current user: public

If you have questions about the server, please let us know.

Query: ACL93485.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# E-value Template Links and tools%idFirst MTPYDDSPAQAVSTAPRTTGPSLIDGFGRAVTYLRVSVTDRCDLRCVYCMAEHMTFLPKAEVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLSRHLSSGALDELTLTTNGSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRVIAGIDAAQAAGMTVKINAVALKHDNAGEIPALIQWAHGRGCDITLIETMPLGEVDQDRTDQFLSLQDVRRDLSSFWTLTDIPDSTGGPARYVHVAETGGRLGLITPLSNHFCDTCNRVRLTCTGTLHTCLGRDDASDLRAEIRRGASDAELVDAIHLAIGAKPKGHDFQIAAAQPAVARHMSTTGGLast
1 0.000e+00UniRef50_A0A1C7NLE5 Molybdenum cofactor biosynthesis protein 1 n=13 Tax=Opisthokonta TaxID=33154 RepID=A0A1C7NLE5_9FUNG  ali  34  59........KPVLSAKQPKVSHYLTDTFDRQHDYLRISLTERCNLRCTYCMPEGVPLSPENQLLNTQEIIHLASLFVSQGVTKIRLTGGEPTVRPDIVSLVQSLGQLKQ-HGLRSLAMTSNGIALKRKLPALVQGGLDTLNISLDTLDPHLFQVMTRRKGFERVLEAIDLAIQLDMPHKINTVVMRGMNDRDVLDFVAYTKNHPVNVRFIEYMPFDGNRWHSDKLIPFKELVYRIESVYGRLDRLKDSPNDTTKHFGVPGYKGKIGFITSMTDHFCGTCNRLRITADGSIKVCLFGNTEVSLRDMLRQGKGDQELLDIIGMAVKKKKKQHAGMFELASR-KNRPMILIGG 399
2 0.000e+00UniRef50_A0A1I8ARP6 Uncharacterized protein n=6 Tax=Opisthokonta TaxID=33154 RepID=A0A1I8ARP6_9BILA  ali  33  34.....PSPKPKPRPVEKLTQHPLLDDFRRQHTYLRISLTERCNLRCTYCMPEGVPLSPSEQLLSADEIVRLATLFAEFGVDKIRLTGGEPTVRKDLVEIVGRL---AKIPGIQQIGMTSNGIVLARKLDALVAAGLSKLNVSLDTLVEHKYQIMTRRNGLSKVLRLIDLAEPMFDQLKLNCVVIRGTNDDEVLDFVKLTENKNLDVRFIEYMPFGGNRFDVRKMVPYKEMLKTIVDHFQEVVRLRDAPNDTSKAYGVHGFRGKFGFISSMSEHFCSTCNRLRITADGNLKVCLHGLSEVSLRDEMRKGATDEELIQVIGSAVRRKKKQHAGID-TLTAMKNRPMILI.. 372
3 0.000e+00UniRef50_UPI000C780F52 LOW QUALITY PROTEIN: molybdenum cofactor biosynthesis protein 1-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C780F5  ali  32  35..PVPTLRKNSEKKEILPFSAFLTDTFGREHDYLRISLTEKCNLRCSYCMPEGVKLTPKQNILTSEEIIHLAKIFVGEGVKKIRLTGGEPLVRPDIVEIIREL---RSIPGLQTIAMTTNGVTLSKRLVELKSAGLDALNISLDTLIPDKFQFVSRRPKHAKVLSAIEKSLELGYPLKINCVMMKGLNDDEILDFIELTRNKPIDVRFIEYMPFDGNKWNDKKMLPYQAMLKIIKDKYPEFRRIDDAPNDTSKGYQVQGFQGQIGFITSMSENFCGSCNRLRLTADGNLKVCLFGNAEVSLRDALRSGMKEEELKELIGMAVNRKKARHAGM-TNLKGMKNRPMILIGG 381
4 0.000e+00UniRef50_UPI000575F920 molybdenum cofactor biosynthesis protein 1 isoform X4 n=3 Tax=Opisthokonta TaxID=33154 RepID=UPI000575F920  ali  32  74.MAVSGDRRGRLVENFLPFSNFLTDNYGRRHSYLRMSLTEKCNLRCQYCMPEGVKLTPRAQLMSTSEILTVARLFVQEGVDKIRLTGGEPLIRPDVLDIITEL---RKLKGLKTIAVTTNGMNLERMLPKLKEAGLDLLNISLDSLVPAKFEFIVRRKGFHKVMEGIDKAIEMFNPVKVNCVIMRGFNEEEILDFVTLTENRPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDYIRQQWPRLEQLPNAKTDTAKTYKVPGFQGQVGFITSMSDHFCGSCNRLRITANGNLKVCLFENMEVSLRDVLRSGASDQELLEIIGAAVGRKKKQHAGMFSISQ-MKNRPMILIGG 439
5 0.000e+00UniRef50_Q9AC48 GTP 3`,8-cyclase n=2880 Tax=root TaxID=1 RepID=MOAA_CAUVC  ali  100  1MTPYDDSPAQAVSTAPRTTGPSLIDGFGRAVTYLRVSVTDRCDLRCVYCMAEHMTFLPKAEVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLSRHLSSGALDELTLTTNGSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRVIAGIDAAQAAGMTVKINAVALKHDNAGEIPALIQWAHGRGCDITLIETMPLGEVDQDRTDQFLSLQDVRRDLSSFWTLTDIPDSTGGPARYVHVAETGGRLGLITPLSNHFCDTCNRVRLTCTGTLHTCLGRDDASDLRAEIRRGASDAELVDAIHLAIGAKPKGHDFQIAAAQPAVARHMSTTGG 349
6 0.000e+00UniRef50_A0A1X7V7I0 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7V7I0_AMPQE  ali  35  20...........ASSTRLPVQEALTDKFGRSHTYLRISLTERCNLRCQYCMPEGVELSPSSELLTASEIVRLASLFVSQGVNKIRLTGGEPLLRTDLLDIITQLS---AISGLSTIGLTTNGLTLAKKVHLLKEAGLSSVNISLDTLIPQKFEFISRRRGHERVLNAIDSAIDSINPVKVNCVVMRGVNDDELNDFVALTEEKPIDVRFIEYMPFDGNKWNTKRFLPYHEMLSSLQNYYPSLARHQDSENDTSKHYQVPGYKGRVGFITSMSEHFCGSCNRLRITADGNLKVCLFGASEVSLKNYIRSGASDEELLPVISAAVKRKHPHHAGMLTLSKR-KNRPMILIGG 355
7 0.000e+00UniRef50_R7UW66 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7UW66_CAPTE  ali  33  70......TRSSRFKEGVRPFSDFLTDSFGRQHTYLRISLTERCNLRCQYCMPEGVDLTPRQKLLSFDEIIKLSTLFVEEGIQKIRLTGGEPLVRRDLVQIIEELNKLKEI-GLQKIGITTNGITLAKRLPDLRAAGLDQINVSLDTLVPAKFEFITRRKGWSKVMEGIDQALEKGFDRKVNCVVKRGMNEDEVVDFVALTEHKPIDIRFIEYMPFDGNQWSDTKLVSYTEMLTSIRERFPELQRLQDHPNDTSKAWSVRGFAGQFGFITSMTQNFCGTCNRLRLTADGNLKVCLLGSAEVSLRDALRSNMTEEQLKQLIGAAVGRKKAKHAGMNSLAK-MPNRPMILI.. 410
8 0.000e+00UniRef50_A0A0D3B4H2 Uncharacterized protein n=66 Tax=Eukaryota TaxID=2759 RepID=A0A0D3B4H2_BRAOL  ali  35  32.....SNAAQVDQTKHSSVSDMLVDSFGRFHTYLRISLTERCNLRCQYCMPEGVELTPKPQLLSQSEIVRLAGLFVSSGVNKIRLTGGEPTVRKDIEEICMQLSSLK---GLKNLAITTNGITLARKLPKLKECGLDSINISLDTLVPAKFEFLTRRKGHERVMQSIDSAIALYNPVKVNCVVMRGLNDDEICDFVELTRDKPINVRFIEFMPFDGNVWNVKKLVSYAEMMDKVVKRFPSIKRVQDHPTETAKNFTIDGHCGSVSFITSMTEHFCSGCNRLRLLADGNFKVCLFGPSEVSLRDPIRSGADDETLREITGAAVKRKKAAHAGMLDIAKTA-NRPMIHIGG 373
9 0.000e+00UniRef50_A0A2I4BD22 molybdenum cofactor biosynthesis protein 1 isoform X1 n=73 Tax=Deuterostomia TaxID=33511 RepID=A0A2I4BD22_9TELE  ali  34  80.................PFSAFLTDSFGRRHNYLRISLTEKCNLRCQYCMPEGVKLTPRGQLLSTSEVLTLARLFVREGVEKIRLTGGEPLIRPDVLEIIAEL---KKLEGLKTVAVTTNGINLSRLLPNLKEAGLDLINISLDSLVPAKFEFIVRRKGFHKVMEGINKAVELGYPVKINCVVIRGLNEDELLDFVSLTETKPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDRIRQQWPKLERLQGGSADTAKMFKVPGFSGQLGFITSMSENFCGSCNRLRITADGNLKVCLFGNSEVSLRDVLRSGASDEELLQIIGAAVGRKKQQHAGMFSISQ-MKNRPMILI.. 407
10 0.000e+00UniRef50_E9FU91 Uncharacterized protein n=4 Tax=Bilateria TaxID=33213 RepID=E9FU91_DAPPU  ali  34  43.................PFSSFLTDTHGRQHNYLRISLTERCNLRCQYCMPGGVDLTTKDKLLTTSEIIKIASAFVEEGVDKIRLTGGEPSIRPDIVELVGTL---KKLDGLKTLAMTTNGLLLSRKLPALKAAGLNMLNVSLDTLIPAKFEFITRRKGFEKVLQGIDVSLELYNPLKLNCVVMRGLNEDELHSFVELTRDKDTDVRFIEYMPFEGNKWNGKKMVPYHEMLEIIRRKYSDLMRLEDAANDTSKAYQVPGYRGKIGFITSMSEHFCGSCNRLRLTADGNLKVCLFGNAETSLRDLLRDGASNEELIAVVGQAVGRKKKQHAGM-SNLPSMKNRPMILIG. 371
11 0.000e+00UniRef50_Q39055 GTP 3`,8-cyclase, mitochondrial n=136 Tax=Eukaryota TaxID=2759 RepID=CNX2_ARATH  ali  35  61.................PVSDMLIDKFGRLHTYLRISLTERCNLRCQYCMPEGVELTPKPQLLSQSEIVRLAGLFVSAGVNKIRLTGGEPTVRKDIEEICLQLSSLK---GLKNLAITTNGITLAKKLPRLKECGLDSLNISLDTLVPAKFEFLTRRKGHDRVMKSIDTAIELYNPVKVNCVIMRGLNDDEICDFVELTRDKPINVRFIEFMPFDGNVWNVKKLVPYAEVMDKVVKRFPSIKRMQDHPTETAKNFTIDGHCGSVSFITSMTEHFCAGCNRLRLLADGNFKVCLFGPSEVSLRDPLRSGADDEALREIIGAAVKRKKAAHAGMLDIAKTA-NRPMIHIGG 390
12 0.000e+00UniRef50_A0A1W0X0M7 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0X0M7_HYPDU  ali  35  44....PSASKLPSPSQSVEVDEFLKDKFGRKHSYLRISLTERCNLRCQYCMPEGVQLTKKEHLLTTEEIIRIASVFVAGGVKKIRLTGGEPLLRPDIAEICEGLN---SLPGLEDIVLTTNGVLLTRKLPSLLKSGLRSVNISLDTLIPAKFELIARRRGWEKVIEGIDSALDAGVPLKINCVVTRGVNEEEMVDFVKWTEKKAVDVRFIEYMPFAENKWNDKKIVPYFEMLDIIKRKYPDLIRLQDKPNDTSKAYKVPGFKGQFGFITSMTANFCGSCNRLRLTADGNLKVCLFGNAEVSLRDVLRSGVGDSELREVIGDAVQRKKKQHAGMLNIAKAP-GRPMILIG. 385
13 0.000e+00UniRef50_A0A060T230 ARAD1A04202p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T230_BLAAD  ali  34  48.....QAERWQAIRHAKPFSAFLTDSFNRQHDYLRISITERCNLRCLYCMPEGVELSPSDKLLTSDEIVKIATLFVSQGVRKIRLTGGEPSVRKDFMGLFERLG---QIPGLEELCITSNGIALPRKLPKLKQYGLTGLNLSLDTLVEGKFMIMTRRKGLSQVLKCLDTALEVGVPSKINCVVMRGQNEDEIVDFVNLTRHMPVEVRFIEYMPFDGNKWNQQKMFSYREIMDTIKEQYPGLARLPSKNGDTAKVFQVPGHAGTVGAITSMTSHFCGTCTRLRITCDGNLKVCLFGNAEVSLRDMVRAGASDDELLQVIGTAVKNKKEKHAGL-GVLENMKNRPMILIGG 389
14 0.000e+00UniRef50_E2RDQ4 Molybdenum cofactor synthesis 1 n=63 Tax=Gnathostomata TaxID=35060 RepID=E2RDQ4_CANLF  ali  35  44.....SRRRQFLREHAVPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVAQLH---QLEGLRTIGITTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYPVKVNCVVMRGLNEDELLNFVALTKGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTLQQQWPELEKLPEEESSTAKAFKIPGFRGQVSFITSMSEHFCGTCNRLRITADGNLKVCLFGSSEVSLRDHLRAGASEEELLRIIGAAVGRKKQQHAGMFSIAQ-MKNRPMILI.. 383
15 0.000e+00UniRef50_UPI0007400CA9 molybdenum cofactor biosynthesis protein 1 isoform X1 n=3 Tax=Neopterygii TaxID=41665 RepID=UPI0007400CA9  ali  33  99LAP-PGGRSRELSEDPQPFSAFLTDRFGRQHRYLRISLTEKCNLRCQYCMPEGVKLTPRSQLLSTAEVLALARLFVQEGVEKIRLTGGEPLIRPDVVHVVAEL---RKLQGLKTIAVTTNGMNLARLLPSLKEAGLDLLNISLDSLVPAKFEFIVRRKGFHKVMEGIDKAIELYNPVKVNCVVMRGLNEDELLDFVALTEKKPLEVRFIEYMPFDGNKWNFRKMVSYQEMLDRIRQRWPDLEKLPAGETDTAKIFKVPGFQGQVGFITSMSEHFCGSCNRLRVTADGNLKVCLFGNAEVSLRDCLRSGASEEELLQIIGAAVGRKKQQHAGMFSISQ-MKNRPMILIG. 443
16 0.000e+00UniRef50_A0A1S3JUP9 molybdenum cofactor biosynthesis protein 1-like isoform X1 n=4 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3JUP9_LINUN  ali  34  56.....RQPSHFQGKDVLPFSEFLTDSFGRQHTYLRISLTERCNLRCQYCMPEGVDLTPKNKLLSTEEIITLSRLFVKEGIEKIRLTGGEPLIRKDLLDIIGALHTLRSA-GLQKISITTNALTLSKKLQQLKTAGLDQINISLDTLLPAKFEFITRRKGWNKVIEGIDAAEEEMHPVKVNCVVMRGINEEEICDFVQWTQDKAIDVRFIEYMPFDGNKWNSKKMVPYQEMLGIIRARWPDLERLSDEVSDTSKAYRVPGFAGQIGFITSMSDNFCGGCNRVRITADGNLKVCLFGNAEVSLRDALRSGTSEPELLEIIGAAVKRKKKQHAGMLSLAK-MKNRPMILI.. 397
17 0.000e+00UniRef50_UPI000813A303 molybdenum cofactor biosynthesis protein 1 isoform X7 n=2 Tax=Boreoeutheria TaxID=1437010 RepID=UPI000813A303  ali  35  36...LSQGPRQFLREHAAPFSAFLTDSFGRQHSYLRISLTERCNLRCQYCMPEGVSLTPKADLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVARLH---QLEGLRTIGITTNGINLARLLPQLQKSGLSAINISLDTLVPAKFEFIARRKGFHKVMEGIHKAIELYCPVKVNCVVMRGLNDDELLDFVALTKGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTLWQQWPELKKLPGEESSTAKTFRVPGFQGQVSFITSMSDHFCGTCNRLRITADGNLKVCLFGSSEVSLRDHLRAGASEEELLRIIGAAVGRKKRQHAGMFSISQ-MKNRPMILIGG 404
18 0.000e+00UniRef50_K7GFA3 Molybdenum cofactor synthesis 1 n=6 Tax=Euteleostomi TaxID=117571 RepID=K7GFA3_PELSI  ali  33  2.....TRRKGFLPELAAPFSAFLTDSFGRQHNYLRISLTEKCNLRCQYCMPEGVQLTPKSELLTTQEIITLARLFVKQGVDKIRLTGGEPLIRPDVVDIVGQLY---KLEGLQTIAVTTNGINLARLLPRLKDAGLDAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVMRGLNEDELLDFVALTQDQPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQRWPELEKLPCEASSTAKAYKVPDFQGQISFITSMSEHFCGSCNRLRITADGNLKVCLFGNSEVSLRDHLRSGASEDKLVQIIGAAVGRKKKQHAGMFNISQ-MKNRPMILI.. 341
19 0.000e+00UniRef50_Q9NZB8-8 Isoform 8 of Molybdenum cofactor biosynthesis protein 1 n=24 Tax=Euteleostomi TaxID=117571 RepID=Q9NZB8-8  ali  34  44.....SRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQ---RLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQ-MKNRPMILI.. 383
20 0.000e+00UniRef50_Q9NZB8 Molybdenum cofactor biosynthesis protein 1 n=261 Tax=Bilateria TaxID=33213 RepID=MOCS1_HUMAN  ali  34  44.....SRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQ---RLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQ-MKNRPMILI.. 383
21 0.000e+00UniRef50_Q6GLX5 MGC84142 protein n=34 Tax=Euteleostomi TaxID=117571 RepID=Q6GLX5_XENLA  ali  34  50.......RKRFMKEHPVPFSAFLTDSFGRQHNYLRISVTEKCNLRCQYCMPEGVKLTPKSELLTTQEIVTLAKLFVREGVDKIRLTGGEPLIRPDVVDIVAQL---RKLEGLKTIALTTNGINLTRQLPKLKDAGLDVLNISLDTLVPPKFEFIVRRKGFHKVMEGINKAIDLYNPVKVNCVVMRGLNEDELLDFVELTEKQPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDTIRQRWPELETLPAEASSTSKNYKVPHFEGQIGFITSMSEHFCGSCNRLRLTADGNLKVCLFGNSEVSLRDCLRSEVSEEELIQIIGAAVGRKKKQHAGMFNISQ-MKNRPMILIGG 389
22 0.000e+00UniRef50_A0A1A7XCB3 Molybdenum cofactor biosynthesis protein 1 (Fragment) n=14 Tax=Euteleostomi TaxID=117571 RepID=A0A1A7XCB3_9TELE  ali  35  97............GDSILPFSAFLTDGFGRRHNYLRISLTEKCNLRCQYCMPEGVKLTPRNQLLSASEVLTLARLFVQEGVDKIRLTGGEPLIRPDVLDIIAEL---KKLEGLKTLAVTTNGINLSRLLPKLKDVGLDLINVSLDSLVPAKFEFIVRRKGFHKVMEGIEKAAELYNPVKINCVVMRGLNEDELLDFVALTETKPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDRIRQQWPDLERLQAGAADTAKIYKVPGFTGQLGFITSMSEHFCSSCNRLRITADGNLKVCLFGNAEVSLRDVLRSGASDEELLQIIGAAVGRKKKQHAGMFSISQ-MKNRPMILIGG 431
23 0.000e+00UniRef50_H0WL74 Molybdenum cofactor synthesis 1 n=15 Tax=Euteleostomi TaxID=117571 RepID=H0WL74_OTOGA  ali  34  44.....SRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTERCNLRCQYCMPEGVPLTPKADLLTTEEILTLARLFVREGVTKIRLTGGEPLIRPDVVDIVARL---RRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVIRGLNEDELIDFVALTKGLPLDMRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQQWPEMEKLPEEESSTAKAFKIPGFEGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFNISQ-MKNRPMILI.. 383
24 0.000e+00UniRef50_Q5RKZ7 Molybdenum cofactor biosynthesis protein 1 n=65 Tax=Bilateria TaxID=33213 RepID=MOCS1_MOUSE  ali  35  46.......RLQFLQEHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVARLHG---LEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYPVKVNCVVMRGLNEDELLDFVALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQRWPGLEKLPEEDSSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLRIIGAAVGRKKRQHAGMFNIAQ-MKNRPMILIG. 384
25 0.000e+00UniRef50_Q9NZB8-6 Isoform 2 of Molybdenum cofactor biosynthesis protein 1 n=164 Tax=Eukaryota TaxID=2759 RepID=Q9NZB8-6  ali  34  44.....SRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQ---RLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQ-MKNRPMILIGG 385
26 0.000e+00UniRef50_Q5RKZ7-2 Isoform Mocs1a of Molybdenum cofactor biosynthesis protein 1 n=24 Tax=Euteleostomi TaxID=117571 RepID=Q5RKZ7-2  ali  35  46.......RLQFLQEHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVARLHG---LEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYPVKVNCVVMRGLNEDELLDFVALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQRWPGLEKLPEEDSSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLRIIGAAVGRKKRQHAGMFNIAQ-MKNRPMILIGG 385
