UniRef50_A0A1G9LNH1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Maricaulis salignorans TaxID=144026 RepID=A0A1G9LNH1_9RHOB  ali  32  4..TIRYFAALRDRMGTAESVVDGINGGGLAEWLIARDPA-AEALAHPSVRLIINDEIAPRSQALQDGDTIAFCPPFSGG 82
736 7.000e-18UniRef50_I3ZJN0 Molybdopterin synthase sulfur carrier subunit n=8 Tax=cellular organisms TaxID=131567 RepID=I3ZJN0_TERRK  ali  39  3.VNVLFFGVLREAIGASE-TVEVADMTTVADLLTYFEERSREDLAEPRIAVAVNREYVGREHVLMEEDEVALLPPVSGG 81
737 7.000e-18UniRef50_A0A0T6AMV4 Molybdopterin converting factor subunit 1, molybdopterin synthase catalytic subunit (Fragment) n=1 Tax=Armatimonadetes bacterium  ali  26  3.IAVRTFAAYRQAIGQGAFTLDLPTPGQVWSTLAEQYPDLRR--FPPPARFAVNDEFVGPEHALAEQDEVALIPPVSGG 81
738 7.000e-18UniRef50_A0A290UW79 Molybdopterin synthase sulfur carrier subunit n=3 Tax=Macrococcus TaxID=69965 RepID=A0A290UW79_9STAP  ali  24  1.MKILYFAHIKAKVNRSQDEFTFTSVNDLKAHLGKTYPN----IQGESYQIAVNEEFVKDDEMIQNNDIVALIPPVSGG 77
739 7.000e-18UniRef50_A0A2E4EJA1 Molybdopterin synthase sulfur carrier subunit n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E4EJA1_9FLAO  ali  32  3.VRVLFFGQTTDITGKSLEEMSLNDLGDLIELLNTENQELSKL----NLKWAVNQEFVSEEQELKNGDEVAVMPPFAGG 79
740 7.000e-18UniRef50_A0A235F5I5 Uncharacterized protein n=1 Tax=Fictibacillus aquaticus TaxID=2021314 RepID=A0A235F5I5_9BACI  ali  25  1MIKVLCFAHIKELTGSDELL-LENEELTVQDFLQDMHDRYG---INKDCMVAVNEEYAEPGDVMKSGDTVALIPPVSGG 75
741 7.000e-18UniRef50_A0A2H6ADV8 Molybdopterin synthase sulfur carrier subunit n=1 Tax=bacterium HR36 TaxID=2035431 RepID=A0A2H6ADV8_9BACT  ali  34  3.VKVLFFARARELAGLEAITLEIPTIRDLQRELTQCLPALADFL--PRCQWAVQDTLAAEETVIPEGATVAVLPPVSGG 81
742 7.000e-18UniRef50_A0A2H6HHB8 ThiS family protein n=1 Tax=bacterium BMS3Bbin02 TaxID=2005725 RepID=A0A2H6HHB8_9BACT  ali  24  1MATLRLFASLREAAGTSSIDIDADTVGAVLDEAIAQFDD-RFAAGMATAQTWLNGDPTDRDATVGPNDEIALIPPVSGG