27 0.000e+00UniRef50_A0A2E0GWU5 GTP 3`,8-cyclase MoaA (Fragment) n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2E0GWU5_9GAMM  ali  58  5......................LIDPFRRAITYLRVSVTDRCDFRCIYCMAENMKFMPKNELLSLEELDRICSTFVVMGVNKLRITGGEPLVRRNIVSFFNSMARHLESGALKELTLTTNGSQLERFADDLYAAGVRRINVSLDTLDEEKFARVTRWGRLKKVLLGIDAAQRAGLRIKINTVALKGFNEEELLTITRWCETRDMDLTWIEVMPMGDLKEDRIGQYWALSELRAELRNHYQLIDLAESTAGPARYVRLHETGQKIGFITPLSHNFC.......................................................................... 258
28 2.000e-98UniRef50_D0MDU9 GTP 3`,8-cyclase n=47 Tax=cellular organisms TaxID=131567 RepID=D0MDU9_RHOM4  ali  37  30............YDPARSEADVLTDGFGRRHTYLRISLIEHCNLRCRYCMPEGLDWTPPEHLLTDEEIIRLARLFVSQGVTKIRLTGGEPLLRKGIERIVAEL---ARLPGLRALAMTTNGLLLPKKLDRLQAAGLTQLNISLDTLRPERFEILTRRKGFEQVLRAIDLAIARYRPLKVNCVVLRGFNEDELLDFAAWTKDRPVEVRFIEFMPFDGNGWNDAQLVPAAE-MRARIEARYPLEPIAFDPHGTARLFRIPGHQGRLGFIASMTEPFCEGCNRLRITADGSLKVCLFGRAEVSLRDAMRRGASDEELLALISAAVGRKHARHAGM-YNLARMPNRPMITIGG 363
29 4.000e-98UniRef50_B3SAV0 Uncharacterized protein n=10 Tax=Opisthokonta TaxID=33154 RepID=B3SAV0_TRIAD  ali  39  42................KPFSEFLTDSFGRKHDYLRISLTERCNLRCQYCMPEGVGLTPQERLLTADEIIKLSQLFASEGVTKIRLTGGEPLVRRDLIDIVREINL---IPGIDVIAMTTNGVTLARHLPKLKEAGLSLINVSLDTLVPAKFEFITRRRGWDRVMKGIDAALQLYNPVKINCVVMKGLNDDEILDFVQLTETKAVDVRFIEYMPFDGNKWNYEKFVSYQQMLDIIRDRWPELVRMQDSPNDTSKAYQVPGHIGRIGFITSMSEHFCGSCNRLRLTADGNLKVCLFGNAEVSLRDVIRSGHSDEELLKIIGVAVGNKKKQHAG.................. 355
30 4.000e-98UniRef50_E3MSE5 Uncharacterized protein n=4 Tax=Caenorhabditis TaxID=6237 RepID=E3MSE5_CAERE  ali  33  78...................QPPFFDMFMREHTYLRISLTEKCNFRCLYCMPEGVPLKPKDKMLTNEEVLKLVKLFASHGIDKIRLTGGEPTIRKDIVQIVEGI---ASTPGIKDVGITTNGLVLPRFLPDLKNAGLTKINISIDSLERQKFAKMTRRDGFDKVWKSIELARRYFPKVKLNVVVIRRQNENEIVDFVNLTRDRNLDVRFIEFMPFGGNEFTNDQFFGYREMLNLIVEKFGDVIRLSDSPNDTTKAYKIEGYEGQFGFITSMTDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDKIRGGDTDEQLSEIIQKAVNNKKARHAGMDAL-KNLPNRPMILIGG 405
31 8.000e-98UniRef50_A0A226ES70 Molybdenum cofactor biosynthesis protein 1 n=3 Tax=Folsomia candida TaxID=158441 RepID=A0A226ES70_FOLCA  ali  33  51.................PFSAFLTDKHGRQHNYLRISVTERCNLRCTYCMPEGVPLTPSQKLLSAAEIVRVAKTFVQQGVDKIRFTGGEPLLRKDLPSILGQI----SELNLKSIGITTNGILLARLMPELKSSGVTSINVSLDTLIPKKFEKISRRPAWFKVWKGIEMAELMYHPLKINCVVQGGVNDDEICDFVELTKDRHLDVRFIEYMPFTGNKWDLSRMVAYKDMVEMIQSRYPNFSKLEDPVTHTSKAYKIPGHVGQVGFITSMSEHFCGGCNRLRITADGNLKVCLFGNAEISIRDALRSGISEEDLLNLIGQAVGRKHPRHAGMMNLS-SMKNRPMILI.. 379
32 8.000e-98UniRef50_A0A1I8C5M7 Uncharacterized protein n=2 Tax=Ecdysozoa TaxID=1206794 RepID=A0A1I8C5M7_9BILA  ali  32  10...................SSTLVDSFGRHHNYLRISLTEKCNLRCTYCMPEGVPLSPRKDILTNDEIVKLVTLFREEGVNKIRLTGGEPTLRKDLVQLVKDIN---SVGGIESIGITTNGIVFNRYAEDLVKAGLTHVNISLDTLDPNKYAILSRRNGFEKVIKNIEFSRSLFKTVKINNVVMRGINDNEVVDFVRMTRDKNLDVRFIEWMPFGGNNFNSKKMVSYKESLAKIDEEIAPIIKINDSPNDTSKGYKIQGWTGSFGFISSMTDNFCGTCNRMRLTANGHLKVCLHDNAEVSLKDMLRNNSSDDQIKETISNAVNAKKFKHAGME-NLKLMKNRPMILIGG 338
33 1.000e-97UniRef50_A0A1Y1IHG9 Molybdenum cofactor biosynthesis pathway protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1IHG9_KLENI  ali  34  318..................VSPTLVDNFGRRHTYLRISLTERCNLRCKYCMPEGVELSPSDSLLSTDEILQLATVFVANGVDKIRLTGGEPTIRRDFVEICRGL---KQLDGLRTLAITTNGLILQRQLPALRDAGVDLLNISLDTLVPAKFELLTRRKGHHKVLQSIERALELGYPVKVNCVVMRGVNDDEVGDFVELTREQPVNVRFIEFMPFDGNVWDSKKMVPYAELMAAVKTKYPTIARLQDHPTDTAKNFRVEGFRGTVSFITSMTDHFCAGCNRLRLMADGNLKVCLFGPAEVSLRDALRAGATTGGLEDIIGSAVRRKKARHAGMFEI-QRTQNRPMIHIGG 646
34 3.000e-97UniRef50_A0A1E4RUJ1 Molybdenum cofactor biosynthesis prote n=1 Tax=Cyberlindnera jadinii NRRL Y-1542 TaxID=983966 RepID=A0A1E4RUJ1_CYBJA  ali  31  18........RWSAIHNALPLSHFLTDNYGRKHNYLRISITERCNLRCLYCMPEGVPLQPDSHILSRDEIKQLASIFVSQGVDKIRLTGGEPTVRRDIVEIVQDL----KSLGVKELGITSNGIALHRKLPLLVESGITALNLSLDTLQDGKFMTITRRNGLNQVLKSLERALELGIKVKLNCVVIRGVNEDEILAFVKLAQWWPIEVRFIEYMPFDGNKWELNKVISYKEMKELILQKHPLMVHRDHKSGETAKVFKSPDWVGSVGFITSMTDDFCSDCNRLRLTSDGNLKVCLFGNEEVSLRDMIRSNVPKDEILEVIGEAVKSKKEKHAGLDEL-KTMKNRPMTLIGG 354
35 3.000e-97UniRef50_A0A2U9CKA2 Putative molybdenum cofactor biosynthesis protein 1 n=4 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A2U9CKA2_SCOMX  ali  34  7...IPAAPLGRTSEDTLPFSAFLTDNFGRRHSYLRVSLTEKCNLRCQYCMPEGVKLTPRGQLLSTSELLTLARLFVQEGVDKIRLTGGEPLIRPDVVDIIAEL---KKLEGLKTVAVTTNGMNLARLLPKLKDAGLDLINISLDSLVPAKFEFIVRRKGFHKVMEGIDKAIEMFNPVKVNCVVMRGLNEDELLDFVALTEKKPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDRIRQQWPELEMLQSGHTDTAKTFKVQGFKGQVGFITSMSDHFCGSCNRLRITADGNLKVCLFGNSEVSLRDILRSGASDKELLQIIGSAVGRKKKQHAGMISISQ-MKNRPMILI.. 348
36 3.000e-97UniRef50_Q20624-2 Isoform mocs1a of Molybdenum cofactor biosynthesis protein 1 n=6 Tax=Rhabditida TaxID=6236 RepID=Q20624-2  ali  33  62...................QPPFFDMFMREHTYLRISLTEKCNFRCLYCMPEGVPLKPKDKMLSNSEVLRLVKLFAAHGVDKVRLTGGEPTIRKDIVHIVEGI---SSTPGIKEVGITTNGLVLQRFLPQLRDAGLTKINISIDSLDREKFAKMTRRDGFDKVWKAIELARGYYPKVKLNVVVLKHQNENEVVDFVNLTKDRNLDVRFIEFMPFGGNEFKNDNFIGYREMLNLIVDKYGDVIRLSDSPNDTTKAYKIDGFQGQFGFITSMSDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDRIRCGDSDEQLSEVIQKAVNNKKARHAGMDAL-KNLPNRPMILIGG 389
37 3.000e-97UniRef50_A0A1R3KJF4 Chloroplast envelope membrane protein, CemA n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3KJF4_9ROSI  ali  34  334...........VKDKANPVSDMLVDRFGRMHTYLRISLTERCNLRCHYCMPEGVELTPTPQLLSHQEIFRLANLFVTSGVNKIRLTGGEPTLRKDIQDICFNLSSLK---GLKALAFTTNGITLAKKLPMLKQCGVTSLNISLDTLVPAKFEFMTRRKGHHKVIESINAAIDLYNPVKVNCVVMRGFNDDEMCDFVNLTRDKPINVRFIEFMPFDGNVWNVKKLVPYSEMLDTVSKQFPGLKRLNDPLTETAKNFKIDGHTGTVSFITSMTEHFCAGCNRLRLLADGNLKVCLFGPSEVSLRDPLRSGAGDEELREIIGAAVKRKKAAHAGMFDIAKTA-NRPMIHIGG 669
38 5.000e-97UniRef50_A0A1Y1YAI0 Molybdenum cofactor biosynthesis prote n=2 Tax=Zoopagomycota TaxID=1913638 RepID=A0A1Y1YAI0_9FUNG  ali  34  7..........AAIDAERPYSPVLRDNYERNHDYLRISVTEKCNLRCLYCMPEGIDLQPTEKMLSTEEILRLARLFVEQGVTKIRLTGGEPTVRKDIVELVEELGKLREK-GLRTIAMTTNGIAIKRKLPDMVKHGLNALNFSLDTLDKFKFEIMTRRRGHERVLESIQQAIDLVHPVKVNNVVMRGVNDQEVLDFIRMTENSPIDVRFIEYMPFDGNKWKDNKLVPYKELLDSIEAEFKSVVKVEDDPNPTSKGFRIPGFRGQFGFISSMTDHFCATCNRLRLTADGNIKVCLFDNEEVSLRDMMRRNASDEELLSIISLAVKNKKKEHADMFELSNT-KNRPMIRIGG 345
39 6.000e-97UniRef50_A0A261XYL3 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XYL3_9FUNG  ali  35  22........RIAAIDAEKPFSPFLTDKFNRKHSYLRISLTERCNLRCTYCMPEGVDLTPTNELLTTEEIIRLARLFVQQGVTKIRLTGGEPTVRPDIIELVAELGKLKHL-GLKHIAMTSNGIALKRKLPKLVENGMDGLNLSLDTLDSNKFEIITRRRGFENVLGSVDQAIDLGMKSKINCVVIRGVNDREVPDFVAFTQKKPVNVRFIEYMPFDGNKWNSDKLVPYKELISNIETRFGALKKLTDDPNDTTKAFKIPGYAGQIGFITSMSDHFCGTCNRLRITADGNLKVCLFGPNEVSLRDAMRGAQTDEDLLEVIGVAVGNKKKQHA................... 344
40 8.000e-97UniRef50_A0A0N5E379 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A0N5E379_TRIMR  ali  34  39..............SAQRTSQSLRDSFGRFHNYLRISLTDRCNLRCKYCMPNGVTCYSPDQLLSQSEIFALTSLFSKLGVTKVRLTGGEPTVRTDLMDIVGSL---SRISGLKKLGLTSNGILLRKMLPKLKERGLTHLNLSLDTLIEPKFQLITGSNGWKHVWKTIEMAERLYPVIKINCVVIRGYNEEELCDFVELTRNRSLDVRFIEYMPFNGNKWEYSKMVSYLEMMQTIQRQFGDLMKLENNLNDTSKGYQVPGFRGRIGFITSMSQHFCGSCSRLRLTADGCLKVCLHGNSEVSLRDAVRSGASEEALIELINKAILSKQEHHAGMFRLAEQ-SNRPMVQIGG 370
41 1.000e-96UniRef50_A0A1X6NEQ4 Uncharacterized protein n=27 Tax=Agaricomycotina TaxID=5302 RepID=A0A1X6NEQ4_9APHY  ali  35  47.DPGPQERLAAIDTQ-RPVSPSLVDSFNRRHDYLRISLTERCNLRCFYCMPDGIELSPREHILTDDEVIRLATLFVKSGVTKIRLTGGEPTVRKGLVDVVARLNELRG-HGLKSIGMTSNGIALERRLPTLVENGLTHLNLSLDTLDPFKFEIMTRRMGHDAVLRSLRAALASGRSVKLNVVVVKGLNDAEVLDFLELTKDQNLSVRFIEFMPFTGNKWDKAKMVPSSELLSHIQRQHPSTIKAPDELNDTARSYITPGYKGSFGFISSMSDHFCGSCNRLRLTADGQIKVCLFDAKEISLRDQMREGATDDELLRTIGHAVRGKQEKHAGME-DIDVVTNRPMILIG. 392
42 1.000e-96UniRef50_Q54NM6-2 Isoform mocs1a of Molybdenum cofactor biosynthesis protein 1 n=138 Tax=cellular organisms TaxID=131567 RepID=Q54NM6-2  ali  35  58......................LTDRFNRHHTYLRISLTERCNLRCKYCMPEGVMLSQADKILTTDEIIRLSKLFVSAGVNKIRFTGGEPLVRKDVEPLIEEVG---KIKGLQKIGITTNGILLSRKLDRLHKAGVNLLNISLDTLNSDKFTLITRRLGWDRVFQSIDNALKLDNKVKVNCVIMKGLNDMEICDFVEMTRDKSVEIRFIEYMPFDGNLWSDKKFLSYTDMIKIIHEKYPTFKKEEEEPNNTSKTYHVPGFKGKVGFITSMSEHFCSSCNRLRITADGNLKVCLFGNTEVNLRDRIRDGASDQQLLEIINAAVLKKKASHAGMYEIAQN-KNRPMILIGG 385
43 2.000e-96UniRef50_A0A1R3GTR7 Cofactor of nitrate reductase and xanthine dehydrogenase n=32 Tax=Viridiplantae TaxID=33090 RepID=A0A1R3GTR7_COCAP  ali  34  206..................VSDMLVDRFGRMHTYLRISLTERCNLRCHYCMPEGVELTPTPQLLSHQEIFRLANLFVTSGVNKIRLTGGEPTLRKDIQDICFNLSSLK---GLKALAITTNGITLAKKLPMLKQCGITSLNISLDTLVPAKFEFMTRRKGHHKVIESINAAIDLYNPVKVNCVVMRGFNDDEMCDFVNLTRDKPINVRFIEFMPFDGNVWNVKKLVPYSEMLDTVSKQFPGLKRLNDPLTETAKNFKIDGHTGTVSFITSMTEHFCAGCNRLRLLADGNLKVCLFGPSEVSLRDPLRSGAGDEELREIIGAAVKRKKAAHAGMFDIAKTA-NRPMIHIGG 534
44 4.000e-96UniRef50_A0A162QWL8 Uncharacterized protein n=3 Tax=Mucorales TaxID=4827 RepID=A0A162QWL8_MUCCL  ali  36  2........................DDFDRHHNYLRISLTERCNLRCTYCMPEGVPLTPNDQLLSKEEILRLARLFVSQGVTKIRLTGGEPTVRPDIIELVQHLGQLKQ-HGLQSLAMTSNGIALKRKLPALVAGGLDTLNVSLDTLDPHLFQIMTRRKGFDKVTGAIDEAVRLRMPHKINTVVMRGVNDQEVLNFAAYTKENPVNVRFIEYMPFDGNKWNRDKLVPFKELVDRIESMYGRLDKLGDGLNDTTKA--MPGYQGKLGFITSMTEHFCGTCNRLRITADGNIKVCLFGNAEVSLRDMMRQGKTDEQLLEIIGAAVKKKKKQHAGMFELASR-KNRPMILIG. 323
45 4.000e-96UniRef50_A0A2C9KBY4 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9KBY4_BIOGL  ali  35  62.THFKQKIKAKVATFDRPFSEFLTDTFGRQHTYLRISLTERCNLRCQYCMPEGIQLSPKEHILTTGEILKLAKIFVSQGITKIRLTGGEPLIRPDIQQIIEGLNECRSI-GLQHIGITTNAITLARKLPDLKAAGLDQINLSLDTLVSAKFEFITRRRGFEKVMKSIETALELYNPLKINCVVMRGLNDDEICDFVAFTENRAVDVRFIEYMPFGGNKWNTNKFFAYQEMLDRINARWPTLSRLSDKPNDTSKAYKVPGFVGQIGFITSMSNHFCNSCNRLRLTADGNLKVCLHGQSEVSLRDAIRSGTPDAELLEIIGAAVKRKKRQHA---DSGYAYKNRKTNNIG. 406
46 7.000e-96UniRef50_A0A0Q9WUX4 Uncharacterized protein, isoform C n=21 Tax=Acalyptratae TaxID=43741 RepID=A0A0Q9WUX4_DROVI  ali  36  57.....SVPQSQSQVPRAAAISPLTDSFGRHHTYLRISLTERCNLRCEYCMPEGVPLQPKAQLLSTEEVLRLARIFVEQGVRKIRLTGGEPTVRRDIVEIVAQL---KALPQLEHVGITTNGLVLTRMLLPLQRAGLDSLNISLDTLRKERFEQITRRKGWERVIAGIDLAIQLGYRPKVNCVLMRNFNEDEICDFVEFTRDRPVDVRFIEYMPFTGNKWHTERLISYSETVQIIRQRWPEFQALPNGPNDTSKAYAVPGFTGQLGFITSMTEHFCGTCNRLRLTADGNIKVCLFGNKEFSLRDAMRAGCTEQQLVELIGAAVQRKKRQHAGI------GSSRTM..... 388
47 9.000e-96UniRef50_A0A166IMQ9 Molybdenum cofactor biosynthesis prote (Fragment) n=8 Tax=Agaricomycetes TaxID=155619 RepID=A0A166IMQ9_9HOMO  ali  35  54.............ESRNPVSPFLQDSFGRKHDYLRISLTEKCNLRCFYCMPEGVDLAPKSHILTDDEIFRLAKLFVRSGVSKIRLTGGEPTVRQGILNIVERLSTLR-PLGLKAIGMTSNGIALHRKLPQFVANGLTHLNLSLDTLDPHKFEIMTRRPGHQAVLQSLEAALASGLESKLNVVVINGLNDYEVMDFVEMTKSKDIAVRFIEFMPFSGNKWDKSKIVPSAELLGRVLARHPSTQKISDLGNDTARSYKVPGYKGSFGFISSMSDHFCGTCNRLRVTADGQIKVCLFDGTEVSLRDQMRRGASDDELLHVIGHAVGNKKAKHAGME-NIDVLQNRPMILIG. 388
48 1.000e-95UniRef50_A0A1V0DJE8 GTP 3`,8-cyclase n=43 Tax=cellular organisms TaxID=131567 RepID=A0A1V0DJE8_9BACT  ali  35  22.APVSEVPQDLSYDPARSQARVLSDGFGRVHTYLRISLIEHCNLRCRYCMPEGLDWTPDEHLLTNAEIVRLARLFVAEGVTKIRLTGGEPLLRPGVEAIAEAIG---ALPGLQTLAITTNGLLLPKKLDRIRAAGVNLLNVSLDTLRPDRFEEITRRKGFDLVMKAIDMAVERYDPVKVNAVVMAGFNDDELPDFVAWTRERPVEVRFIEFMPFDGNRWDDGRLVSYEQML-ERIRAHFPLERLQDGPNDTSKTYRVPGHRGRIGFITSMTTPFCEGCNRLRITADGHLKVCLFGSAEVSLRDAMRGGATDDELREIISAAVGRKRARHAGMYNLAE-MKNRPMITIGG 368
49 2.000e-95UniRef50_T1FPI9 Uncharacterized protein n=4 Tax=Protostomia TaxID=33317 RepID=T1FPI9_HELRO  ali  33  52..............HVKPFSDFLTDLHHRQHTYLRISLTERCNLRCQYCMPEGVDLTSNDNLLKTDEMMKLAKLFVKEGIKKIRLTGGEPLIRKDIVEIVEQLNFLKQ-YGLEKLSLTTNGVLLHRYSEKLKEAGLDNLNISLDTLIKSKFEFITRRKGFEKVINNIDLAINTGFKSKINCVLMKNFNDDECTNFVELTKDKPLDVRFIEYMPFDGNKWNAAKFISYRDLFEIIKSAYPNIKPLENEFHSTSKSWKVDGYVGRIGFITSMSDHFCGGCNRLRLTADGNLKVCLFGNSEVSLKDALRLNYSDEDLLQIIGHAVKRKKAKHAGLDSL-TKLKNRPMILIGG 386
50 2.000e-95UniRef50_A0A1W3JKF3 LOW QUALITY PROTEIN: cyclic pyranopterin monophosphate synthase, mitochondrial-like n=2 Tax=Ciona intestinalis TaxID=7719 RepID=A  ali  37  68................EENGPVLMDTFNRKHTYLRISLTEKCNLRCTYCMPEGIELTPTDNLLTTEEILKLAQLFVKEGVTKIRLTGGEPLVRRDIAEIIGELNKLKSIPGLESIGITTNGTTLKRKLPLLKKGGLDSLNVSLDTLNPVRFELITRRRGWQRVMDGIMDAIDIGIPTKINCVVMNGMNEDEICDFVELTRDIPVDVRFIEYMPFDGNKWNENKMVSYKSMLKTIQSQFPVLHRLEDDPNHTSKGYRVEGHAGKFGFITSMSDHFCGTCNRVRITADGNLKVCLFGNSEVSLRDEIRSQKSDEELLEVIGAAVKRKKKQHAGMFNLAK-MKNRPMILI.. 403
51 3.000e-95UniRef50_A0A1W4WUH0 molybdenum cofactor biosynthesis protein 1 isoform X1 n=16 Tax=Arthropoda TaxID=6656 RepID=A0A1W4WUH0_AGRPL  ali  33  37...................DSPLLDNFGRQHSYLRISLTERCNLRCGYCMPEGVQLTPSEDLMSTDEIVKIARLFVEQGVRKIRLTGGEPTLRKDLVDIIAKL---KCIEGLENIALTTNGVVLTKKLAYLQRAGLDNLNISLDTLNKNKFETITRRKGWERVMMGIDLALQLGYPVKINCVVIKGFNENEVCDFVKLTKDKKLDVRFIEYMPFTGNKWEMGKMISYNDIIANIKLKWPEIYPLENGPNDTSKAWKIPGHLGQIGFITSMSEHFCGSCNRLRITADGNLKVCLFGNTEISLRDALRAGCSDDDLVTLISAAVKRKKKQHAERSNMNCKPSSVHMHS... 364
52 3.000e-95UniRef50_Q54NM6 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Dictyostelids TaxID=33083 RepID=MOCS1_DICDI  ali  35  58......................LTDRFNRHHTYLRISLTERCNLRCKYCMPEGVMLSQADKILTTDEIIRLSKLFVSAGVNKIRFTGGEPLVRKDVEPLIEEVGKIK---GLQKIGITTNGILLSRKLDRLHKAGVNLLNISLDTLNSDKFTLITRRLGWDRVFQSIDNALKLDNKVKVNCVIMKGLNDMEICDFVEMTRDKSVEIRFIEYMPFDGNLWSDKKFLSYTDMIKIIHEKYPTFKKEEEEPNNTSKTYHVPGFKGKVGFITSMSEHFCSSCNRLRITADGNLKVCLFGNTEVNLRDRIRDGASDQQLLEIINAAVLKKKASHAGMYEIAQN-KNRPMILIG. 384
53 5.000e-95UniRef50_A0A1I8D3V4 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8D3V4_9BILA  ali  32  10...................SSTLVDSFGRHHNYLRISLTEKCNLRCTYCMPEGVPLSPKNDILTNDEIIKLVTLFREEGVNKIRLTGGEPTLRKDLVQLVKDIN---SVGGIESIGITTNGIVFNRYAEDLVKAGLTHVNISLDTLDPNKYAILSRRNGFEKVIKNIEFSRSLFKTVKINNVVMRGINDNEVVDFVRMTRDKNLDVRFIEWMPFGGNNFNSKKMVSYKELLAKIDGEIAPIIKINDSPNDTSKGYKIQGWTGSFGFISSMTDNFCGTCNRMRLTANGHLKVCLHDNAEVSLKDMLRNNSSDDQIKETISNAVNAKKFKHAGME-NLKLMKNRPMILI.. 336
54 6.000e-95UniRef50_UPI00065B6544 molybdenum cofactor biosynthesis protein 1-like isoform X1 n=1 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B6544  ali  37  92...VRQSAKEKVATFDRPFSDFLTDTFGRQHRYLRISLTERCNLRCQYCMPEGVSLSPRQNILTTEEILSLSRLFVAEGINKIRLTGGEPLVRKDIITIIDGLNRLREL-GLKHIGITTNAVTLARRLPDLQAAGLDQINLSLDTLVPAKFEFITRRRGFDKVMKGIDKALELGYPMKINCVVMRGMNEDEICDFVDFTKDKKVDIRFIEYMPFGGNRWNTKKFVSYQEMLHMIHERFPDLTRLSDRPNDTSKAYKVPGFAGQIGFITSMSEHFCGTCNRLRLTADGNLKVCLHGNAEVSLRDALRENMPEAELLDVIGAAVKRKKKQHA................... 419
55 8.000e-95UniRef50_D5GII1 Uncharacterized protein n=3 Tax=Pezizomycotina TaxID=147538 RepID=D5GII1_TUBMM  ali  35  79...............AKPFSEFLTDGFGRKHTYLRISVTERCNLRCVYCMPEGVPLSPPAHLLSTPEILEIARLFVSQGVTKIRLTGGEPTVRKDVVELVEELGKLRSI-GLKELAITSNGIALHRKLQRMIDAGLTGLNLSLDTLDPFQFQIMTRRKGLETVLKTIDTALDMGFGEKINSVVMKGVNDHEIVDFVGMTRDKPIEVRFIEYMPFDGNKWSKNKMVSYNDMVSRIKEIYPTLQKLPSQPNDTSKTWGVPGFSGRVGFITSMTHNFCGSCNRLRITGDGNLKVCLFGEAEVSLRDMMRKYRNREELLQVIGKAVGNKKEKHAGM-GELENMKNRPMILIGG 436
56 2.000e-94UniRef50_A0A067CLK9 Molybdenum cofactor biosynthesis protein A n=4 Tax=Stramenopiles TaxID=33634 RepID=A0A067CLK9_SAPPC  ali  34  49.......RALVAQLQAAEKEDNLVDTFGRVHTYLRISLTERCNLRCQYCMPDGVPLQPADNMLTTDEIVRLASLFAAHGVTKLRLTGGEPLLRKDIVPLTQALH---AIPGIESVGVTTNGIALPKHSSALT-ALNTRLNISLDTLDARKFEHITRRKGFSRVMAAIEVAAASSVPVKLNCVVMRDFNLSEVADFVALTIDKPIDVRFIEWMPFDSNKWSDSTFVPYREMLARIEEAFPRTRKLADDDHDTAKAYAIDGARGRFGFITSMSEHFCGGCNRLRLTADGNLKVCLFGHTEVSLRDALRAGFSDDELRLIVQAAVKRKKFGGHGDMYGIASAKNRPMILIGG 391
57 2.000e-94UniRef50_A0A210PP57 Molybdenum cofactor biosynthesis protein 1 n=3 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PP57_MIZYE  ali  37  62............AERVGPSTDTLTDTFGRQHTYLRISLSERCNLRCQYCMPEGVELTPSQKLLSSEEILRLSEMFVKEGVEKIRLTGGEPLVRKDVVEIIRGLNEFR-DLGLQTIAMTTNGVTLARKLPALKEAGLDLINVSLDTLVPAKFEFISRRKGWDRVIKGIDTAIDLGYPVKVNCVVMRGLNEEEICDFVAFTKDKNVDIRFIEYMPFDGNKWNSKKMVSYLEMVDTIKARWPDFSRMQDHPNDTSKAYHVPGFTGQVGFISSMSEHFCGTCNRIRLTADGNLKVCLFGNTEVSLRDVMRASPDDAELRDVISAAVKRKKKQHA................... 380
58 2.000e-94UniRef50_A0A2E8QY23 GTP 3`,8-cyclase MoaA (Fragment) n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E8QY23_9PROT  ali  61  2......................LIDPFQRQVTYLRVSVTDRCDFRCVYCMSEHMSFLPKKELLSLEELDRLCSAFIALGVRKLRISGGEPLVRRGIMTLMRRLGRHLDTGALDELTLTTNASQLERYAEELVDCGVKRINVSLDSLDAEKFLAITRWGKFDKVMAGIEAARADGLRVKINTVALNGVNDDEIENIVRWCGEKDMDLTFIETMPMGEIDGDRSDQYLPLAQVRARLAKNWTLEESDHDIGGPAR................................................................................................ 232
59 3.000e-94UniRef50_Q2UQW9 Uncharacterized protein n=2 Tax=Aspergillus oryzae TaxID=5062 RepID=Q2UQW9_ASPOR  ali  33  72.....PSPRWTALKTAKPFSDFLTDTFNRQHDYLRISITERCNLRCVYCMPEGIELSPPARLLTSPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQSIGDLRR-NGLRELCLTTNGISLHRKLEPMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDKILEAGIKLKVNCVVMRGVNDREIIPFVEMGRDSPIEVRFIEYMPFDGNRWNQKKMLSYQEMLTVIREKYPTLEKVVDHKNDTSKTYRVPGFQGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDTIRKDERERELLEIIGMAVKRKKAKHAGM-GELENMKNRPMILIGG 453
60 3.000e-94UniRef50_A0A1B0CVY7 Molybdopterin cofactor synthesis 1 n=5 Tax=Nematocera TaxID=7148 RepID=A0A1B0CVY7_LUTLO  ali  36  25.......GAPPVASETVREVPTLTDTFGRNHTYLRISLTERCNLRCQYCMPEGVQLTRREELLSTEEMFKLAELFVREGVRKIRLTGGEPTVRKDIVDIVGGL---KKIPQLESVSITTNALILTRILVPLQRAGLDGLNISLDSLIPGKFERITRRKGFERVIAGIDLAIQLGYRPKVNCVVMKGLNEEEIVDFVAFTQDRNVDVRFIEYMPFTGNKWETDKMVSFRDMMTRIKEKFPDFHALPNGPNDTSKAFKVPTFAGQVGFITSMTEHFCGTCNRLRITADGNLKVCLFGNTEISLRDALRGGCSESDLIAMISAAVNRKKKQHAGGAPQLDGM.......... 354
61 3.000e-94UniRef50_A0A151I1C7 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Atta colombica TaxID=520822 RepID=A0A151I1C7_9HYME  ali  34  27...TPSRLQQLRAKLREDEHEILTDTFGRKHTYLRISLTERCNLRCTYCMPEGVKLTKKEGILKTDEIIQIADLFVKEGVRKIRLTGGEPTIRKDIIDIIGQLKQLRD---LDQVAITTNGLTLTRQLPALQKAGLDALNISLDTLKEERFELFTRRRGWAKVMASIDLAVQLGYPVKINCVMMRGRNDDEIIDFIDFTRDRPVDVRFIEYMPFQGNQWKENKMISFNEMKAIIREKYSDFQALPNQPNNTSKAYHVPGFIGQVGFITSMSQHFCDSCNRIRITADGNLKVCLFGKGEVSLRDALRSGISENALKNLIRRAISRKKKQHAGMF-NLTQMENRPMILIG. 370
62 4.000e-94UniRef50_A0A1E3P7T4 Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3P7T4_WICAO  ali  28  19.....SAKRWDAVKNAKPITHFLTDNFNRRHDYLRISITERCNLRCLYCMPEGVPLQADSQILSTDEIIQIAEMFVKQGVKKIRLTGGEPTVRKDILEIMESLN---QIEGLNEICITSNGIALNRKLPKLAKSGLTSLNLSLDTLVEGKFTLITRRNGLSNVLKSLETALKLGIPKKLNVVIIRGLNDDEILNFVKLAQYYPLEVRFIEYMPFDGNKWEVEKVISFKEIIDIIKTKHPIIEQLTHKYGETSKIFQIPGFKGKLGFITSMTSDFCGDCTRLRITSDGNLKVCLFGNDEVSIKNLLRAGVDESEILEVVGKAVKGKKEKHAGLDEL-PKMANRPMILIGG 360
63 4.000e-94UniRef50_A0A2G1QQ97 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A2G1QQ97_9RHIZ  ali  53  1MGPMPMTPDRSIPTTPARSQPTLTDTFGRAITYLRLSVTDRCDLRCTYCMSEHMTFLPRKDVLSLEETYRLAETFMRLGVRKLRLTGGEPLVRKNIMTLLAQLKPHLEARDLDEVTLTTNGTLLARYAAALKQNGVTRVNVSLDTLDPDRYRAVTRWGDLARALSGVDAALAEGLSVKLNAVVQKGLFERDAADLIAFAHGRGMDLTFIEAMPLGGALDDYGANHLPLTEAEAWLRARYTLTPVTKKTGGPARYMRVGETGGLIGFIAPLSCNFCASCNRMRVSCTGQLFPCMGDDGAVDLRAALRGGEGPEQLEQAILGAVAAKPRGHGFGDGTVSGGLSRPMSHLGG 351
64 5.000e-94UniRef50_A0A2D4C6L5 Molybdenum cofactor biosynthesis protein A n=2 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4C6L5_PYTIN  ali  35  92................VPVPHQFVDRFGRAHTYLRISLTERCNLRCRYCMPEGVPLQPQDDLLSTTEIVRLASLFAASGVTRIRLTGGEPLLRRDLVDLVTQL---RSIPGITSVGITTNGIVLQKKLAALQHAGVDRLNISLDTLRADRFAQITRRQGFQRVMDAIRDAQTMGFPLKINCVVMRDVNLDELLDFVAFTEHNAVDVRFIEWMPFDSNKWNDTTFVSFDEMMTRIRDKYPTIAKLADDANDTSKAFHVPGSRGQFGFITSMSQHFCGTCNRMRLTADGNLKVCLFGNTEVSLRDALRYGVADADVQRIIDVAVKRKKFGGHGDMYGISKAKNRPMILIGG 425
65 7.000e-94UniRef50_A0A2P6VSJ7 Cyclic pyranopterin monophosphate mitochondrial n=2 Tax=Chlorellaceae TaxID=35461 RepID=A0A2P6VSJ7_9CHLO  ali  32  179...WREVVAAARRHQEVSGAEMLTDTFGRRHSYLRISLTERCNLRCLYCMPEGVDLTPSQKLMSTEEVVRVARLFAAAGVDKIRLTGGEPTLRSDLVELTARL---ATLPGVKDVGLTSNGLTLGRKLPALKEAGLSLLNISMDTLRAPRFTAMTRRQGHDRVLASIHKAVELGYPVKVNVVVMRGVNDDEVPAFVELTRDSPINVRFIEYMPFDGNVWSDSKMVPYRDMLGTVEARFGDLERCADPRGEVAKNFRVPGFRGTVSFITSMTKAFCSDCNRLRIMADGNLKVCLFGANEVSLRDAMREGATDGDLRAIVSAAVDRKRAAHAGMFELAATA-NRAMVKIGG 522
66 9.000e-94UniRef50_D8PQD3 Uncharacterized protein n=3 Tax=Agaricomycetes TaxID=155619 RepID=D8PQD3_SCHCM  ali  34  5LAPIP--LTHGLPHASTRHVPTLVDSFNRRHDYLRISLTERCNLRCFYCMPEGVELSPTGKLLTDDEVVRLAELFVRTGVTKIRLTGGEPTVRKGITDIIARLHTLRKL-GLKSLAMTSNGIALHRKLPCMVDNGLTHLNLSLDTLDPDKFMIMTRRRGHEAVLRTLDEALNNPRQVKLNIVVIKGLNDAEVFDFIELTKDRPLSVRFIEFMPFTGNKWDQQKMLSSSELLERISRRHPDIVRVTDEANDTARSWALPGYKGSFGFISSMSDHFCASCNRLRITADGNIKVCLFDAKEISLRDRMRAGASDAELLDLIRIAVLGKQEKHSDMQ-DIDVKTNRPMILI.. 350
67 1.000e-93UniRef50_F4PX68 Molybdenum cofactor synthesis 1 n=29 Tax=Eukaryota TaxID=2759 RepID=F4PX68_CAVFA  ali  33  100...................DELLTDTFGRKHTYLRISLTERCNLRCQYCMPEGVQLQPSENIMTDQEIIKLSRLFVSAGVTKIRFTGGEPLVRKNIESMIEEIG---KIKGLETIAMTTNAIALGRKLERLQKAGLNLLNISLDTLDANKFTIITRRLGWDKVKESIDKALSLFNPVKINCVVMKNINHYEINDFVEMTRDKPIEVRFIEYMPFDGNRWSDQKFVSYKEMLDIIKTKYETIEKIPDHPNNTSKTYQVPGFRGKVGFITSMSEHFCGSCNRLRLTADGNLKVCLFGNDEVSLRDLMRHGVSDDDLLLIINQAVLKKKASLGGNMHEISQNKNRPMILIGG 431
68 3.000e-93UniRef50_Q8IQF1 Molybdenum cofactor biosynthesis protein 1 n=103 Tax=Opisthokonta TaxID=33154 RepID=MOCS1_DROME  ali  38  58...................NSPLTDSFGRHHTYLRISLTERCNLRCDYCMPEGVPLQPKNKLLTTEEILRLARIFVEQGVRKIRLTGGEPTVRRDIVEIVAQ---MKALPELEQIGITTNGLVLTRLLLPLQRAGLDNLNISLDTLKRDRFEKITRRKGWERVIAGIDLAVQLGYRPKVNCVLMRDFNEDEICDFVEFTRNRPVDVRFIEYMPFSGNKWHTERLISYKDTLQIIRQRWPDFKALPNGPNDTSKAYAVPGFKGQVGFITSMTEHFCGTCNRLRLTADGNIKVCLFGNKEFSLRDAMRDSVSEEQLVDLIGAAVQRKKKQHA................... 367
69 3.000e-93UniRef50_A0A2A9NVD2 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NVD2_9AGAR  ali  33  7.....ASERIALVDKSNLMSPMLVDTFQRKHNYLRISLTERCNLRCFYCMPEGVELSPAGKLLTNEEVLRLATLFVKSGVTKIRLTGGEPTVRKGLDDIISALNALR-PLGLQAIAMTSNGLALYRRLPELVEKGLSHLNLSLDTLDPYRFEIMTRRRGHDAVLRTLDLALSLPLKSKLNVVVIRGLNEDEILDFVEMTKDNPISIRFIEFMPFTGNKWEKQRMVPSSQLIQQISERHPSLSRGSAELNETAQTWKIPGYQGNIGFISSMSDLFCSTCNRLRLTADGQIKVCLFDPKEVSLRDELRRNATDEELLSVIGQAVKGKHEKHAGME-NIDVINNRPMILIG. 349
70 6.000e-93UniRef50_A0A2D7CPJ3 GTP 3`,8-cyclase MoaA n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7CPJ3_9PROT  ali  56  1................................................................................................MNLIASLSRHITSGKLEELTLTTNGSQLSKYAQQLADNGVKRLNVSLDTLDREKFKKITRWGDLDQVLAGLNAAKSAGLNVKINTVALNGTNNDELKDMLTWAGDNGYDMTIIEVMPMGDISETRIDQYLPLNAVRNDLSKYFTLEDIDYKTGGPARYTRVKETGGRLGFITPLTHNFCESCNRVRVTCTGTLYMCLGQDDDADLKTPLRNSEGDEAVVRAIREAILRKPKGHDFIIAAVDP-VTRHMSVTGG 256
71 7.000e-93UniRef50_A0A183V249 Uncharacterized protein n=2 Tax=Chromadorea TaxID=119089 RepID=A0A183V249_TOXCA  ali  33  33....RPVLADEFAPSAENTVEGLVDAYGRRHTYLRISVAEKCNLRCTYCMPEGVPLNPSHKLLSADEIVRIATIFAANGVTKIRLTGGEPTLRKDIVDIVGRLSV---IPGIEQVGMTTNGIALPQKLEALVDNGLKKLNISLDTLNEAKYMIMTRRNGFKKVIKSINLAESMFDQVKINNVIIRGINDDELIDFVALTQYRKLDIRFIEYMPFGGNKFEVRKMVPYREMLKVIDKSFPMIIKLKDQPNDTSKAYSVHGFRGKIGFISSMSEHFCSSCNRLRVTSDGNLKVCLHGNSEVSLRDVLRAGASDTQLETIVREALSRKKKQHA................... 356
72 8.000e-93UniRef50_B0CRH2 Predicted protein (Fragment) n=15 Tax=Fungi TaxID=4751 RepID=B0CRH2_LACBS  ali  36  1.....................FLIDSFQRKHDYLRISLTERCNLRCFYCMPEGVELSPQGKLLTDQEIIRLASLFVDNGVTKIRLTGGEPSIRRGILELVRNLHALK-DRGLESIAMTSNGVALHRRLPQLVEYGLTHLNLSLDTLDPFKFELMTRRRGHDAVLKSLDVALRSPASVKLNAVIIKGLNDSEILDFVNLTKDKRISVRFIEFMPFTGNKWDKEKMIPSSELLRRITAHYPDVTRMLDKPNDTAKSYKVPGFQGNFGFISSMSDHFCSTCNRLRLTADGQIKVCLFDPNEVSLRDAMREGSSDKELINKISLAISGKKAKHAGM-NDIDVIKNRPMILIG. 327
73 9.000e-93UniRef50_F8PFY6 Uncharacterized protein n=13 Tax=Agaricomycotina TaxID=5302 RepID=F8PFY6_SERL3  ali  35  46.............DSRTPISPSLIDSFHRRHDYLRISLTERCNLRCFYCMPEGVELSPPQHLLTDSEVIRLATLFVKGGVTKIRLTGGEPTIRKGIIEIIGRLDELR-VHGLKSIGMTTNGLILHRRLPEFVANGLTHINLSLDTMDPFKFEIMTRRRGHEAVLRSLEAALLSPDSVKLNVVVMKGLNDHEVVDFVEMTKGHNLSVRFIEFMPFTGNKWDKAKMVPSSELLANIANRYPDIARAPGKINDTARSWKIPGYRGSIGFISSMSDHFCASCNRLRLTADGQIKVCLFDAKEISLRDEMRGGASDTELLQLISSAVRGKKEKHAGME-DIDVVTNRPMTLIGG 382
74 2.000e-92UniRef50_A0A1Y2IYK9 Molybdenum cofactor biosynthesis prote n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2IYK9_PYCCO  ali  34  55............AERGAAVSPFLVDSFKRQHNYLRISLTERCNLRCFYCMPEGVELSPPEHILTDDEVIRLATLFVQSGVTKIRLTGGEPTVRKGIVDIVGRLNELRK-YGLQSIGMTTNGIALHRKLPLLIENGLTHLNISLDTLDPFKFEIMTRRMGHDAVLRSLETAYKELRSVKLNVVVVQGMNDHEVLDFVEMTKERRLSVRFIEFMPFTGNKWDKHRMVPSADLLTRIRSRYPAVCKAPDELNDTARSYIIPGHAGSFGFISSMSDHFCGSCNRLRLTADGQIKVCLFDAKEISLRDQMRAGADDSTLLATIGRAVMGKKEKHAGME-DIDVVTNRPMILIG. 391
75 4.000e-92UniRef50_Q7RW32 Molybdenum cofactor biosynthesis protein 1 B n=16 Tax=leotiomyceta TaxID=716546 RepID=Q7RW32_NEUCR  ali  31  102.APTPTSSRRDMLKDAKPFSDFLTDNYNRQHDYLRISVTERCNLRCLYCMPEGVPLSPQKELLTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGALR-PHGLKELCLTTNGLSLHRKLDAMVEAGLTGINLSLDTMDPWQFQLMTRRNGFSAVQKSIDRIFEAGIKFKINCVVMRGLNDREVLPFVEMTRDKNVEVRFIEYMPFDGNKWNKGKMFSYQEMLELIRSKYPDLQRIQGHKNDTSKTFQVPGFAGKVGFITSMTHNFCGTCNRLRITSDGNIKVCLFGNAEVSLRDILRKINNSEELLNVIGMAVKNKKEKHAGI-GELENMKNRPMILI.. 486
76 5.000e-92UniRef50_T1JPP1 Uncharacterized protein n=2 Tax=Tetranychus urticae TaxID=32264 RepID=T1JPP1_TETUR  ali  34  40.....................FLQDSFGRKHDYLRISLTERCNLRCSYCMPEGVILSPKESLLQRDEIIRLAKLFVALGVKKIKLTGGEPLVRSDCIQIVADLTALKAS-GLLNIGITTNGLVLGRSIKKLVESGLDSVNISLDTLRPEKFEFITRRKGFSAVFNSIERCLEADLPKKINCVVMRGLNDDEILSFVELTQHKKLEVRFIEYMPFDDNKWSYGKMFPAHEIMATIKSKYEVKSLPKDHPSDTAQLFQVNGFQGKIGFIGSMTQNFCGACNRLRIAANGNLKVCLFGSEEVSLRDPLRSGWSDQEIIKLIQSALSKKRERHAGAINISKS-TNKPMILIGG 369
77 6.000e-92UniRef50_UPI00084A6B2B molybdenum cofactor biosynthesis protein 1-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084A6B2B  ali  32  45...........LKQPLLPFSAFLTDSFARQHNYLRISLTERCNLRCQYCMPEGVPLSPSEQMLSTPELLRLTKLFVSEGIDKIRLTGGEPFIRKDLAHIVENI----AAMGVKHIGITTNGLVLKQRLGELVTLGLTHINISLDTLVPQKFEFITRRKGHQRVMDGIQVALAAPQAVKLNVVVMRGTNDDELVDFVRLTEQQPLDIRFIEYMPFDGNRWQAARMMPYSEMLSTITQKFPDTQRISDKPNDTSKAYKVPGFAGQFGFISSMTDNFCGSCNRLRLTADGSLKVCLFGPSEVSLRDAVRGGATDEELLALVGAAVRGKKKQHAGMAVLATQ-KNRPMILI.. 377
78 6.000e-92UniRef50_A0A1I4SS80 GTP 3`,8-cyclase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1I4SS80_9DELT  ali  38  6.......................IDAHGRTVDYLRISITDRCNLRCIYCMPEGVPRLSHEDVLSYEEIIRILNVAGSIGISKVRVTGGEPLVRKGVVEFCRSLV---EIVGRGCVSITTNGVLLEEFAWDLWNAGIRRINVSLDTLKRERFAEITRRDYFNRVWNGIMTAYRIFHPVKLNVVVIKGLNDDEIEDLAALTFEYPFHVRFIEFM-PFGSGEWSSRFVSSDEIVERLKNVGELLPAVSLNSNGPAKYYAFRGALGKVGIISPISHHFCATCNRLRLTADGKLRTCLFATKETDLRAILRSSEDDEKLKEAIVRALKEKPEKHGLNEELFHKCIGRPMIKIGG 329
79 1.000e-91UniRef50_G2XWY6 Uncharacterized protein n=74 Tax=Eukaryota TaxID=2759 RepID=G2XWY6_BOTF4  ali  32  68...............AKPFSSFLTDNFQRQHDYLRISITEKCNLRCLYCMPEGVPQSPQPDLLTTPEIVLLSSIFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRS-HGLRELCLTTNGLNLARKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMKSIDRILHAGIKLKINCVVMRGVNEREIVPFVEMGRDKDVEVRFIEYMPFDGNKWSQGKMLSYKEMLDIIRQKYPTLRKVADHKNDTSKTYEIPGFVGKMGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRSSSNERELLEVIGMAVSRKKEKHAGM-GELENMKNRPMILIGG 440
80 1.000e-91UniRef50_A0A1Y0H3E8 GTP 3`,8-cyclase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0H3E8_9BACT  ali  38  3.....PRGDLPHNPTVTTRADLLTDRFGRFHDYLRVSITDRCNFRCVYCMPEGVAWQPREDILTFEEIERLARFFVERGVRKIRLTGGEPSLRKGYLNLVEAL---AAIPGLRQLALTTNGTRLAQDAVALKAAGLASVNVSLDTLRQDRFLEITRRDELPRVLQGIEAAHAAGLKIKVNVVVLPGVNEDEIIHFGEFACEHSLTVRFIEFMPFLDNGWSAERVVTSAE-IRARLSNQFELQLLASGASDLAREYAINGSEGRVAFVSSVTESFCSGCNRLRLTADGQLKSCLFLPPSVSLRDLIRGGAPDAELETAVQECLDGKWSAHPPMRNWAQR-DNLTMVQIGG 342
81 1.000e-91UniRef50_A0A1J1I6M2 CLUMA_CG009292, isoform A n=2 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1I6M2_9DIPT  ali  35  53....................SPLTDSFGRFHTYLRISLTEKCNLRCQYCMPEGVQLSPKDNLLTTDEIILISKLFVEQGVTKIRLTGGEPTIRKDLIDIITRL---RALESLENIGITTNGLVLTRNLVNYQRAGLDSLNISLDTLKPKKYEEITRRRGWERVIAGIDLAVQLGFKPKVNCVVMKNFNEDEVCDFVEWTKDRAVDVRFIEYMPFSGNRWHTEKMLSYREMLEMIHEKFPEFKELPNGPNDTSKAYHVPGYKGQVGFITSMTEHFCGSCNRLRITADGNLKVCLFGNKEISLRDAIRSGCSEDDLLALIGAAVMKKKKQHAFYSPIGLNYNKIQM..... 377
82 1.000e-91UniRef50_A4J6S5 GTP 3`,8-cyclase n=59 Tax=root TaxID=1 RepID=MOAA_DESRM  ali  38  1......................MIDNYNRNINYLRISVTDRCNLRCVYCMPEGVKQTPHSEILSLEEFARVVDAASDIGIRKIRITGGEPLVRKNIVNLFEKISTNSA---IDDISLTTNGVLFAEMASDLKKAGLNRVNFSLDSLNPDTFRDITRMGKFNDVWRSIQKALELEHPVKLNVVAVRGINDHEFADFARLTKEIPIHVRFIELMPIGECNPWAVGNFIAAEEILHGLQQKFGLLQVKVTGSGPAKYYCLPNSKGTIGFITAISEHFCAGCNRLRLTANGQLRPCLYGKQEFDLKTPLREGASRQELAKIITKAIRHKPSQHHMEDGWRDR---RVMSQIGG 325
83 2.000e-91UniRef50_T2M4C2 Molybdenum cofactor biosynthesis protein 1 (Fragment) n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2M4C2_HYDVU  ali  35  87...........VPHDKKTFSSFLTDSFGRKHNYLRISLTERCNLRCGYCMPEGVLLTNKDDLLTNEEMIRLARLFVFEGVNKIRLTGGEPLVRKDIVQICDQLSSLK---GLKTLAITTNGLVAEQKLLYLKQAGLTNVNISLDTMIEKKFEFISRRKGLTKVFNAIEKAIELKFNSKINCVVMKGLNDDELIEFVNFTQNKPVDVRFIEYMPFDGNKWAPVKFVPYGEMLKLIFQKFPDIVKVEDDPNDTAKTYKVPDFKGRFGFITSMSEHFCGTCNRLRLTADGNLKVCLFGPNEVSLRDLIRSGASDTDLLNIISIAVGSKKKQHAGM-HTLANTKNRPMILV.. 420
84 4.000e-91UniRef50_A0A2P7ZMG0 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P7ZMG0_9PEZI  ali  32  56...LPPLDRRKAIAQAPAFSSFLTDTFGRQHDYLRISLTERCNLRCTYCMPSGVPLSPPSELLTSAEIVYLSSLFVAQGVQKIRLTGGEPTVRKDFLALLGQIGALKSR-GLKELAITTNGLVLERRLERMVEAGLTGVNISLDTMDPGMFQIMTRRKGWENVMRGIEKVLKAAVKLKVNCVVMRGVNDREVVDFVEFTRDRDIEVRFIEYMPFDGNKWSQKKMVSYGEMVDMIKEKYPTLRRVGEGKNETSKTWEVPGFKGKLGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDMIRKDMDEEELLDIIGMAVKRKKEKHAGM-GQLENMKNRPMILIGG 440
85 7.000e-91UniRef50_UPI0008F9DE82 molybdenum cofactor biosynthesis protein 1 isoform X1 n=2 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9DE82  ali  35  45.TPIQESIKYKTSSHIKEANPSLTDSFGRKHTYLRISLTEKCNLRCQYCMPEGVKLTEKSRLLTSDEIIKLASLFVQEGVTKIRLTGGEPTVCKDIIHIVECL---RKLSGLNNLGMTTNGLALTKLLPALQRAGLDSVNISLDTLKPEKFEIMSRRKGWGRVVAGIDLAVQLFQQPKVNCVVMRGVNDDEVMDFVEFTRDRPVDVRFIEYMPFTGNKWNDSKLVTFKEMLTAIKSKYPSMTPLDNQKHDTSKAYKIPGFQGQIGFITSMSNHFCGTCNRLRLMADGSLKVCLFGNSEISLRDMLRSGMSQDDMLAMIQVAVRRKKQQHA................... 373
86 1.000e-90UniRef50_E8R2S4 GTP 3`,8-cyclase n=14 Tax=Planctomycetales TaxID=112 RepID=E8R2S4_ISOPI  ali  43  17.......................IDGFGRIHNNLRISVTDRCNIRCVYCMPETVQFLPRAEILSFEEIERVVRVAVGLGINKLRLTGGEPLVRRDLTKLVARLT---AIPGIQDVGLTTNGLLLGPLAQPLWDAGLRRINVSLDTLDPVSFRELTRRDGLEQVIEGILAAKRAFDPVKINAVAIKGVTESQVVPLARFCREHHLEMRFIEYMPLDAENRWERDKVLFAEEILNLLTEAFGPLRPSPNQDAPAQDYDYLDGGGRVGLIASVSRPFCASCNRVRLTADGKLRHCLFALEETDLRALLRGGADDETIAQAIRDNVAAKWEGHEINTARFIKPE-RLMHSIGG 341
87 1.000e-90UniRef50_A0A1V5MC57 GTP 3`,8-cyclase n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5MC57_9BACT  ali  39  4.....................PLIDSFGRLHTYLRISVTDRCNLRCRYCMPEGLQWKKREELLSFEEIERLAAIFVGMGVTKIRLTGGEPMLRRDFPDLVAKLAGLKASTGLKDLAMTTNATLLAGQASLLKEKGLSHINISLDSFKPERFEQITRLSCFDAVKAGLHEAIAAGFKLKLNMVVIAGFNDDEILDFAAFAREHKINVRFIEFMPFKDN-DWQIDKVVTFKEMKASLDKHFKLSPAKQEVGDVARDFDLAGG-GSLSFITSMSESFCSSCNRLRLTSDGSMKSCLFYPAEINLRDAMRQNASDEELRGMIRGCLAGKPEAHPPAEEIAAR-DNRSMIEIGG 334
88 1.000e-90UniRef50_A0A231M7L7 Uncharacterized protein n=1 Tax=Aspergillus thermomutatus TaxID=41047 RepID=A0A231M7L7_9EURO  ali  32  28........RWTALRSARPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPAHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMRSIGELRR-NGLRELCLTTNGISLHRKLEDMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFEAVMKSIERILEAGIKLKINCVVMRGINDREIIPFVELGRDSPIEVRFIEYMPFDGNKWSQGKMFSYQEMLAVIREKYPSLEKVVGHKNDTSKTYRIPGFQGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDIIRKENDEQELLGLIGMAVKRKKAKHAGM-GELKNMKNRPMILI.. 404
89 2.000e-90UniRef50_Q65DY5 GTP 3`,8-cyclase n=87 Tax=Bacteria TaxID=2 RepID=MOAA_BACLD  ali  38  3.................TNSEQVLDQKSRPLRDLRISVTDRCNLRCTYCMPQDYPFLPKGELLSFEELERLAKLFVHFGVEKIRLTGGEPLMRKDMPELVGKLAGIK---GIRDIAMTTNGVLLPVYADKLKKAGLKRVTVSLDSLDDERFKSINGRGSVSKVLAGIEAAKKAGLGVKINMVVQKGVNEKDILPMARYFKEKGHILRFIEFMDVGNTNEWNRQSVVAKADIIRIINEDMPIEPIPNYEGEVAKRYRYLDGSGEIGFISSVSDAFCTTCNRARLSAKGELFTCLFASSGFDLRTLIRSGQTDQELAEAIGTVWRNRDDQYSLDRALAKPRKKVEMSYIGG 341
90 3.000e-90UniRef50_A0A0F0I8D8 Uncharacterized protein n=1 Tax=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) TaxID=1403190 RepID=A0A  ali  33  72.....PSPRWTALKTAKPFSDFLTDTFNRQHDYLRISITERCNLRCVYCMPEGIELSPPARLLTSPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQSIGDLRR-NGLRELCLTTNGISLHRKLEPMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDKILEAGIKLKVNCVVMRGVNDREIIPFVEMGRDSPIEVRFIEYMPFDGNRWNQKKMLSYQEMLAVIREKYPTLEKVVDHKNDTSKTYRVPGFQGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDTIRKDERERELLDIIGMAVKRKKAKHAGMGKL-ENMKNRPMILIGG 453
91 4.000e-90UniRef50_A0A075KAH5 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A075KAH5_9FIRM  ali  39  4......................LYDIVGRRIHYLRVAVTDRCNFRCQYCMPDGVKWTEHDNILRYEELLRIIHAFTSLGIDKVRITGGEPLVRKGLIPFLKKVT---AIAGIKEVVLTTNGSMLEEYAPLLKKAGVKRVNVSLDTLYPERFKQITGQDALHQVLAGIKKAQAVGTPIKINMVVMKDFNSDELADFANLAMENPYQIRFIEYMPFCSDKNY---LFTAAEIKQQLITAGFTTMLPEVSNNSPAQVYRFPQSQGSIGFITPVSQHFCSSCNRIRLTPDGNLKPCLLSNQEYSLRDVLRAGISDQELLDTIRQVVWNKPMEHELKKG---KKSERGMYRIGG 323
92 4.000e-90UniRef50_U9UMQ3 Uncharacterized protein n=7 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UMQ3_RHIID  ali  33  56..........STIDKERPFSNFLTDRFDRQHTYLRISITERCNLRCTYCMPEGIDLTPYHKLLSTEEIIRIAQLFVSQGVNKIRLTGGEPTIRKDIVELIGELSKLK-PQGLQTIAMTSNGIALKRKLPKLVENGLNLLNISLDTLNPYKFELISRRKGLEKVLETIEQGIALGRPLKINCVVMRGVNDQEVPDFIELTRNKPIEVRFIEYMPFDGNKWNKNKLVSYRELLNDIRTRYNDVRKLSDDLHNTSKTYYIPGFTGQFGFITSMSDHFCGTCNRLRITADGNLKVCLFGNAEVNLRDLLRENVPDHQLLDIIGAAVKNKRKQHA................... 385
93 4.000e-90UniRef50_A0A1M4MA29 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A0A1M4MA29_9FIRM  ali  38  1......................MKDSFGRSINYLRISVTDLCNLRCKYCMPEGICKVEHKDILSLEEIYEIAKVFVSLGINKIRLTGGEPLTRKGFVNLVEKLGN---LDGIKDLAMTTNGILLKKYARDLKSAGLNRVNISLDTLDEEKYSQITRGGRLKDVLDGIDVAKSVGTPIKINTVLIGGFNVNEIEDFVNLTRADEIDVRFIELMPVGEASKWAEENFVSNEVILDKVNTLKSVERLDP--SSPAVYYKLPGAKGRVGIINPISCKFCDYCNRVRLTSQGKLKLCLHSNEEIDLKDKLRQG---EDIEKIILNAIKQKPEAHHLEDGQYITD---SMYQIGG 318
94 6.000e-90UniRef50_B5YJ09 GTP 3`,8-cyclase n=34 Tax=root TaxID=1 RepID=MOAA_THEYD  ali  38  1......................MKDNFNRNIDYLRISIIDRCNLRCIYCMPEETNLLPHHEILSYEEILKIVEIGVDLGITKIRITGGEPLLRKGIVSFIERL---ARIEGIRDIGMTTNGVLLKKFAKDLYNAGLKRVNVSLDSLDENKFRAITRVGLIDDVFEGIDEAKNAGQPVKVNVVVMKGINDDEIEKFALWSKKVEYQIRFIEFMPVGQNAWKKELFISKDEIKERIENKIGKLIPVQMKKSGPAEYFMLAGAKGFLGFISPMTTHICVRCNRLRLTADGKLRPCLFSDKEVDIKKILRSGASTEEIRETIIKTIHLKPQGMSEH-----TKPLRPMSTIGG 322
95 6.000e-90UniRef50_L8H770 Molybdenum cofactor biosynthesis protein A, putative (Fragment) n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H770  ali  33  48....EPSSVLSATTQPATADSILADNFNRHHNYLRISLTERCNLRCVYCMPEGIDLQPNDKILTKDEIVRVARLFVDAGVDKIRFTGGEPLVRKDLEDIVSEVG----ALPLRALAMTTNAITLARKLPKLHKMGLNQLNISLDTLDSEKFTQITRRKGWEKVMEAIDMAVDYGYPLKINCVVMRGVNDNEIVDFVKMTRDKPIQVRFIEYMPFDGNRWNDQKFLSYKEMIEIIKRDFGNLRLPDPTPNETAKTWSIPGFAGSVGFITSMSDHFCGSCNRLRITADGNLKVCLFGSSEVSLRDAMRVGATDAELSRMINAAVKRKKEHHGAAESS.............. 382
96 6.000e-90UniRef50_A0A074Y898 Uncharacterized protein n=1 Tax=Aureobasidium subglaciale EXF-2481 TaxID=1043005 RepID=A0A074Y898_9PEZI  ali  30  45...SPQDDRRQAIKQAKPFSDFLTDKFKRQHDYLRISVTERCNLRCLYCMPEGVPLSPSRHLLTTPEIVYLSELFVSQGVTKIRLTGGEPTVRPDILPLMQQIGSLKTK-GLRELALTTNAISLHRKLDKMVEAGLTGVNISLDTLDPFQFQILTRRKGHSAVMKSIDRVLEAGIKLKVNCVVMRGINERELVPFVEMGKEKDIEVRFIEYMPFGGNKWSERKMLTYQEMLDIIREKYPTLRSVKGHLNDTSKTYEIPGFVGKIGFITSMTENFCGTCNRLRITGDGNLKVCLHGNTEVSLRDLLRKDNNNDELLNFIGEAVKRKKEKHAGMEEL-QNMENRPMILIGG 429
97 7.000e-90UniRef50_A0A1F8RE71 GTP 3`,8-cyclase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8RE71_9CHLR  ali  39  1.....................MALDRFGRDIHYLRISLTDRCNLRCVYCMPEDMQFRPRKELMQDDELLHLVRLFTELGFHKFRLTGGEPTVRANIVELVRGI---ARAPGVRSLSMTTNGLLLKQLARPLAEAGLQRVNVSIDSLDPAKFKRLTRWGDVQDVWEGIVEAEAAGAPMKLNAVIVRGYNEDDVADLAALTLYHDWQVRFIEMMPFGEVAGFQQAQVVAAQEMRAKIEAALGTLIPVDKLDGEARLYRLADGLGDVGFISSVTEPFCASCTRARLTADGKLRMCLLREYEVDLLTPLRQGATIDDLKALINKAVWHKPWGHGL--AHNIVPMNRVMSEIGG 326
98 8.000e-90UniRef50_UPI000CF7E458 molybdenum cofactor biosynthesis protein 1 isoform X2 n=1 Tax=Oryzias melastigma TaxID=30732 RepID=UPI000CF7E458  ali  36  90................QPFSTVLTDSFGRHHNYLRISLTEKCNLRCQYCMPEGVKLTPRSQLLSTSEVLTIARLFVQEGVDKIRLTGGEPLIRPDLLDIIIEL---RKLNGLKTIAVTTNGIHLAKPLSRLKEAGLDLINISLDSLVPAKFEFIVRRRGFHKVMEGIDKAIELGFPVKINCVVMRGLNEDELLDFVRLTEKKPLEVRFIEYMPFDGNKWNFKKMM-----------------------------FKVPGFEGHLGFITSMSEHFCGSCNRLRITADGNLKVCLFGNSEFSLRDALRSGASDEELLQVIGAAVGRKKKEHAGMFKISQMM-NRPMILI.. 389
99 9.000e-90UniRef50_A0A2N3LDW2 GTP 3`,8-cyclase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2N3LDW2_9BACI  ali  36  1.....................MITDQFNRPLHDLRISVTDRCNFRCQYCMPPDFPFLSKNEVLSFEEIERLAKLFADLGVKKIRLTGGEPLLRRGLPELIEKLT---RIEGITDMGLTTNGLLLSRLAEDLYDAGLRRLNISLDALDDNIFKKLNGRGVSSRILAGIDKACEMGFEVKVNMVVQRGVNDQEIVPMAAYFREKGISLRFIEFMDVGNSNGWNMEKVITKKEMYEILSSHFELEPVDAYFGEVAKRYRFKESNAEVGFITSVSESFCSSCTRARISADGKLYTCLFASHGTDLRAFLRDRSSDETIKTKITSIWSKRADRYSDQRNNLQTPKKIEMSYIGG 333
100 1.000e-89UniRef50_A0A271J4H1 GTP 3`,8-cyclase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A271J4H1_9BACT  ali  36  2....................SPLTDSFGRRHTTLRLGLTERCNLRCVYCMPEGVPLTPTRQMLSTDEIERLARVLAEVGVDKIRLTGGEPLVRKDAVEVAERLGR----LGLRSLALTTNGLLLEDRLPDLRAAGLTDLTLSLDTLRADRFEAVTRRPGLDRVLSALDAALRLGYRIKVNVVALRGVNEDEAVDFADWAAREPIEVRFIEVMPFDGNGWDRSELVPYAETRARIEDVHGPLDALDDGPHSTARTFSRPGWRGRVGFVASMTVPFCAGCNRLRVTADGALKVCLFGAREVSLRDAMRGGATDADLLELVRRSLAGKARAHAGMDVLAAT-ENRPMITIGG 332
101 2.000e-89UniRef50_G4UNP2 Molybdenum cofactor biosynthesis prote n=1 Tax=Neurospora tetrasperma (strain FGSC 2509 / P0656) TaxID=510952 RepID=G4UNP2_NEUT9  ali  31  101.APTPASSRRDMLKDAKPFSDFLTDNYNRQHDYLRISVTERCNLRCLYCMPEGVPLSPQKELLTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRRDIVSLMQQIGALR-PHGLKELCLTTNGLSLHRKLDAMVEAGLTGINLSLDTIDPWQFQLMTRRNGFSAVQKSIDRIFEAGIKFKINCVVMRGLNDREVLPFVEMTRDKNVEVRFIEYMPFDGNKWNKGKMFSYQEMLELIRSKYPDLQRIQGHKNDTSKTFQVPGFAGKVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDIVRKINNSEELLNIIGMAVKNKKEKHAGI-GELENMKNRPMILI.. 485
102 2.000e-89UniRef50_Q20624 Molybdenum cofactor biosynthesis protein 1 n=11 Tax=Caenorhabditis TaxID=6237 RepID=MOCS1_CAEEL  ali  33  62...................QPPFFDMFMREHTYLRISLTEKCNFRCLYCMPEGVPLKPKDKMLSNSEVLRLVKLFAAHGVDKVRLTGGEPTIRKDIVHIVEGIS---STPGIKEVGITTNGLVLQRFLPQLRDAGLTKINISIDSLDREKFAKMTRRDGFDKVWKAIELARGYYPKVKLNVVVLKHQNENEVVDFVNLTKDRNLDVRFIEFMPFGGNEFKNDNFIGYREMLNLIVDKYGDVIRLSDSPNDTTKAYKIDGFQGQFGFITSMSDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDRIRCGDSDEQLSEVIQKAVNNKKARHAVFRNGRSEEPAKS...... 384
103 2.000e-89UniRef50_M1VY33 Related to molybdopterin biosynthesis protein n=4 Tax=Pezizomycotina TaxID=147538 RepID=M1VY33_CLAP2  ali  30  55.....RSLRRDELHNAKPFSEFLTDKYNRQHDYLRISITERCNLRCVYCMPEGVPLSPNRDLLTTPEIIMLSSIFVSQGVSKIRLTGGEPTVRRDIVPLMQQIGALRTD-GLKELCITTNGITLRRKLDSMVQAGLTGVNMSLDTLDPWQFQIMTRRQGFEAVRDSIDRILEAGIKLKINCVVMRGVNDSQVLPFVEMTREKDLEVRFIEYMPFDGNRWNKNKMLGYSEMLDMIREQHPGLQKVVDHKNDTSKAWHIPGFAGQIGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRRSNNGDQLLDIIGMAVKNKKAKHAGL-GELEHMKNRPMILI.. 413
104 2.000e-89UniRef50_A0A1F9U2V5 GTP 3`,8-cyclase n=9 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9U2V5_9BACT  ali  38  1.....................MLTDSFNRKIDYLRLSLTDRCNLRCVYCMPKDMTFGPREEMLSDAEILKLLSCFAQLGISKIRITGGEPLVREGIVSLVREISGIR---GIQDISLSTNGLLLDKMALDLTRAGLKRVNISLDSLNAEKFNQITRYGKLETVLSAIESALSAGAPVKLNVVVARGMNDDEIADFVKLTKKNPLHVRFIELMPMGETGFFSKEKWVS---MNEILQKAQPLEEMEKEDWGPARYFRRPGARGTIGVISALSCGFCSSCNRMRLSSQGVLVPCLDAAEGTDLKALLRSGTSSRELKEAILFTVQQKPERHHMLEKAAVNSSNRQMCQIGG 329
105 2.000e-89UniRef50_A0A2B4S549 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2B4S549_STYPI  ali  34  65................RPLSDFLTDKFGRHHTYLRISLTERCNLRCQYCMPEGVELSPNSELLTTEEIVSLAKLFVGEGINKIRLTGGEPLVRKDIVELCEELG---RIEGLETLAMTTNGITLARKLPQLKRVGLNLLNISLDTLVPQKFEFVTRRKGWHKVMESIDCALELYNPVKVNCVVMRGLNEDEVCNFVEMTQNKAIDVRFIEYMPFDGNKWNFKKFVPYSEMLESISKTWPNVEKVSDHPNDTSKAYKVPGF-----------------------SADGNLKVCLFGNSEVSLRDSLRAGTSEEELLEIIGAAVGRKKKQHAGMFNIAKQ-KNRPMILIGG 372
106 2.000e-89UniRef50_C7NK92 GTP 3`,8-cyclase n=255 Tax=Actinobacteria TaxID=201174 RepID=C7NK92_KYTSD  ali  38  2..................STPGLVDRFGRVHTDLRISLIDKCNLRCTYCLPEGVPWMAKDELLSREELRAIAAVAVASGITEIRLTGGEPLLRPDLEDLVADLASLEGEDGPVELSMTTNGIGLHHRAHRLADAGLARVNISLDTVDPETFRTMTRRPRLDAVLAGVDAALAADRPVKINAVLMRGQNDHQAVDLLTWAVERGVELRFIEQMPLDAGHTWERGDMVTRAEVMAALEQRFTLTPLPGRGAAPAERFLVDGGPAVVGLIASVTAPFCGACDRLRVTADGQLRSCLFARSETDLRGPLRAGADHAELAALFREATLGKQPGHGIDDPGFLQPP-RPMSAIGG 333
107 2.000e-89UniRef50_A0A2V0PHQ1 Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0PHQ1_9CHLO  ali  33  190........RARRTQERVGGAQMLTDTFSRKHTYLRISLTERCNLRCTYCMPDGVQLTAGERLLTAGEVQRLASLFVSAGVDKIRLTGGEPTVRPDLADICSRL---SALPGLRTLALTSNGIALKRQLPQLKAAGLSALNISLDTLRPDRFEALTRRGGHARVLAAVEEALRLYDPVKVNVVVMRGVNDDEVNDFVELTRDAPINVRFIEYMPFDGNVWSDSKMVPYRELLASIGAAHPGLAREDDPAGEVAKNFRLRGHRGTVSFVTSMTHAFCGDCNRLRLLADGSLKVCLFGANEVSLRDAMRAGASDEELALVISAAVDRKRAAHAGMFELAATA-NRPMITIGG 529
108 3.000e-89UniRef50_A0A1F7TF74 GTP 3`,8-cyclase n=8 Tax=Nitrospinae/Tectomicrobia group TaxID=1802340 RepID=A0A1F7TF74_9BACT  ali  40  3....................PQLFDSYGRGHDDLRISVTDRCNFRCFYCMPEGMQWLPHEEVLSYEEIARLVRITTELGFVSYHLTGGEPLLRKDLDRLVRM---MLQIQPGMDLALTTNGVALPQMAGKLYAAGLRRINISLDTLDAQKFFLITRRDVFGQVMAGIEAAARAGFPIKINAVAVKGLTEQELPRFARWARETGHIVRFIEYMPLDADRSWERGKVLAAEEILEGLSAEGELELTSGHPSDPATRYRYRDGKGEVGIIASVTRPFCQACNRLRLTAEGMVRTCLFSNVEHDLKALLRGGASDAEIETWLAGVVWTKTPGHLIGQKAFVQP-ARTMSAIGG 329
109 3.000e-89UniRef50_A0A2K1QQV1 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Elsinoe sp. CQ-2017a TaxID=1983410 RepID=A0A2K1QQV1_9PEZI  ali  34  57......SPRRAALRSSAPFSSFLTDTFGRQHDYLRISLTERCNLRCTYCMPEGVPLSPASDLLTTAEIVYLSSLFISQGVRKIRLTGGEPTVRKDFMELLGRIGEWKGR-GLDELAITTNGLLLERRIEAMVERGLTGVNISLDTLEPAMFQIMTRRKGWENVMRGIEKVLDLKRKGKVNCVVMRGVNDREVLDFVEFTRERDLEVRFIEYMPFDGNKWSRGKMVSYGEMVEMIKTRYPEFRRVGEGKNETSKTWEVPNFMGRLGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDMIRKDQREAELLDIIGLAVRRKKEKHAGM-GQLENMKNRPMILI.. 436
110 3.000e-89UniRef50_F7VS97 WGS project CABT00000000 data, contig 2.5 n=9 Tax=leotiomyceta TaxID=716546 RepID=F7VS97_SORMK  ali  31  99..PAPTSSRRDMLKDAKPFSDFLTDNYNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPKELLTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRRDIVPLIQQIGALRA-HGLRELCLTTNGLSLHRKLDAMVEAGLTGINLSLDTMDPWQFQLMTRRNGFSAVQKSIDRIFEAGIKFKINCVVMRGLNDREVLAFVEMTRDKDVEVRFIEYMPFGGNKWTEGKMFSYQEMLELIRSKYPDLQRIQGHKNDTSKTFQVPGFAGKVGFITSMTHNFCGSCNRLRITGDGNIKVCLFDNTEVSLRDIVRKINNSEELLNIIGMAVKNKKEKHAGI-GDLENMKNRPMILI.. 482
111 4.000e-89UniRef50_A0A136M2B8 GTP 3`,8-cyclase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136M2B8_9BACT  ali  36  3....................APLIDRFGRRHTYLRISVTDRCNLRCTYCMPEGIALASHFDLLTFEEISRVLQIFAEMGINKVRLTGGEPLLRKGLPNL---ISSISQTSGIDKVGLTTNGILLTDYAEPLRNAGLKSVNISLDTLNQDRFLQITRVGRIEKVLEGIEAAIAAFSPIKINMVVMKDFNDDEISDFIEYFFEKPVHLRFIEFMPFRSNGWNRQKLIPAAAIRQIIGERFSFMPAGSEEPDQVARPYQIEGMKGSIGIISSMTEEFCESCSRLRLSATGGVKTCLFGPEDGNVRNLLRDGATDVEIETFIRQCLDRKPSGHSFNEGEFLVES--PMVAIGG 329
112 4.000e-89UniRef50_U1GGH6 Uncharacterized protein n=1 Tax=Endocarpon pusillum (strain Z07020 / HMAS-L-300199) TaxID=1263415 RepID=U1GGH6_ENDPU  ali  34  69..PHQQPLRLREETNPRPLSSYLTDDFSRAHNYLRISVTERCNLRCVYCMPEGVPLSPSAHLLTTPEIVYLSQLFVSQGVDKIRLTGGEPTVRKDIIDLMTQIGRLRRS-GLKELCLTTNGLTLHRKLDAMVEAGLTGVNLSLDTLDPYQFTIMTRRNGHEAVTRSIERILEAGIKLKINCVVMRGINEREIIPFVELGKNKDIEVRFIEYMPFDGNKWSQGKMLSFKEMLATIREKYPDLQKIQDHKNDTSKTYQVPGFLGKLGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDILRERNNDQRLLEIIGAAVKRKKAKHAGM-GELENMKNRPMILI.. 449
113 4.000e-89UniRef50_A0A2H5WZN4 GTP 3`,8-cyclase n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5WZN4_9BACT  ali  37  1......................MRDSFGRTIDYLRISVTDRCNFRCVYCMPEGADVAPKEWILRYEEIATIVKVAAELGVRKVRLTGGEPLVRKDIVQLVRMI---AQTPGITEVSMTTNGFLLARYAHELKEAGLTRINISLDTLNPERFVRIARRGSLQQVLEGIEAARQVGSPIKLNMVVMRGFNDDEVADFARLTLRHPYHVRFIELMPINWNDGSRRLFVPVHEIRQRIEQEVSPLEPAEVITNGPARTFRLPGAQGTVGFISQVTHDFCANCNRLRLTADGFLRPCLMADGEVDLRAPLREGKGEEEIRRLFLHTVAHKPERHYLAE--GIVPVGRGMSQLGG 365
114 5.000e-89UniRef50_R7R6Y8 GTP 3`,8-cyclase n=3 Tax=Lachnospiraceae TaxID=186803 RepID=R7R6Y8_9FIRM  ali  38  1......................MQDSFGRKIEYLRVSVTDKCNLRCRYCMPEGITRLAHDDILRLEEWARIIKIMQELGITKVRFTGGEPLVRKNLIQLIRDVH---ALDGIRQIAMTTNGILLGEQAADLREAGLTHVNISLDTLNPRTFEEITRVDALNQVLSSIEKALQAGLQVKINCVPCQEWNGEDLTDIAALARQYPLDVRFIELMPVGCGSQYHG---ISSDRVLEKLEQQYGRVQADNEKGGPAKYYDFAGFQGKVGVISAMSHQFCGSCNRIRMTAEGRLKLCLHYQDGIELRPLLRKGRTDDEIREAIVEAVRQKPRAHDFHTAEHTDADQRRMVQIGG 326
115 5.000e-89UniRef50_A0A2H0JS16 GTP 3`,8-cyclase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2H0JS16_9BACT  ali  36  10....................EPLTDTFGRRHTYLRIALTERCNLRCTYCMPDGVDLLKRHHLLTFEEILRLAGLFAGLGVTRIRLTGGEPLVRKD---APALAAALARLPGVETLAITTNGLLLHRHLDLLQSAGLAKLNISLDTLREERFLSITRRTGLETVIRNIDLALASGFDTKLNCVVMRDVNDGELIDFAHFVEDRDMEVRFIEYMPFGGNGWNHDAFVPYATMLDTLQSVFPDMYRLDDGPHETAKTWQIPGFRGRIGFITSMSEQFCGGCNRIRLMADGNLKVCLFGRGEVSLRDAMRDGATDEELTALIDKAISGKKKAHDGM-STLATQENRPMIRIGG 336
116 5.000e-89UniRef50_A0A1G1PNG7 GTP 3`,8-cyclase n=7 Tax=Bacteria TaxID=2 RepID=A0A1G1PNG7_9BACT  ali  37  2....................TKLIDKYNRQINYLRISVTDRCNLRCVYCMPGGISHKPHQEILSFEQIYKFVRVAAGLGIEKVRITGGEPLIRKDLPLLIAQL---KTIGGLKEIALTTNGMNLSEYAFILKKSGLDRINVSLDSLDADKFQEITRGGSLKAVLKGIDSALEAGFPSKINTVLLKGFNSDEILSFAGLTKARPINARFIEYMPTDFNYFSYNELFFSAQEAKTLCSGLGELKPLDGAGGATARIFRLEGFCGSLGFISAVSRPFCSSCNKLRLTSDGRIRNCLHSSRTLNLKALLDRNASEEELEQLIKEAVFLKPRAHNLANPSGSESDNFSMCQIGG 336
117 7.000e-89UniRef50_A0A0F8B348 Cyclic pyranopterin monophosphate synthase accessory protein n=40 Tax=saccharomyceta TaxID=716545 RepID=A0A0F8B348_CERFI  ali  31  91..PVAPAGSLSTPHSAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPRNILTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRSDIVPLMQQIGALRSR-GLRELCITTNGISLHRKLDAMVDAGLTGINLSLDTLDPLQFQIMTRRKGFDAVQRSIDRVLAINHKLKINCVVIRGVNDREILPFVELTRSHNLEVRFIEYMPFDGNRWNKAKMLSYADMLDIIRRVHPDVHAVRGHANDTSKTWQVPGHVGRLGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDVLRQANSENQLLHVIGQAVRRKKEKHAGI-GELEHIKNRPMILIGG 492
118 1.000e-88UniRef50_A0A2H3IZG2 Elongator protein 3/MiaB/NifB n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A2H3IZG2_9EURO  ali  32  9.SPVNSQNVSALRLPKKPISENLVDGFRRQHDYLRISVTERCNLRCMYCMPEGVDLSPPSHLLTTAEIVYLSSLFVSEGVTKIRLTGGEPTVRKDIVPLVQAIGKLRQ-NGLRELCLTTNGISLLRKLDPMVEAGLTGINLSLDTLDPFQFQIMTRKQGLEAVRKSIDRILEAGVKLKINCVVMRGLNEREILPFVEMGRENPIEVRFIEYMPFDGNKWRQNRMVSYQEMLTMIRTKYPEISKTTGLKNDTSKNYQIPGFAGQVGFITSMTHNFCGSCNRLRITADGNLKVCLFGSAEVSLRDLLRQPIDDEDLLKLIGLAVKRKKAAHAGM-TDLASMKNRPMILIGG 389
119 1.000e-88UniRef50_G2LLG5 GTP 3`,8-cyclase n=32 Tax=Bacteria TaxID=2 RepID=G2LLG5_CHLTF  ali  36  6.............PRTVHLHPLLRDAHGRVIRDLRISITDRCNFRCTYCMPEGVTWKAAEELLTVDEILALARVFVGLGIEKIRLTGGEVLLRDDVVALTRAL---RQLPGVKDLALTTNGYRFEQYAAALAEAGLQRITISLDSLREETFHRLTRVRALDRVLRAIELAHRYRTPVRVNCVLMRGVNDGEIEDFADFARAWDVSLRFIEYMPLDGPGEWQPTLVVPGREVRARIQARYPLIPIAGQPSETARRYRFADGPGEIGIIAPVTEPFCGACSRLRLTADGKLRTCLFSVVEYDLRDALRAGAGQQELAARILTAVAQKEAGHRINEPDFI-PPSRTMSCIGG 341
120 1.000e-88UniRef50_M5TB14 GTP 3`,8-cyclase n=3 Tax=Rhodopirellula TaxID=265488 RepID=M5TB14_9PLAN  ali  39  1.....................MLTDRFGRIHRSLRISVTDRCNLRCTYCMPEHTPYQPRSEILTFEEIVRFVKIAVSLGVDDVRLTGGEPLVRSQLNLLVQKLN---EIDGLRKISLTTNGVLLQDQLAELFAAGLRHVNVSLDALDEESFKGATRRGGLDKVVGGIDAAQRAGMVVKVNSIAMRGLTDHQIVAFGEFTRRTGIPVRFIEFMPLDSDGNWNTSAVLSGTEIVEMFSSQIPLVPIERNGSSPSADYRFDDGIGTVGVIASVSKPFCDSCDRFRLTADGQLRNCLFGEDSGDVRALLRGNASDESISQMIQSAVATKKRGH-GTDDLTFLRPSRPMHAIGG 326
121 2.000e-88UniRef50_A0A2K3D1A8 Uncharacterized protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3D1A8_CHLRE  ali  33  301........AEEEGRQAVAGAAMLTDTFSRVHTYLRISLTERCNLRCTYCMPEGVALTPGGQLLTTPEIMRLARLFVEAGVTKVRLTGGEPTLRRDILDLVGQLGALRXXRGLSSLAITSNGIVLARQLPALKEAGLTAVNISLDTLRPERFQQLARRPGHGRVMEAIATAARLFDPVKVNVVVMRGVNDDEVADFAALTRHQPVNVRFIEYMPFDGNVWSDSKMVPYRELLTRLRAAFPPLERLDDPRGEVAKNFRLRGHVGSVSFITSMTQHFCHDCNRLRLLADGNLKVCLFGSSEVSLRDALRGGASDDDLRLIIGAAVRRKRAAHAGMFELAALP-NRPMITIGG 688
122 2.000e-88UniRef50_Q89NT2 GTP 3`,8-cyclase n=492 Tax=root TaxID=1 RepID=MOAA_BRADU  ali  62  4..........SSANPRAALSSAMTDPFGRTISYLRVSVTDRCDLRCFYCMSEDMTFLPKADLLTLEELDRLCSAFIAKGVKKLRLTGGEPLVRRNVMTLVRSLSRHLSSGALSELTLTTNGTQLAKYARELADCGVRRINVSLDTLDPKKFREITRWGEIDKVLEGIEAARAAGLAVKINAVALKNLNEDELPSLMRWAHGKNMGLTLIEVMPMGEIGAGRIDQYLPLSLVRARLAQQFTLMDLAESTGGPARYVSVAETGGKLGFITPMTHNFCESCNRVRITCTGTLHTCLGHEDASDLRKPLRASDDDMLLADAIDRAIGLKPKGHDFDRRHNRPSVSRHMSVTGG 344
123 2.000e-88UniRef50_A0A2G6E2T6 GTP 3`,8-cyclase n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6E2T6_9BACT  ali  40  3......................LQDAFGRTIASLRVSVTDRCNLCCRYCMPEGVPVLPHDEILRYEEIERLIRVALALGVARVRLTGGEPLVRKGLLDFICRL---KALEGLKALTMTSNGILLERYAESLKKCGVDSLNISLDTLNAEKFRLMTGFNQLESVLRGIAKAREAGFSIKINVVSLRAFNDDELFDFIEFADHGDFILRFIEYMPFPGN-DWHQKGFLSSKELRAKIEQRYTLQPYDGDPSAAAKLYEIQGLRGKIGFISAVSESFCDRCNRLRLTSDGFLKPCLHGPLEIDLKSPLRRGAQDSELMALFHEAIERKPASHHDLFTHACRPIDREMVRIGG 329
124 3.000e-88UniRef50_A0A225B8R4 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225B8R4_9EURO  ali  32  802......SRRAAAIRSAKPFSDFLTDTFHRQHDYLRISVTEKCNLRCLYCMPEGVPLSPPAHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQAIGDLR-LDGLRELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFQYQIMTRRKGFDAVMKSINRIQEAGIKLKINCVVMRGLNEREIVPFVELGRDKAIEVRFIEYMPFDGNKWSEQKMVPYQEMLATIRTKYPNLEKVADHKNDTSKTYRVPGFAGQVGFITSMTHNFCNTCNRLRITSDGNLKVCLHGNAEVSLRDLIRENSRERQLLEVIGMAVKRKKAKHAGI-GQLEKLKNRPMILIGG 1184
125 3.000e-88UniRef50_A0A1V4IWT1 GTP 3`,8-cyclase n=32 Tax=Firmicutes TaxID=1239 RepID=A0A1V4IWT1_9CLOT  ali  38  1......................MFDSYGRKINYLRISVTDLCNLRCKYCMPEGIDKMWHKEILTLEEIEAITESFVELGVDKVRITGGEPLVRKNILKL---IDGIGKIGGVNDLAMTTNGILLKDYAKDLKNAGLNRLNISLDTLNEEKYSQITKVGKLKDVLQGIEAAKKSGTPIKLNVVLIKDFNENEIEDFINLTKYEDIEIRFIELMPIGTLKHWSSNKYISNDTV---LEKMPELIEIESDISSPARYYKLPNAKGKVGLINPISCKFCENCNRIRLTADGKLKSCLHSNAEVDLKKLLREGKD---IKTVITDTIKSKPKEHELENGNY---INREMTAIGG 318
126 3.000e-88UniRef50_A0A135LK05 Cation transporter n=1 Tax=Penicillium patulum TaxID=5078 RepID=A0A135LK05_PENPA  ali  33  746LPPHPPTSRLSTLKSAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGIDLSPSAKLLTSPEILYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMHDIGKLRS-NGLRELCLTTNGISLHRKLDSMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEAGIKLKINCVVMRGMNDREILPFVEMGREKAIEVRFIEYMPFGGNKWNQGKMFSYQEMLAVIREKYPTFEKVADHKNDTSKTYRVPGFEGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDIIRKNEREREILDIIGMAVKRKKAKHAGMEQL-KDMKNRPMILI.. 1132
127 4.000e-88UniRef50_A0A0G4LU40 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4LU40_9PEZI  ali  33  381LPANSTSNRRDALRDAKPFSDFLTDNFSRQHDYLRISVTERCNLRCVYCMPEGVPLSPSRDILTTPEIVMLSSVFVNQGVTKIRLTGGEPTVRRDIVPLMRQLGALR-PHGLQELCLTTNGLSLHRKLDAMVEAGLTGINLSLDTLDPWQFQIMTRRNGFSAVRKTIDRVFEAGLKFKINCVVMRGRNDAEIVPFVDMTRDRDVEVRFIEYMPFDGNRWNEGKMLGYAEMLDVIRAAHPTVEKVRDHRNDTAKTWRVPGFAGRVGFITSMTHNFCGSCNRLRVTSDGNLKVCLFGNAEVSLRDILRKSLNEAELLDIIGMAVKRKKEKHAGME-NLQHMKNRPMILI.. 766
128 5.000e-88UniRef50_G2RA30 Uncharacterized protein n=14 Tax=leotiomyceta TaxID=716546 RepID=G2RA30_THITE  ali  31  78VGATLASRRDRIRD-AKPFSDFLTDTFRRQHDYLRISVTERCNLRCLYCMPEGVPLSPPKELLTTPEIVMLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGALRA-HGLRELCLTSNGLSLHRKLEPMVEAGLTGVNLSLDTLDPWQFQLMTRRAGFSAVQKTIDRIFEAGLKFKINCVVMRGLNDREILPFVEFTRDKDVEVRFIEYMPFDGNKWSEGKMFSYQEMLDLIRSRYPDLQRAKDHKNDTSKTFQVPGFVGKIGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDVIRKLNNSEELLNVIGMAVKRKKAKHAGI-GELENMKNRPMILI.. 462
129 6.000e-88UniRef50_A0A1I6HP25 GTP 3`,8-cyclase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1I6HP25_9ALTE  ali  47  3...................NSKLTDRFGRTVNYVRLSVTDRCDFRCVYCMAEDMTFLPRQQVLTLEEIARLARTFTELGTEKIRLTGGEPLVRRDILELVREIGSY----GLRDFAMTTNGSQLPTMADDLRRAGMHRLNISLDSLDPDRFRRITRTGKLSQVLDGIDASREAGFRIKLNTVVLKGRNDDEVPELVDFARRKGVDITFIEEMPLGEITEHDRSVFCSSDEVRGIIRQHHDLVPATEDSGGPARYYRMPGSQSRVGFISPHSHNFCSTCNRVRVTVEGRLLLCLGNEHSVDLRRVLRNPVSDDKLRQTIIDAMELKPEKHHFEVG-GDVQILRFMNMTGG 330
130 7.000e-88UniRef50_R7Z7P6 Uncharacterized protein n=1 Tax=Coniosporium apollinis (strain CBS 100218) TaxID=1168221 RepID=R7Z7P6_CONA1  ali  30  62LPPQQPERRKDDLKHAKPFSDFLTDTFNRQHDYLRISITERCNLRCLYCMPEGVPLSPPSHLLTTPEITYLSALFVSQGVTKIRLTGGEPTVRSDILPLMRSIGALRSR-GLKELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRRGFEAVMKSVERILEAGVKLKINCVVMRGLNEREILPFVEMTRDKDIEVRFIEYMPFDGNRWSQGKMLPYREMLEIIRGKYPEVRRVQGHKNDTSKTFGIPGFVGRLGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDLLRKDNSERELLDVIGMAVKRKKEKHAGM-GALENMKNRPMILIG. 448
131 9.000e-88UniRef50_A0A0A2K889 Molybdenum cofactor synthesis C-terminal n=3 Tax=Penicillium TaxID=5073 RepID=A0A0A2K889_PENEN  ali  33  741......SSKLSKLKSAKPFSDFLTDTFNRQHDYLRISITERCNLRCLYCMPEGIDLSPSAKLLTSPEILYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQDIGKLRQ-NGLRELCLTTNGISLHRKLDPMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEAGIKLKINCVVMRGMNDREILPFVELGREKPVEVRFIEYMPFGGNKWNQGKMFSYQEMLAVIREKYPTFEKVADHKNDTSKTYRVPGFEGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDIIRKNEREREILDIIGMAVKRKKAKHAGM-AQLKDMKNRPMILI.. 1119
132 9.000e-88UniRef50_A0A1G6R3R4 GTP 3`,8-cyclase n=1 Tax=Halanaerobium congolense TaxID=54121 RepID=A0A1G6R3R4_9FIRM  ali  38  4......................LIDQFGRKIDYLRISITDRCNLRCRYCMPEGVREKDHSEILSYEEIIKIAKTAVKMGIKKIRLTGGEPLVRKNVEALIKELN----KLDLEDISMTSNAVALADKASSLKKAGLDRINISLDSLSSEKFEKITRRRALSYVLAGIEAALEADKPVKINMVVMKGINDNEILDFVELSRNKELNIRFIEYMPLGGEAE--AEKFISSKEIKKIIADKYKLLPAVTKGSGPANYFKVEGASGTIGFISALSEHFCSSCNRLRLTADAKIKPCLAGNQEVKIKEI-----NSSEIESAFIEALKLKPACHHLDF--AEQAYNRNMSQIGG 319
133 9.000e-88UniRef50_K4LDX9 GTP 3`,8-cyclase n=23 Tax=Terrabacteria group TaxID=1783272 RepID=K4LDX9_THEPS  ali  39  1......................MEDRFGRRINYLRVSVTDRCNLRCLYCMPEGVTAKPREEILRLEEILRVAQVALQLGITRFRLTGGEPLLRKGVISLIRSLAL---LPGVEDLAVTTNGTLLARLGRQLLDTGVKRVNVSLDTLNPDKFRRITRGGDFRQVWDGIVEALKLFQPVKINTVALRDYNGGEWVDFARLTLEYPLHVRFIELMPVTSWKLAGGSFVPCGEVQSAIEQELGELRPVADQGGGPAKYYALPGAKGTIGFIHAMSGHFCASCNRLRLTADGKIRPCLHDQHEVDIRSAIRSGAGDEELKALFYQALALKPASCHAAMDASSSGSGRGMCQIGG 328
134 1.000e-87UniRef50_A0A2E9A0S9 GTP 3`,8-cyclase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E9A0S9_9RICK  ali  46  3......................LLDQYSRKVNYLRISVTDRCDLRCVYCMKEKMDFLPKNQILSLEEIERISDNFIYLGVKKIRLTGGEPLVRKNIIDLIGKLNLKKNKTSLEEITLTTNGSLLKNFAKDLKKNGIERLNVSLDTIDPKKYNKITRFGDINKVLSGIEEALKNNIKVKINTVVIKQFNEDEIEKLIEWTNALKIDLTFIEVMPMEETDTPRDLQFVSLDKIYNKLNHKYKFKLSNHKTGGPSKYYESKKLKNKIGFITPLSDNFCANCNRVRISSTGKLFMCLGQNEFVDFREILRKDFSDSYIREKILFALSIKPKKHDFIIDDKTKPMQRHMNVTGG 330
135 1.000e-87UniRef50_A0A2H6ADR4 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6ADR4_9BACT  ali  39  6..PLFPAPASLET---MPTCGPLVDTFGRLHTNLRVSVTDRCNLRCTYCMAEDVVFLDRQELLSFEEIVRFVRLLVPLGVNKIRLTGGEPLVRRDLDKLVAMLC---AIPGITDLSLTTNGILLAEQAERLYRAGLRRLNISLDTLRPEVFRQLTRRQGLERVLEGIRVARQLFRPIKLNAVSIRGITEEEVVPLARFARENDLELRFIEYMPIGADHWERSKVYFAEEILQQLARAFGPLRPVPVGDGTAPAQEWEYPDGGRVGIIASISRPFCHHCNRLRLTADGKLRHCLFALEETDVKSLLRGGANDKDIVLAVRRCVWAKWEGHQINTARFLKP-ARTMHTIGG 346
136 1.000e-87UniRef50_Q8NR60 GTP 3`,8-cyclase n=1003 Tax=Bacteria TaxID=2 RepID=MOAA_CORGL  ali  34  23...TSASIKHDAYLPPADGNRVLVDRFGRIARDLRVSLTDRCNLRCTYCMPEGLEWLPTEQTLNDAEVLRLIRIAVKLGIRQIRFTGGEPLLRKNLEDIIAGTAALRTDEGEKVIALTTNGLGLDKRIAGLKEAGLDRVNISLDTIDAERYVSLTRRDRLSGVLASIDAAVAAGHPVKINAVVMPGVNEVDIVPLAEYCISKGSQLRFIEQMPLGPREQWKRGDMVTAEEILARLEEKFTLSPAKEPRGAAPAALWNPDITGQIGIIASVTHPFCGDCDRSRLTTDGTIRNCLFSRTETPLRDALRDGASDDELAQLWAGAMWEKKPGHGIDDEGFLQP-DRPMSAIGG 377
137 2.000e-87UniRef50_A0A2A2K3Q1 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2K3Q1_9BILA  ali  33  103.......................RDTFGRVHTYLRISLTERCNLRCLYCMPEGVQLSPKGNLLTTEEVIRLTRLFASHGVNKVRLTGGEPTLRKDLVDIVHQISN---IDGIEDIGLTTNGLMLSKHVMALREAGLTKVNVSLDTLRQDRYIEMCRRNGLGKVLESIKATESLYPYVKINVVVMRGKNDDEIMDFVRMTQARRIDVRFIEFMPFGGNHFNQGHFVSYGEVMQRIKDEFGEVCKLTELPNDTAKSYKIRGFTGQFGFISSMSDHFCFTCNRLRITADGNLKVCLHGNAEVNLRDLMRLDESDEKLSEVIQSAVTRKKAKHAGYRHGEFEEPPKS...... 422
138 2.000e-87UniRef50_A0A0G2EDW0 Putative molybdenum cofactor biosynthesis protein 1 b n=1 Tax=Diplodia seriata TaxID=420778 RepID=A0A0G2EDW0_9PEZI  ali  29  66FPPPPQQDRRDAIKQAKPFSEFLTDTFNRQHDYLRISITERCNLRCLYCMPEGVPLSPPDHLLTSPEIFYISSLFVSQGVNKIRLTGGEPTVRRDIVPLMRSIGSLRSK-GLRELAITTNGISLHRKLDSMVESGLTGINLSLDTLDPFQFTLMTRRKGFDAVMRSVERVLEAPVKLKINCVVMRGLNDREIVPFVELGREKDVEVRFIEYMPFDGNRWNQKKMMSYQEMLDVIRAKYPGARPVQGHKNDTSKTWEIPGFVGKFGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDIMRKDNDERELLEVIGAAVKRKKEKHAGM-GELENMKNRPMILI.. 451
139 2.000e-87UniRef50_A0A1G1E2D7 GTP 3`,8-cyclase n=1 Tax=Nitrospirae bacterium GWA2_42_11 TaxID=1817752 RepID=A0A1G1E2D7_9BACT  ali  34  4................ETQKTQLVDAFNRKITYMRISVTDRCNLRCVYCVPGTISNLPVNELLSFDEILRLVKVASKMGLNKVRITGGEPLVRRGVIEFVAALN---KIDGINDIAMTTNGVLLKNYAQALKKAGLRRLNISLDTFDPKKFKAITKGDCFDKVWEGILEAERVFQPIKLNVVPSKGCNDDELVDFGKLTLTKPFHVRFIEFMPVDDWDGWKKSFISKAEMMEKIEAGLGKLEPVRDEKDGPAKNYRLHGAPGIIGFISAISEHFCDTCNRIRLGADGKIKHCLFSESYIDFREPLRNGCDEKEVERLLCSVMQTKPEAHNIDINADSKKYLHSMTQIGG 338
140 2.000e-87UniRef50_A0A285NXL4 GTP 3`,8-cyclase n=11 Tax=Bacteria TaxID=2 RepID=A0A285NXL4_9AQUI  ali  31  1.....................MIKDAYGRELHDLRISVTDRCNFRCQFCMPEGYEFYPRSEILTFEEITRIVKISTRLGVKKVRITGGEPLLRRDIEKLIHML---SQIEGLEDISMTTNGFLLEQMAERLKDAGLRRITVSFHSLKDEVFSKIVGRSKVSQIIKGIEASLKAGHPVKVNVCVVKGLNDEEILPIAKFFKKMRVVVRFIEFMDVGNLNGWSLDKVVSAKEIVEIISKEFPIEPVEKNYRGEADRYRYKDDGLEFGVISSITQPFCGDCNRLRLTADGKLLTCLFATQGYNIKTLLRNGAKDEDIEDFIKRVWYSRKDRYSEERKRGEVPKKVEMFKVGG 334
141 2.000e-87UniRef50_A0A178F8I5 Molybdenum cofactor biosynthesis protein n=1 Tax=Trichophyton rubrum TaxID=5551 RepID=A0A178F8I5_TRIRU  ali  32  989..PQLPSSRLDSLKDARPFSSFLTDTFNRQHDYLRISITERCNLRCLYCMPEGVPLSPPEHLLTTPEIVYLSTLFVSQGVTKIRLTGGEPTVRKDILPMMQEIGKLRRD-GLKELCLTTNGISLHRKLDSMAESGLTGVNLSLDTLDPFQFQIMTRRKGFEAVMKSIEKILEAGIKLKINCVVMRGINDREILPFVELGRDKVLEVRFIEYMPFDGNKWSKGKMFSYQEMLDAIKAKYPGFEKVPDHKNDTSKTYRVPGFKGKVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDMIRQNERERELLDIIGAAVKRKKAKHAGI-GILENMKNRPMILI.. 1372
142 3.000e-87UniRef50_G5EAS9 Uncharacterized protein n=134 Tax=Eukaryota TaxID=2759 RepID=G5EAS9_EMENI  ali  34  77..............TAKPFSAFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPAHVLTSPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQSIGELR-HHGLRELCLTTNGISLHRKLEPMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRIQEAGIKLKINCVVMRGLNEREIIPFVEMGRDSPIEVRFIEYMPFDGNKWSKGKMVSYQEMLALIREKYPTLEKVVDHKNDTSKTYRIPGFQGRVGFITSMTHNFCGTCNRLRITCDGNLKVCLFGNSEVSLRDIIRQQNNERELLDVIGMAVKRKKAKHAGM-GELENMKNRPMILI.. 447
143 3.000e-87UniRef50_A0A1H9S0I2 GTP 3`,8-cyclase n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H9S0I2_9BACI  ali  35  2..................QQAVITDKFGRVLQDLRISVTDRCNFRCRYCMPKDFAFLPKEHLLTFEEIERLASTFLQLGVKKIRLTGGEPLLRKNIDELIERL---ASLEGLEDIGLTTNGVLLGKMADKLKAAGLKRVNVSLDALDDKTFMAINDSNFPSHVIKSIQQAKDAGLVVKINMVVKKGMNDHEVLSMANFFKERGITLRFIEFMDVGQTNGWDFQHVVTKKELYEMIAKEHDLEPVPDYIGEVAKRYRYKGTETEVGFITSVSESFCSSCTRARIAADGHFYTCLFAGTGFNLKDILREGISNEELKNTIINRWQKREDRYSDEEETAKKRKKIEMSYIGG 338
144 3.000e-87UniRef50_B0TI16 GTP 3`,8-cyclase n=31 Tax=root TaxID=1 RepID=MOAA_HELMI  ali  41  1......................MIDAFARDIHYLRVSVTDRCNLRCIYCMPEGLPLVDHREVLRFEEFERLIAIAASQGIRRVRITGGEPLVRKGIVPFVARV---KTMTGIEDVALTTNGLLLPRFASELKAAGLDRVNISLDTLRPERFRAVTRVGRIDDVWTGIEAALAADHPVKLNVVVMGGVNDDEVADFARLTLQWPIHVRFIELMPIGEGDSRFRGQYVTIEQMKAKMAEQGLRLHPGIRGGGPARYHTLAGALGTVGFISAISKHFCGTCNRLRLTAEGKLRPCLHSRQEIDLRTPLRRGASDNLLARIFQKAVEAKPYQHHMLDEGWGDRP-RLMSQIGG 327
145 3.000e-87UniRef50_A0A024TII9 Molybdenum cofactor biosynthesis protein A n=7 Tax=Eukaryota TaxID=2759 RepID=A0A024TII9_9STRA  ali  31  64...........AQLQHAEREDHLVDTYGRVHNYLRISLTERCNLRCQYCMPEGVPLQPTSDLLSTPEILHLTNLFAQSGVSKLRLTGGEPLVRPDIVSLATSLH---AIPGIESLGITTNGLSLSKHLAALC-AVPARLNISLDTLNEAKFAKITRRKGFQRWAAIEAAVAASPVQVKLNCVVMRDFNLDEIVDFVRLTTTLNVDVRFIEWMPFDQNRWNDQTFVPFAEMLSQLHAEFPVIEPLENHLNDTSKSFRLPDSPGQFSFITSMSEHFCGGCNRLRITADGNLKVCLFGNAEVSLRDAMRHGYSDDDLLLVIQAAVKRKKLGGHQNMHGIAKAQNRPMILIGG 401
146 4.000e-87UniRef50_C7M1B9 GTP 3`,8-cyclase n=23 Tax=root TaxID=1 RepID=C7M1B9_ACIFD  ali  37  1................MDAATPLIDPFGREITDLRVSITDRCNFRCTYCMPEGMHWLDRGELLSFEEITRIARVMAAFRLQSVRITGGEPTVRAQVPSLIEQLAQVRRPDGTLELSMTTNGATFALLADDLVSAGLARVNISLDTLRPERFAQITRRTRLERVIEGIDAAIRVGSPVKLNTVVMRGVNEDELPDLVHFAVDRGIEVRFIEFMPLDGDGHWSPRDVVSEAEMLELLAAHFSFHPLARS-SAPATTYELDDGSGRFGVIPTVTHPFCDACDRVRLSADGRLRTCLFALDEHDLRPLLRGGAGDDALAERIVAIVGTKWAGHQIGTVRFRRPSK-SMSQIGG 335
147 4.000e-87UniRef50_A0A2L1U560 GTP 3`,8-cyclase n=81 Tax=Bacillales TaxID=1385 RepID=A0A2L1U560_9BACL  ali  38  5......................LIDRYGRVHDYLRISVTDRCNLRCVYCMPEGMEFEPDDHLLTFNEITTVVRVLARLGVRKLRLTGGEPLVRKHIEDLVNRL---SSIPGIEDIALTTNGMFLAPKAEQLKAAGLTRINISLDSLKEDRFAFITRGGKLKKVLEGLNASAKVFNPIKLNVVLMKGINDDEIVDFIELSRDHPIQVRFIEYMPIGHDDQEWRGRYVSLARVMEECPKQGWEVQEVKGINGPSQNFRIHGAAGTFGLIHPVSDHFCESCNRLRLTADGNIKPCLYWSDEFNVRPYI---GDEKAIMDLFFRALDLKPQSHEMAEKQSHQPTLRRMSQIGG 334
148 5.000e-87UniRef50_A0A1Q7HYA9 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7HYA9_9CHLR  ali  38  1......................MFDQWGRRVKSLRISVTDRCNFRCVYCMPEGLDWLPKDKILSYEEIARLTGILVGMGVENVRLTGGEPLVRRDLPVLVRMLSG---IPGLRSLSLTTNGYFLKEMAGDLADAGLTRINVSLDTLQRDKFHEITRRDCLERVLEGLAECERYPRPIKVNAVAVRGFTEEEIPAFAALARRAPYLVRFIEYMPIDGDAAWTRDRVLTGGEILSEMRKLYPLEAVPDDPAQTSRDFRFVDGAGTVGFINPVSEPFCEACDRIRLTADGQIRTCLFSVTETDVRGPMRAGADDAEVAEVLRRAVWRKELKHHINDPGFVRA-SRSMSQIGG 327
149 6.000e-87UniRef50_I8REV2 GTP 3`,8-cyclase n=5 Tax=Sporomusaceae TaxID=1843490 RepID=I8REV2_9FIRM  ali  40  4......................LYDSVGRRIHYLRVAVTDRCNFRCLYCMPEGVKWMEHNDILRYEEILRIITAFASLGVDKVRITGGEPLIRKGIIGF---LHKVTAIPGIKEVAVTTNGSMLEEYASLLKEAGVKRINVSLDTLDPERFKQITGHDVLYRVLAGIKKAQEIGTPIKLNMVVMNGINSDEIADFAKLAINNPYQVRFIEYMPF---ALERKYLFAADKMKQQLLKAGFAKLIPEMSNHSPAQIYRFPQAQGSIGFITPISQHFCSSCNRIRLTPDGNLKPCLLSNQEYSLRERLRAGISDQKLLDTIKQVIWNKPKECDLKNGGKG---KRGMHRIGG 323
150 6.000e-87UniRef50_A9BF51 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=MOAA_PETMO  ali  36  1......................MIDKYGRSIDYLRVSITDRCNLRCIYCMPPGVTFKTHSSILRYEEIIKIVEVGTELGIKKVRITGGEPLVRQGVVNLIKEL---RKIPELEDITMTTNGVLLPKYAFALKRAGLSRVNISLDSLNPDTYKTITRRGEFSQAIEGIKAALEVGNPVKINTVVMKGINDNELENFVNLTIDKDLHVRFIEYMPMGETSLLSGNYYVSLNEFKEIIIDKMGMVPVNIQNNGPSKDFKVPGAKGTVGFITAISHNFCSTCNRMRLTADGFLRPCLASDVEVNMRDE-DGKISSEGVREKFEKALLLKPISHNFYKNDFFPKKN--MSQIGG 323
151 6.000e-87UniRef50_A0A0D2F4X6 Molybdenum cofactor biosynthesis protein A n=12 Tax=Herpotrichiellaceae TaxID=43219 RepID=A0A0D2F4X6_9EURO  ali  32  78.............HEPRPFSSFLTDNYSREHNYLRISVTERCNLRCLYCMPEGVQLSPSAQLLTTPEIVYLAELFVNQGVDKIRLTGGEPTVRKDIVGLMQQIGNLRR-NGLKELCITTNGISLHRKLDSMVESGLTGVNLSLDTLDPYQFTIMTRRNGHDAVMKSINRILEAKIKLKINCVVMRGLNESEILPFVELGREQDIEVRFIEYMPFDGNKWSEKKMISFDEMLALIRQKYPDVQKVEGHKNDTSKTYKVPGFAGRIGFITSMTHNFCGTCNRLRITGDGNLKVCLFGNAEVSLRDILREGVSEKELLDVIGMAVKRKKEKHAGM-GELENMKNRPMILI.. 450
152 7.000e-87UniRef50_A1B4A2 GTP 3`,8-cyclase n=37 Tax=root TaxID=1 RepID=MOAA_PARDP  ali  57  9...............AMDAHAPLIDPFARPITYLRVSVTDRCDFRCTYCMAEHMQFLPKRDLLTLEELDRLCSAFVGLGVRKLRVTGGEPLVRRNIMEFFRAMSRHLGA-GLDELTLTTNGSQLARFATELADCGVRRVNVSLDTLDEDRFARITRWGRLPQVLQGIEAAKAAGMRVKINTVALKGFNEDELFRLVGWCADQGHDLTFIEVMPMGEMGEEERDQYWALSDLRDRLGERFTLTPLAERTGGPARYVRLDETGQKIGFITPLTHNFCESCNRVRITCTGELFMCLGQEDRADLRAPLRAGAEDAPLRAAIRDAIARKPKGHDFDRRHVAGQVSRYMSHTGG 344
153 7.000e-87UniRef50_D2QPI7 GTP 3`,8-cyclase n=92 Tax=Bacteria TaxID=2 RepID=D2QPI7_SPILD  ali  35  1.....................MIYDNHNRPISYLRLAVTDRCNLRCFYCMPEGIKYLPKHQVLTYEEMERLVRVLARLGVQKVRITGGEPFVRAGLMDFLHRL---AEIDGLNDISLTTNGVLTAPHIPALAALGVKSVNLSLDTLDRERFYKITRRDELPAVLKTLDALLEAGIQTKINAVVMDGQNTQDLVPLTEMTRTMPVDVRFIEEMPFNGEGSHYPVNWTHRRIIDEIRAHFPDLQKLPDPPFSTSANYQIPGHQGTIGVIAAFSRTFCGSCNRIRMTAQGTLKTCLYDNGVLDVRALLRSGASDEELTTAFLKAFSHRPANGFEAEQQRDTVTE-SMSTIGG 326
154 7.000e-87UniRef50_A0A2P6MPZ9 Molybdenum cofactor synthesis 1 n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MPZ9_9MYCE  ali  35  123..........SDAKSMPVVDEMLIDTFSRKHNYLRISLTERCNLRCQYCMPEGIELTPSENIMTQDEILRIATLFVESGVTKIRLTGGEPLVRKDVVDICERLG---ALPGLKHLGMTTNGLTLPRKIGDLHRVGVNLLNISLDTLKADKFTFITRRLGFERVKESIDLALNKYNPVKINCVVMKGFNDDEIWDFVEMTKEQDMEIRFIEYMPFGGNRWSDKKFISYQEIIDKIKRLHPEFKRIPEEESETSKLWKVPGYKGRIGFITSMSQHFCSSCNRLRLTADGNLKVCLFGQEEVNLKDYMRKGATDEELRRWIDMAVKKKKSSLGGDMYELAKGTNRPMILIGG 465
155 7.000e-87UniRef50_A0A2A4ZYS5 GTP 3`,8-cyclase n=10 Tax=Bacteria TaxID=2 RepID=A0A2A4ZYS5_9BACT  ali  33  19................APARPXITDQFGRTFNYLRIAVNEKCNLRCIYCMPEGVQFNPKNEILTTEEILRVVKVVSDLGVNKIRFTGXEPLLRGDITKL---VGKSXSTPGIESVHLTTNGVLLDRYAGDLKESGLAGVNISIDTLNIEKYIQITRRDELXRAMEGLEAAKTAGIPSKVNAVALRGFNDSEIVEFVELTKDYPLTVRFIELMPFDAHQIWKTGKFFSAEHIQKELKDHFPNIKITTGTATEHFIFQVPNYAGKVAVIPSYSRNLCGNCNRIRLTADGNIRNCLYAHNEFNLKELMRSGGTEEELKELMLSAMWKKPIDGWAAQKTGSDSRE-SMTQIGG 349
156 7.000e-87UniRef50_D3F5R6 GTP 3`,8-cyclase n=13 Tax=Bacteria TaxID=2 RepID=D3F5R6_CONWI  ali  38  3....................EQLKDGHGRLIGDVRISVTDRCNFRCQYCMPDGLPWLEREEILTFEEIARLVGLLASMGVHDVRLTGGEPLVRRDFPRLVEML---AAIPAVHDLSITTNGYLLERDAAALVAAGANRFNVSIDSLQRDRFFEMTRRDALPRVLRGLEAAFPQAHPIKVNAVALRGFTEQEAIPFAEFARSHPYEVRFIEFMPLDADHAWSRDQVLTGDEVRAAIDAVYPLEPEPREPSATARVYRFADGRGRIGFINPVSEPFCGDCNRIRVTADGNLRTCLFSAGETSLRDPLRAGAGDDELARVIRDAVWRKELKHQVNDPGFVQP-ARTMSAIGG 330
157 8.000e-87UniRef50_A0A2E4HJG1 GTP 3`,8-cyclase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2E4HJG1_9BACT  ali  37  5.....................QLFDKYGRGHNDLRISVTDRCNFRCFYCMPEGMEWLPHDEVLSYEEILRVVRITTDLGFDSFHITGGEPLLRKDLSLL---ISGMLKIQPEMDLALTTNGILLPAVAKDLYQAGLRRINISLDTLDEEKFLFMTRRNQLKQVMEGIKSASDMGFPIKINAVAIKGLTEEEIPRFADWARETGHIVRFIEYMPLDADKTWGKDKVLSAEEILDGLSKNCALELVSGNISDPATRYRYQDGKGEIGVIPSVTKPFCEDCNRMRLTAEGMIRTCLFSNDEHDLKKLLRGNERDEVIKKWLGEVLLTKTPGHLIGQKEFVQP-DRTMSAIGG 330
158 8.000e-87UniRef50_A0A1J9RRJ6 Molybdopterin cofactor biosynthetic protein n=1 Tax=Diplodia corticola TaxID=236234 RepID=A0A1J9RRJ6_9PEZI  ali  30  71..PSQQARRDAI-KQAKPFSEFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPDHLLTSPEIFYISSLFVSQGVNKIRLTGGEPTVRRDIVPLMRSIGSLRAK-GLRELCITTNGISLHRKLDSMVESGLTGINLSLDTLDPFQFQLMTRRKGFDAVMKSVDRVLEAPVKLKINCVVMRGLNDREIVPFVELGREKDVEVRFIEYMPFDGNRWNQKKMMSYQEMLDVIRAEYPGLRPVQGHRNDTSKTWEIPGFVGKFGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDIMRKDNDERELLEVIGAAVKRKKEKHAGM-GELENMKNRPMILI.. 453
159 9.000e-87UniRef50_A0A1Y2LXC1 Uncharacterized protein n=1 Tax=Epicoccum nigrum TaxID=105696 RepID=A0A1Y2LXC1_EPING  ali  32  63.TPSRQAARERIQEKAKPFSEFLTDKFQRQHDYLRISITERCNLRCLYCMPEGIPLSPPATMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIIPLMQQIGSLR-PKGLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRVLEANIKLKVNCVVMRGLNEREIIPFVEMGREKDIEVRFIEYMPFGGNKWSENKMISFQEMVDTIRTKYPGLERIPGHKNDTSKTFQVPGFVGKVGFITSMTNDFCSTCNRLRITSDGNLKVCLHGNDEVSLRDLLRQDNNNEELLSVIGQAVKRKAEKHA-DMGDLANMQNRPMILIG. 450
160 9.000e-87UniRef50_A0A2S4KXF7 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Tolypocladium paradoxum TaxID=94208 RepID=A0A2S4KXF7_9HYPO  ali  33  58......QSRRARVRDAKPFSEFLTDTFRRQHDYLRISVTERCNLRCMYCMPEGVPLSPNRELLTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRRDILSLMQQIGALR-PRGLKELCLTTNGISLHRKLDSMVEAGLTGVNLSLDTLDSWQFQIMTRRKGFDAVQKSIDRILEAGIKLKINCVVMRGINDREVVAFVEMTREKDIEVRFIEYMPFDGNKWSQGKMFSYSEMLGLIREQYPELQKVQDHKNDTSKTWRVPGFVGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRKSNSEAELLDVIGMAVKRKKAKHAGI-GELEHMKNRPMILI.. 437
161 1.000e-86UniRef50_A0A090L164 Molybdenum cofactor biosynthesis protein 1 n=4 Tax=Strongyloides TaxID=6247 RepID=A0A090L164_STRRB  ali  31  21......................LTDNFGRHHDYLRISLTERCNLRCKYCMPEGVPLTPSVNLLTNDEIITLVKIFEKNGVSKIRLTGGEPTIRSNLAKL---IYDIRSIEGIKSVGITTNGITLSRQLPDLVKSGLTHVNISLDTLDPNKYMILSRRNGFSKVIKSIKLAQNFFPYVKLNVVVMKGINDNEVVDFVKMTKNENLDIRFIEYMPFEGNNFNINKMVPYKELLIMIDKEINEMIKATDDKNDTSKGYYVDGWKGKFGFISSMSEHFCGTCNRLRITADGSLKVCLHENTEVSLRKLLRENSSTEIIENVIEKAVKGKKFKHA-DVNILKNLKNRPMILI.. 343
162 1.000e-86UniRef50_A0A1V8U8X6 Uncharacterized protein n=3 Tax=Rachicladosporium TaxID=470018 RepID=A0A1V8U8X6_9PEZI  ali  31  261.....RSSRAAAIREAKPFSDFLTDTHARQHDYLRISLTERCNLRCLYCMPEGIDLSPNRDLLTTAEIVYLSALFVNQGVTKIRLTGGEPTVRKDIVPLMHQIGALRKD-GLKELALTTNGISLHRKLDEMLKAGLTGVNISLDTLDPFQFQLLTRRQGFAAVMKSIDRVKEAGIKLKINCVVMRGLTDHQILPFVEMTENEEVEVRFIEYMPFGGNKWSQNKMVSYADMLDVIRAKYPEFGRLKDRKSDTSKTWQVPGFVGKVGFITSMTQDFCGSCNRLRITSDGNLKVCLHGEAEVSLRDVLRNNSKEQELLELIGAAVKRKKESHA-DMGDLENMKNRPMILIGG 642
163 1.000e-86UniRef50_W7NHN0 Uncharacterized protein n=25 Tax=Eukaryota TaxID=2759 RepID=W7NHN0_GIBM7  ali  32  62...LLQSRRRRIRDS-KPFSDFLTDTFHRQHDYLRISVSERCNLRCVYCMPEGVPLSPNRELLTTPEIVLLSSVFVSQGVTKIRLTGGEPTVRRDILPLMQQIGELRR-HGLKEICITTNGISLHRKLDSMIESGLTGVNLSLDTLDPWQFQIMTRRKGFEAVQKSIDRILEAGIKLKINCVVMRGVNDREVLPFVGLTEEKDVEVRFIEYMPFDGNKWSKNKMFSYQEMLDLIRTKYPTLQKVQDHKNDTSKTWHIPGFTGRIGFITSMTHNFCGTCNRLRITGDGNLKVCLFGDAEVSLRDILRKSNSGEELLEVIGAAVKRKKAKHAGI-GELEHMKNRPMILI.. 444
164 1.000e-86UniRef50_A0A1G1PGI1 GTP 3`,8-cyclase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1PGI1_9BACT  ali  37  4......................LTDKFNRRIDYLRVSVTDRCNLRCVYCMPQGVSQKAPGEILAFEEISRIVKLAIGMGIDKIKVTGGEPLVRKGLPRLLHLISSLA---GLKDLSLTTNGMLLARYSKELKAAGLKKLNISIDTLDSQKFAHIARFGKLDNVLAGIDAAGKEKFLIKLNVVMMKGLNDDEILDFVRFAQDRQIIVRFIELMPMAGNSILSEDLYMSGEEIKQRLTALGNLKRLAKFGHGPAQYYKIEGTQAIIGLISPMSCKFCFSCNRLRLTADGMLKPCLVSEQGLDLKRPLRFGE-EEEVAQLIQQAVFLKPQGHHLDFNSQRQYL---MSEIGG 325
165 1.000e-86UniRef50_A0A2W4MXB6 GTP 3`,8-cyclase MoaA n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4MXB6_9FIRM  ali  35  18......SRSSDATPPGMPVKGPLVDQFGRVVRKLRVSLTDRCNFRCLYCMPDGVPWIPSEEILSVDEIERVVRICARMGVEKIRLTGGEPLLRPGVEEIVERI---RGIPGIRAVSMTTNGFLLEEKAAALKAAGLQGINVSLDSLDRDRFRQLTRRDELERVLAGIRAAARAGEPIKINAVVMRGINDGEIETFLRWAREQPVQIRFIEFMPLDGSNVWTRDLVYTADEILEQARRVAPVEEVHNDPSDPARLYRFADGRGTFGIIASVSRPFCHACDRIRLTADGKIRNCLFAVEEYDLREMLRAGATDGDIEQAIRRAVWVKWRGHLINQQGFVKPQ-RAMYAIGG 360
166 1.000e-86UniRef50_A0A2S7R008 Molybdenum cofactor biosynthesis 1 B protein n=2 Tax=Rutstroemia TaxID=38452 RepID=A0A2S7R008_9HELO  ali  30  65.....SSSRRDALKKAKPFSSFLTDTFQRQHDYLRISITEKCNLRCLYCMPEGVPQSPPANLLTTPEIVLLSSIFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSD-GLRELCLTTNGLNLARKLDGMVAAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMKSIERILEANIKLKINCVVMRGINEQEIVPFVELGREKDIEVRFIEYMPFDGNKWSKGKMLGYQEMLGIIRQKYPTLRKVADHKNDTSKTYEIPGFVGKMGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRKSNDERELLEVIGMAVSNKKEKHAGM-GELENMKNRPMILI.. 445
167 2.000e-86UniRef50_A0A0N4ZRW2 Uncharacterized protein n=1 Tax=Parastrongyloides trichosuri TaxID=131310 RepID=A0A0N4ZRW2_PARTI  ali  32  498............GTSIPQNSQILTDTFGRRHEYLRISLTEKCNLRCNYCMPEGVPLTPKNNILTNDEILILVKLFEKHGISKIRLTGGEPTLRKDLSHLIKNIHSFK---GIKSIGLTTNGITLSRQLPELVSSGLSHVNISLDTLDPNKYMIMSRRNGFIKVMDSIKLAQNFFPYVKINTVIMRGVNDDEVVNFVKLTESENLDIRFIEFMPFGGNKFDNKIMVPYKELLEKIKKSFKEVIKLEDNKNDTSKGYFVDGWKGRFGFISSMSEHFCGTCNRLRITADGSLKVCLHGNTEISLRDLIRSGKDEKYLESVIEQAVKRKKFKHA-DMNILKNLKNRPMILI.. 830
168 2.000e-86UniRef50_B5EIK8 GTP 3`,8-cyclase n=18 Tax=Bacteria TaxID=2 RepID=B5EIK8_GEOBB  ali  38  2.....................ALIDAYGRRINYLRLSVTDRCNMRCSYCMPQGVEKLEHKEMLSYEELYRVAGACIAQGIEKIRVTGGEPLVRKGIVPFLERL---ARVPGLKELVLTTNGLQLEEMAQPLKRAGVARLNISLDSLRPEVFARITRGADLKRVLSGIEAAEKAGFNLKINMVVMRGVNDDEILDFAALSIEKPYTVRFIEYMPTLQDEGWNAQSMPGSEILARIAERYPLLPMVGAEMAGPARNFKIEGAAGAIGIITPVSGHFCESCNRIRVTAAGRMRGCLFSDQGVDLKPLLQS-LDPYRLQEEIRRIVTHKPGRHHIAEPEAEK-ITVNMSRIGG 326
169 2.000e-86UniRef50_M1E611 GTP 3`,8-cyclase n=9 Tax=root TaxID=1 RepID=M1E611_9FIRM  ali  40  1......................MTDLYGRNIDYARISVTDRCNYRCVYCMPEGVNFIPHKEILSFEEIVRIIKILKELGIKKIRLTGGEPLVRKNIVELVGKI----TKIGLDDVSLTTNGSLLKIYAEDLFKSGLRRLNISLDTLNCERFANITRKGTLIDVLEGIEKAIAVFNPVKLNVVVMKGINDQDLIALANLTIDKEIHVRFIEIMPIGDN--DQKDKFISCEEIKDNISKFFKLESTKGPFNGPAEYYKLKNSKGTIGFISPLSKHFCAKCNRIRITSDGMIRLCLFSDVEYNLKERLRSNLTDDEIKKFILETLSFKPKGHPYIQKARE-IYHRNMSAIGG 324
170 2.000e-86UniRef50_A0A2S7QHW0 Molybdenum cofactor biosynthesis 1 B protein n=1 Tax=Rutstroemia sp. NJR-2017a BBW TaxID=2070414 RepID=A0A2S7QHW0_9HELO  ali  31  42.....SSSRRDALKKAKPFSSFLTDTFQRQHDYLRISITEKCNLRCLYCMPEGVPQSPPANLLTTPEIVLLSSVFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSD-GLRELCLTTNGLNLTRKLDGMVAAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMKSIERILEANIKLKINCVVMRGINEREIVPFVELGREKDIEVRFIEYMPFDGNKWSKGKMLGYQEMLGIIRQKYPTLRKVADHKNDTSKTYEIPGFVGKMGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRKSSSERELLEVIGMAVSNKKEKHAGM-GELENMKNRPMILI.. 422
171 2.000e-86UniRef50_D4M4I4 GTP 3`,8-cyclase n=82 Tax=Bacteria TaxID=2 RepID=D4M4I4_9FIRM  ali  34  1......................MIDQYGRTIEYLRISVTDRCNLRCVYCMPEGIEQLPHEQILTFDEIERVCRISTELGISKIKLTGGEPLVRKGLPDLLGKI---KRIPGIEQVTLTTNGILLKNQLDELMRQGLDAVNISIDTLDETCYHTVTRCGELNQALEGLQVALEYPNLRVKLNCVPMNQSEEEYIQMAEYAKEHPVEVRFIEMMPIGMGKACQGK---SRDELLELLEKAFGNAEPYEKHNGPAEYVSFSGFHGRIGFISAVSHKFCDSCNRIRLTAEGYLKLCLQYESGIDLRKLLRSGATDEEVKEAMRQAIWKKPACHNFDEEVGQKKEHRAMYGIGG 329
172 2.000e-86UniRef50_A0A1B9BMV6 GTP 3`,8-cyclase n=30 Tax=Clostridiales TaxID=186802 RepID=A0A1B9BMV6_CLOBE  ali  35  1......................MVDSSGRNIEYLRISVTDRCNLRCVYCMPEGIENLEHDEILTFKEIMLIVKTVSQLGIHKIKITGGEPLVRKGIVNLVRRI---KDIDGIEEITMTTNGVLFGDMADSLAEAGLDSVNISLDTLNSTSFNKITRRDCLDKVKLGLKKAVELGLKTKINCVPIAQLNGDDLIDILKIAKENPIDVRFIELMPIGFGKSYSP---VCNEQIFEQIEQNFGTLQNSKHGNGPAVYYNLSDFKGSIGFISAISNEFCETCNRIRLTADGNLKLCLHYNKGVALKPLLRSGISKEQLKRVIENAIYNKPSHHGFNNSSTENIELKNMVQIGG 324
173 4.000e-86UniRef50_C3LA56 GTP 3`,8-cyclase n=1806 Tax=root TaxID=1 RepID=MOAA_BACAC  ali  33  7........................DKLQRPLKDLRISVTDRCNFRCRYCMPEDYSFLSNDKILSFDEIERITRIFVSLGVRKLRITGGEPLLRRGLPQLIERLN---KVDGVEDIGLTTNGSLLKKFAPDLYKAGLSRVTVSLDSLEEERFFYLNNRSKVQRVLEGIQAAAEVGMKIKINMVVQKGKNEQDILQMAQYFKENKHILRFIEYMDVGNYNGWELKEVVSKQEIVDMIHQVMPLERIEANYAGEATRYSYIGSDEEIGVISSVTDSFCSSCTRARISAEGKLYTCLFASKGNDLRELLRSDYTDEEITDVVRDIWNNREDRYSDERSNKKAMPKIEMSHIGG 338
174 4.000e-86UniRef50_A5G480 GTP 3`,8-cyclase n=41 Tax=Bacteria TaxID=2 RepID=A5G480_GEOUR  ali  38  3......................LIDSYGRRINYLRLSVTDRCNLRCSYCMPEGIPKLQHGEMLSYEDLYRVACESVALGIEKIRVTGGEPLVRKGLVQFIGRL---ADIPGLKELVLTTNGLLLGELAIPLRQAGAQRLNISLDSLKPETFARITRGGDLRKVVDGIAAAEEAGFPPKINMVVMKGINDDELLDFAALTIHKPYTVRFIEYMPTLRDKGWNSQCMAGSEILERIGRHYPLLPLVGNEMAGPSRNFKIRGSAGAIGIITPISGHFCDSCNRIRVTASGLLRGCLFADNGVDLKPLLH-GADNGPLRETLRRIVTGKPGRHHLAEDETAHG-SVAMSQIGG 326
175 4.000e-86UniRef50_A0A1F5RET2 GTP 3`,8-cyclase n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RET2_9BACT  ali  35  1.....................MLSDQFGRKVNYLRVSVTDRCNLRCRYCIPDGVSLKKHDDMLSFEEIETIVRAGVELGINKVRLTGGEPLLRKGFPELVKKL---AAIEGLKDLALTTNGILLGPLARELKQAGIKRVNVSLDTLKPERFKQMTGSDQWQQAKEGFEKALTAGFEQKLNVVAIAGYNDDEVEDFVKYAMDKPIQLRFIEFMPV-GNKFWEKGKQLNSKQLIERISKITAIVSLPPLKNSVAEEYQIVGSPATLGFISPLSHSFCRGCNRLRLTADGFLKPCLASKYEVNIKVPVRAGHAGNELRRVFYEAMRLKPRAHKMDQGFSDNI--RHMAEVGG 324
176 5.000e-86UniRef50_A0A2A4TZ04 GTP 3`,8-cyclase n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TZ04_9BACT  ali  36  5.......................VDNFGRTARKLRISVTDRCNLRCVYCMPEHPVWMPKKEILTFEELTRIASIAARHGVDRLRVTGGEPLLRKDLSVF---INMLKGIAGIREIALTTNGLLLPQQARALYAAGLDRVTVSVDSLHRERVLKLARRDVRDGVLAGIEAARAAGFEGKINVVVMRGRNEEEVGDITAWAREQNLHLRFIEFMPLEGDKIWSRSLLVPAEEIISRVKERFPLNVGVRKPGETAETYSFIDGKGSIGVIASVTQAFCGDCDRVRITADGGFRTCLFAASGTDLRGPLRSGVSDEGLAEYMKMAVSRKNRGHLVSDPAFQRP-DLAMNAIGG 329
177 5.000e-86UniRef50_A0LJI8 GTP 3`,8-cyclase n=32 Tax=root TaxID=1 RepID=A0LJI8_SYNFM  ali  41  6.......................TDPYQRRIDYLRLSITDRCNLRCTYCMPEGVPKLAHGDILRYEEILRLARIVTAMGISKIRITGGEPLVRRDVLFLCGSIAGIPQ---LRSLSITTNGVLLGRLAGGLFQAGIKRINVSLDTLKPGRFASITRQDCFEEVWKGIMAAHEAGFPIKLNAVVMRGVNDDEIADLARLTFEYPFHMRFIEFMPFKEA--DYDDRFLSSEDILDRLRSVGELVPVESTDNGPARHYRFAGAMGKIGIISPISNHFCPTCNRLRVTADGRLRTCLFAREETDLKRALRLGASDEEMMLLIRTAIADKPERHELDSRAFRKCISRPMFAIGG 329
178 5.000e-86UniRef50_A0A060I7R2 GTP 3`,8-cyclase n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A060I7R2_9RHIZ  ali  59  4.....QSGTVASPAPLWATARPMVDPFQRAITYLRFSVTDRCDFRCTYCMAENMNFLPKKDLLTLEEMNRLCSAFIAKGIRKLRLTGGEPLVRKNVMHLVRELGKQIGS-GLDELTLTTNGSQLARFADELYDCGVRRINVSLDTLDPDKFRQITRWGDFHRVMKGIDAAQNAGLKIKLNAVALKDFNDVEMPDMIRFAHGRGMGLTVIETMPMGEIEEDRTDRYLPLSKLRVDLEKQFTMREIDHRTGGPARYVTVEETGGRLGFITPMTHNFCDSCNRVRLTCTGTLYMCLGQNDAADLRSMLRATEDDGPLYPAIDEAISRKPKGHDFHRTHNRPAVARHMSVTGG 348
179 6.000e-86UniRef50_A0A2H3DYZ4 Molybdenum cofactor biosynthesis prote n=2 Tax=Armillaria TaxID=47424 RepID=A0A2H3DYZ4_ARMGA  ali  35  31...SQAQARISHVDAVSPFSPALIDTFRRRHDYLRISLTERCNLRCFYCMPEGIELSPESHLLTNEEVLRLAALFVKSGVTKIRLTGGEPTVRKGLNEIIGGLNELR-PYGLRSIAMTTNGLALPRRLPTLIDQGLTHLNISLDTLDPFKFEFMTRRRGHEAVLKALDAALAALVSVKLNVVVVKGLNDSEVLDFIEMTKGQVLSVRFIEFMPFTGNAWDKRKMVPSSVLFGKIMLHHPDVERISDEVNDTARSWRVPGYKGTFGFISSMSDHFCSSCNRLRITADGQIKVCLFDAKEISLRDAMRKGATDDELLRVIGKAVSGKQEKHANMEDI.............. 364
180 6.000e-86UniRef50_A0A0G4GTG7 Uncharacterized protein n=2 Tax=Chromerida TaxID=877183 RepID=A0A0G4GTG7_VITBC  ali  35  77....................ECLVDRFGRSHTYLRISLTERCNLRCQYCMPDGIDLSPNDSILTAHETVRFASMFAQAGVDKIRLTGGEPTVRKDFGDLAMRLG---EIPGLKTFAMTTNGVTLMRHIDTLKKARMNCINISLDTLVPAKFAFMARRNGFEKVWESINSALEGFCQLKINCVVMKGFNDDELCDFVRLTEEWPVHIRFIEYMPFTKNGWSDKRMVTKESMIKKIRKEFPSLARADDPPNETAQLYRVAGFRGYVGFISSMSDMFCGSCNRIRLTADGNLKNCLFGVEEFNIRNVLRSGNSDDEVMGVVKEAVQAKKKAHGGMHFLAEQANNRPMIKIGG 406
181 6.000e-86UniRef50_A0A2S8STC8 GTP 3`,8-cyclase n=2 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8STC8_9BACT  ali  40  1.....................MLQDRFQRLISYLRISVTDRCNFRCVYCMPEGVEVSPREEILSFEEIARIARVGATLGLSKIRLTGGEPTVRRDLPTLVSML---RAIPEIKEIAMTTNAALLDNLAIPLKNAGMNRLNISLDTLSHKKSREIARRDEFERVLAGIDAAKCAGLGIKFNTVVMRGLNDDELPDLLEFARSYDAQIRFIEYMPMGMARFDERNRLVSATQMREILSSKFDLVP-EAENGDPARGYVCNRTGARAGFISSMSDHFCDSCNRMRLTALGGLRPCLHQNAEVDARAILRNGGSDEDLQAAFLEAAGLKWAGHRMND-IIPLFSSKDMVSIGG 324
182 7.000e-86UniRef50_I1RRZ6 Uncharacterized protein n=10 Tax=Hypocreales TaxID=5125 RepID=I1RRZ6_GIBZE  ali  32  60......QPQRRRIKDPKPFSDFLTDNFNRQHDYLRISVAERCNLRCVYCMPEGVPLSPDRELLTTPEIVLLSSVFVSQGVSKIRLTGGEPTVRRDILPLMRQIGELRQ-HGLKELCITTNGISLHRKLGSMVESGLTGVNLSLDTLDPWQFQIMTRRKGYDAVQKSIDRILEAGIKLKINCVVMRGVNDREVLPFVDMTQEKDIEVRFIEYMPFDGNKWSKNKMFSYQEMLDLIRTKYPTLQKVQDHKNDTSKTWHVPGFAGRIGFITSMTHNFCGSCNRLRITGDGNLKVCLFGNAEVSLRDILRKSNSGEELLEVIGAAVKRKKAKHAGI-GELEHMKNRPMILI.. 440
183 8.000e-86UniRef50_A0A093UUT1 Molybdenum cofactor biosynthesis protein 1 (Fragment) n=3 Tax=Talaromyces marneffei PM1 TaxID=1077442 RepID=A0A093UUT1_TALMA  ali  31  833.....ASRRFEAIKSAKPFSDFLTDTFHRQHDYLRISITEKCNLRCLYCMPEGVPLSPPAHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDLVPMMQAIGDLRKD-GLKELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFKYTIMTRRNGFEAVMKSINRIEEMNHKFKINCVVMRGLNEHEIVPFVEMGREKDIEVRFIEYMPFDGNKWSEQKMVPYQEMLDIIRKSYPELEKAADHKNDTSKTYRVPGFQGKVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIREPIDDEALLDVIGLAVKRKKAKHAGIGKL-ENMKNRPMILI.. 1212
184 8.000e-86UniRef50_A0A0C2X228 Uncharacterized protein (Fragment) n=1 Tax=Serendipita vermifera MAFF 305830 TaxID=933852 RepID=A0A0C2X228_9HOMO  ali  34  4............ATNSTTVSKPLIDTFNRKHTYLRISLTDRCNLRCNYCMPPTAEFSPSSSILTTPEILRLATLFVQQGVNKIRLTGGEPTIRRDIIPLVTELSRNLRPAGLRTLAMTSNGVVLRRKLPELVENGLTHLNLSLDTLDPKTFTLVSNRPSTMHTLQTALSLSPALQSLKLNVVVMADMNLHELPAFAALTQDHPITVRFIEYMPFSGTTWRANQMIPSRVVLDRLKGKFPGIAPIVPEHHGTAKEYRIPGYKGSIGFISSMSDHFCASCTRLRITADGQLKVCLFDPREVSLRDMIRNGASDESLLEVIADAVTRKKASHGGMDLLAKNKDNRSMIRIG. 356
185 9.000e-86UniRef50_A0A292YTY0 GTP 3`,8-cyclase n=2 Tax=Effusibacillus lacus TaxID=1348429 RepID=A0A292YTY0_9BACL  ali  38  4.....................TLTDKFGRVHDYLRISLTDRCNLRCVYCMPEGMQFMENDKHLTFDEIEAVVRMAAKLGVRRLRLTGGEPLVRPNVEKLVSRL---SAIPGIEDIALTTNGIFLAQKAEKLRKAGVTRVNISLDSMKQERFAKITRGGDVSKVLAGLEASFRVFNPIKLNVVLMNRFNDDEVDDFLRMTLEREVHVRFIEYMPIGHDDNGWRDLYLPLEYVKERCEAMGMTPEPTQFGNGPAEYFRLPGAKGSFGLIHPVSDHFCESCNRLRLTADGNIKPCLFWQDEFNVRKYI---GDEQALEDLFFRALDIKPESHEFGEELSHEPTVRRMSQIGG 334
186 9.000e-86UniRef50_A0A1M6M6U9 GTP 3`,8-cyclase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1M6M6U9_9FIRM  ali  36  1.....................MLKDKFGRKINYLRISLIDRCNLRCKYCMPPGVDLYGHDKILTYEELLLIIKAAAELGINSIRLTGGEPLIRRGLIPF---IKTVSNIDGIDDIAITTNGVLLEEMADDLKKAGVNRLNISLDTLNKDKFKEITGRDQFEKVFKGINKSIEVGFPVKINVVMLKNFNEGEILDFVKLTKDKPLHVRFIEMMPLGESKNNWTAGYMPWNDALELVKREFEVRESSGPKGGPAKYYTIPGFLGTFGFITPVGEHFCHQCNRIRLTSDGFLKTCLFGNNEVNLKKLSKTG-DINKIKEAIIKSINEKPEKHQITNHN----VSRFMSQIGG 323
187 1.000e-85UniRef50_A0A2U3EJ76 Molybdenum cofactor biosynthesis protein 1 B n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EJ76_9HYPO  ali  33  53.APTASSRRERI-RSAKPFSEFLTDTFHRQHDYLRISVTERCNLRCVYCMPEGVPLSPNRELLTTPEIVMLSSLFVGQGVSKIRLTGGEPTVRRDILPLMHQIGALR-PQGLRELCITTNGISLHRKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFDAVQKSIERILEAGIKLKINCVVMRGVNDREVIPFVEMTREKDIEIRFIEYMPFDGNKWSQGKMFSYTEMLDLIRAEYPGLEKVQDHKNDTSKTWHIPGFTGRIGFITSMTHNFCGTCNRLRITGDGNLKVCLFGNAEVSLRDLLRKSNSEAELLDVIGAAVKRKKAKHAGL-GELEHMKNRPMILI.. 436
188 1.000e-85UniRef50_A0A2H6F2M0 GTP 3`,8-cyclase n=1 Tax=bacterium BMS3Abin06 TaxID=2005714 RepID=A0A2H6F2M0_9BACT  ali  35  6................KTKNQPIKDSYNRRIDYLRISITDKCNLKCVYCMPKGLKYFKEAEILTDEEIVRFIRIARNHGLRKVRITGGEPLMRKNIISLVSSI----KETGIRDLSLTTNGITLSKIAGDLKAAGLDRVNISLDTLEAARYKTITKGGDINLVRESIKEAERAGTPVKINVVPIRGINEDEILAFASLTFKENYHIRFIEFMPATRNGIWRKKRCVNSEEVLEKISTLGKLESFEFRGRGPSRNYRLKGAAGIIGIISPLSDHFCGFCNRLRLTADGKIRPCLFSREEIDIKTPMRNNATDEDIDKLFQHSIKVKPRRHLLNENTASTRIIKTMSKIGG 336
189 1.000e-85UniRef50_A0A2N9MRB4 GTP 3`,8-cyclase n=50 Tax=Bacteria TaxID=2 RepID=A0A2N9MRB4_9BACT  ali  36  3..................NAAPLRDSFGRVHDNLRISVTDRCNIRCFYCMPEGVEFVERREILDFEEIERFARIAAGMGITKIRVTGGEPLVRRDLPVLIRRL---AAIPGIHDLALTTNGVLLADLAASLYDAGLRRLNVHLDTLDRERFFQITRRDDLPKVLEGLAAAKRTGFQIKLNAVAVKNLVEDDIVPLALFARENGFEVRYIEFMPLDAQNLWDRGKVLLADDIIAALSRSPLTPIPDPDPRAPATEYAYADGGGMVGFIASVSRPFCLNCNRIRLTADGKLRYCLFAIEEDDVKGLMRSGASDEAIAALVRRNVAGKWEGHEINSTKFVAPP-RPMYSIGG 333
190 1.000e-85UniRef50_A0A1G1DXW0 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1DXW0_9BACT  ali  39  1.....................MLSDSFERQIDYLRISITDRCNYRCLYCMPNGIEPKPRHQLLSYEETLTIVELFVKLGLSRFRITGGEPLIRKGLVELIGAISQIK---GVADLALTTNGTLLARYARALKGAGLKRINISLDSLNPQKYYEITRGGNIHEVLAGIDAALDLGFPIKLNTVVIRGINDDELIDFVRFASAKPLEIRFIEFMPLGKEGIWSPEKFIPGKEIRARITREIPINPITDTRGGPAEYYQIKGSPGTIGFITSLTENICQRCNRVRLTADGYLRTCLLADREYDVKALIREGASEEEILSFIRDAIRQKPQGRCFNLDQPQISRS-PMSAIGG 329
191 1.000e-85UniRef50_A0A1V5PLY8 GTP 3`,8-cyclase n=56 Tax=Bacteria TaxID=2 RepID=A0A1V5PLY8_9CHLR  ali  42  2.....................PFSDSYARPIEYLRVSVTDRCNLRCRYCMPEGIIPIAHDAVLRYEEIVRIVRVAVSMG-----LAAGEPLVRRGIVDLVAQL---AAIPGLEDLSMTTNGMLLERYAGELAQAGLRRINLSLDTLRPERFHNITRLGSLEQVLRGREAALEAGRPVKVNTVVVRGSNDDEIVDLARLTLLPDWHVRFIEVMPLGTGEHWSEDGVVPTTEIRARVEAGPLISVPNETGVGPARYYQLPGAAGTLGFISPVSEHFCHACNRLRLTSDGLLLPCLMSDRSIDLRTPLRTGASDSELREIFQKAILAKPRGHQLAEHQL-PECLLPMSTIGG 324
192 1.000e-85UniRef50_D3DII6 GTP 3`,8-cyclase n=7 Tax=Bacteria TaxID=2 RepID=D3DII6_HYDTT  ali  32  1.....................MIKDTYGRELHDLRVSVTDRCNFRCQFCMPEDYEFYSRSEILTFEEIERIVRVSTKLGVRKVRITGGEPLVRKHIENLIHLLSH---VDGLHDISMTTNGFLLSQKAKLLKDAGLKRITVSFHSLKDEVFSKVVGKDKVSDILKGIETAIDVFHPVKVNVCVVRGLNDSEVLDIAKFFKSMGVVVRFIEFMDVGNINGWSLERVVSAKDIVNIISKEFDIEPVEKYRGEVADRYRYKDDGLEFGVISSITQPFCGDCNRLRLTADGKLLTCLFATDGYDIKRLIRSGASDEKLQEFIRGVWQSRKDRYSEERRRGEILRKVEMFKVGG 334
193 1.000e-85UniRef50_A0A1Z5T6R2 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5T6R2_HORWE  ali  32  52...SPSSSRREALREAKPFSDFLTDSFSRQHDYLRISVTERCNLRCLYCMPEGIDLSPPKTQLTSPEIFYLSQLFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRS-NGLRELALTTNGISLHRKLDAMVEAGLTGVNISLDTLDPFQFQLLTRRQGFDAVMKSISRVQDAGVKLKVNCVVMRGLNDHQIMPFVDMTRDQDLEVRFIEYMPFGGNKWEEQKMMPYAEMLDVIREKYPTLTRMQDAKNDTSKSWHIPGFAGRIGFITSMTHNFCGTCNRLRITSDGNLKVCLHGETEVSLRDLLRTERNERQLLGVIGAAVKRKKAKHAGM-GELENMKNRPMILIG. 438
194 1.000e-85UniRef50_A0A0U1M3D2 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1M3D2_TALIS  ali  31  865.......SRKDALKSAKPFSEFLTDTFARQHDYLRISITEKCNLRCLYCMPEGIPLSPPAHMLTTPEIVYLASLFVSQGVTKIRLTGGEPTIRKDIIPMMQAIGNTRRD-GLRELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIARIEEAGIKLKINCVVMRGLNDREIIPFVEMGRDKAIEVRFIEYMPFDGNKWSEGKMVPYQEMLATIREKYPALEKVMDHKNDTSKTYRVPGFEGKVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIRKNERERELLNVIGMAVKRKKAKHAGI-GQLEKMKNRPMILI.. 1243
195 1.000e-85UniRef50_W9CNK6 Molybdenum cofactor biosynthesis protein 1 B n=1 Tax=Sclerotinia borealis F-4128 TaxID=1432307 RepID=W9CNK6_9HELO  ali  31  61........RRAELKDSKPFSSFLTDNFQRQHDYLRISITEKCNLRCVYCMPEGVPQSPQQDLLTTPEIVLLSSLFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSR-GLRELCLTTNGLNLSRKLDGMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMRSMDRILHAGIKLKINCVVMRGVNEREIIPFVELGRDKNVEVRFIEYMPFDGNKWSQGKMLSYKEMLDIIRQKYPTVQKVTDHKNDTSKTYEIPGFVGKMGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRSSANERELLEVIGMAVSRKKEKHAGM-GELENLKNRPMILI.. 438
196 2.000e-85UniRef50_UPI000C0BED4E GTP 3`,8-cyclase MoaA n=1 Tax=Sphingobacterium sp. 1.A.5 TaxID=2044604 RepID=UPI000C0BED4E  ali  32  1.....................MLKDKFGREIDYLRLAVIDRCNLRCTYCMPEGLNWLSKNELMSNEEMLRICRIFTEMGVSKIRITGGEPFLRKGIMPF---LNDLTQLNGLKNIAITTNGLNTFKNIQELKNLGIKSINLSLDSLDSERFFQITRRDELSKVLDTLDQLIENQFEVKVNTVVMDGVNTADIYPLVELTKNKPISVRFIEEMPFNGGTHEISLKWDANCIIKHIQSAYPKLDKIEDERNSTAMNFNIPGYQGNIGIIAAYTRNFCGSCNRLRLTSVGELRTCLYQSKGINLRDLMRQGNSDQEIKEFIELALIHKPKDGWEAEKQYFSMTHQSMASIGG 328
197 2.000e-85UniRef50_H8KW40 Molybdenum cofactor biosynthesis protein A n=1 Tax=Solitalea canadensis (strain ATCC 29591 / DSM 3403 / NBRC 15130 / NCIMB 12057 / US  ali  31  1.....................MLVDKFGRKINYVRIAVTDRCNLRCSYCMPENQHFLERENLLTYEEISYLLNILSREGVNKVRITGGEPFVRKDISFLLKEI---AKIDSIEKLTITTNGVLTSSYINELKDAHIKQLNLSLDTLNRDKFLLLTKRDEFEAVQTSFHSLVKNNFLVKLNMVVMDEFNTNEIYDFVELTRNLPISVRFIEEMPFNGQGNSYSGIKWNYQTIVSHIREKYHLRKLQDPTNAIALHYKINNFAGNIAVIPAYSRTLCGTCNRLRITATGDLKLCLYGDPVLNVRDLLRSGISEENLIKTIQNAVLNKPLNGFEAEKQKTSSFHESMSIIGG 325
198 2.000e-85UniRef50_A0A1B9F8K4 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1B9F8K4_9DELT  ali  37  1......................MKDRYGREIRYLRISVTDRCNLACTYCNPENFSWIPSNELLTLEEIEFVARAFSRLGLKKIRLTGGEPLLRKGIVDLAKKLY---SIQGIEEVCITTNGVLLLDYADSLYDVGVRHINISLDTLRPERFKEVSGKDALHRVLAGIERVIELFFPIKINTVLIKGINDHELFDFARLTMENVLEWRFIEYMPIGSKCSWQEGEVITTDTAKKRLEEQFGPLEPNGKWHGPAKLFRIKGAKGLIGFISPMSHHFCDTCNRLRLTPDGKLRLCLFSDNEVDLKTKIREGMSIEALSKFLKEVVYDKPLG--PVAQNKEPGCERAMRAIGG 327
199 2.000e-85UniRef50_A0A192WT06 GTP 3`,8-cyclase n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192WT06_9BACT  ali  37  2.....................ALVDGFGRQHDDLRVSVTDRCNLRCAYCMPEEPEWFPRERILSFEEIERLVRLLVADGVRKVRITGGEPLVRSGIESLVGML---AAIDGVEDLSLTTNGVLLDRLAEPLRRAGLRRLNVSLDTFRADRFAELTRRDQLDRVLAGLVAARDAGFERKINTVLMPGVNDDEVEEIVERSRREGYEVRFIEFMPLSNGSWDPARVLSGDKVRERIEARWPLTPDPAGDPHAPATRYLFTDGAGAVGFINSVTAPFCSNCSRLRLTSDGHFRVCIYDNNEVDLKTPMRAGASDESLREQVVEALSRKTRGGALEEKQAALPLARTMHQIGG 329
200 2.000e-85UniRef50_F8A8W9 GTP 3`,8-cyclase n=3 Tax=root TaxID=1 RepID=F8A8W9_THEID  ali  36  1.....................MLIDSYGRKITYLRVSVTDRCNLRCFYCSSKDFAKLPPEKILSYEELYQIIKVAVSLGVKRVRLTGGEPLVRKDLVSFVAAL---AQIPGLEDLALTTNGILFASMALDLKKAGLKRVNISLDAITPQKYKEICGIDALNQVLAGIEKALEVGFPVKINMVVMRGLNDDEAIEMARLTLKEPLEVRFIEFMPIGSGAPWEEDLFMPVSEIEKRLKEVFELHPASKIGAGPAKVFTLPGAKGSVGFISAISNHFCHKCNRLRLTPEGRLRLCLFSDEEIDLRPFLNQKNPQEALKEAFLKAIQRKPSQRSLD-----TSPKRLMRSIGG 323
201 2.000e-85UniRef50_UPI000A05CA01 GTP 3`,8-cyclase MoaA n=1 Tax=Hippea sp. KM1 TaxID=944481 RepID=UPI000A05CA01  ali  40  1......................MIDRFGRRINYLRISITDRCNFRCIYCMPDGIEWKPMSEILSYEEIALFVLVAAELGINKIKLTGGEPLVRKGIDGLVSML---KSINGIDEISLTTNGSLLKKYARGLKEAGLDRITISLDTLKPDRFRLITRLGNIEDVLEGFDVLDELGFKNKINTVVMRGVNDDEVLDLMEFALNRGVDIRFIEFMPTDVVKDWQRYFISIND-IKSIIETRYTLKPADKKSNGPSVYYSV--GDGFVGFITPLSKTFCSVCNRIRLTSDGAILPCLGHPDRVSIKEAARKG-DKDRLKRLLREAIRIKPKEHALLSENIHS----SMSAVGG 318
202 2.000e-85UniRef50_A0A2G5I4M6 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Cercospora beticola TaxID=122368 RepID=A0A2G5I4M6_CERBT  ali  33  51..PSQPARKEKLRD-AKPFSEFLTDNFDRQHDYLRISLTERCNLRCTYCMPEGIQLSPDREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRR-NGLKELALTTNGISLHRKLDDMVEAGLTGVNISLDTLDPLQFPLLTRRNGFNAVMKSIDRVQEAGIKLKINCVAMRGINDDQILKFVEMTREQDLEVRFIEYMPFGGNRWAQKKMLPYAEMVDLIKVQYPTLSRLQDAKNDTSKTWQVPGFKGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLLRADNSERQLLEVIGAAVKRKAAKHA-DMGDLENMQNRPMILIG. 437
203 2.000e-85UniRef50_A0A0Q4GH97 GTP 3`,8-cyclase n=156 Tax=Bacteria TaxID=2 RepID=A0A0Q4GH97_9SPHI  ali  34  1.....................MIADSFGRIHDYLRISLTDNCNFRCFYCMPEEYDFTPASRLMQTDEIIKLAEIFVANGVKKIRLTGGEPLVRKDAAEIIAALGKLP-----VELVITTNGTRIAEMLPVLKEAGIKTINISLDTLQPEKFFMITRRDVFHQVRSNIELLLQHKIKVKVNMVVMKGLNDNEINDFISWTKHNPIQIRFIEFMPFSGNK-WTSNKMFSLDEILAVVEKDFTVLPVKGEPHDTAKSFMIPGHEGSFAIISTMTNPFCDTCNRMRLTADGKLKNCLFSDSETDLLTALRNN---EEVLPLIQSTIWSKKKALGFEKIDATTIQNRSMITIGG 326
204 3.000e-85UniRef50_A0A1Z8ZE01 GTP 3`,8-cyclase n=36 Tax=Bacteria TaxID=2 RepID=A0A1Z8ZE01_9PROT  ali  55  1.....................MLLDPFKRPVSYLRVSVTDRCDFRCEXCMAENMTFLPKKDLLTLQEIERICISFXKLGTTKIRITGGEPLVRKNVMSLFKNLGSYLKKGPLKELTLTTNGSQLEKYALELFNSGVKRINVSIDTLKPDLFAKLTRRGNLDQVLRGVYAAKEAGLKVKINTVALKETNEHEITDILKWAHSHNFDMTIIETMPLGEIEYDRTDQFLPLSKVKESLEKNFTLLKSQHYTGGPSRYFDVKETKNRIGFITPLTHNFCELCNRVRLTCTGKLYMCLGQDDSADFVEAARSINWEENLKNAIVEAISRKPKGHDFVIRRKQSPSKRHMSVTGG 329
205 3.000e-85UniRef50_A0A1G5S0X9 GTP 3`,8-cyclase n=94 Tax=Bacteria TaxID=2 RepID=A0A1G5S0X9_9FIRM  ali  41  1......................MQDAYGRTIRYLRISVTDRCNLRCRYCMPPGMPKLGHESILRNEEIVEVARVAAGLGINKIRLTGGEPLVRKGIIELVAQL---AAIPGIEDLAMTTNAVLLDTMAAPLKAAGLRRINVSLDTLNPERFKEMTRGGDLSRVLKGLEEAERVIWPIRLNSVLIGGENDSEIRALAELTRTKGYDVRFIELMPIGEAATWTEEHFISTDRILEVLPE--LVPDIAKAHDGPARYFRLPGASGRIGLIQPVSCNFCADCDRIRLTADGKLKPCLHSDKEIDLLAAIRAG---EDVAPIIQQAVGLKPERHHMEESDY-VPIVRGMYKIGG 321
206 3.000e-85UniRef50_A0A162Z408 4 iron, 4 sulfur cluster binding n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A162Z408_DIDRA  ali  32  67.TPSRQSAKARIQENVKPFSEFLTDNFQRQHDYLRISITERCNLRCLYCMPEGIPLSPPATMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGSLR-PKGLRELALTTNGISLHRKLDAMVEAGLTAVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEANVKLKVNCVVMRGLNEREILPFVDMGREKDMEVRFIEYMPFGGNKWSENKMIGFQEMVDMIRTKYPGLARIPGHKNDTSKTFQVPGFVGKVGFITSMTNDFCSSCNRLRITSDGHLKVCLHGNDEVSLRDLLRKDNSNEELLSVIGQAVKRKAEKHA-DMGDLANMQNRPMILIG. 454
207 3.000e-85UniRef50_A0A1T9BNQ3 GTP 3`,8-cyclase n=93 Tax=root TaxID=1 RepID=A0A1T9BNQ3_9MYCO  ali  38  2....................TPLIDSFGRIATDLRVSLTDRCNLRCTYCMPEGLDWLRSNALLTAEEYIRLIGIAVELGIRSVRFTGGEPLIYKDLERI---VTAVAALSPRPDIALTTNGIGLDRKAAALRDAGLDRINVSLDTLDADRFAAITRRDRLTDVLAGLEAASAAGTPTKINAVLTPEQYKEDSVELLRFSLERGFELRIIEQMPLDAGHHWSRAHMVTADEVHAALSREFTLSADPAPRGSPAQRWLVNGGPATVGIIASVSRPFCGDCDRTRLTADGQVRNCLFATTETDLRGLLRSGADDDVVASAWQAAMWGKKPGHGINDPSFLQP-DRPMSAIGG 330
208 4.000e-85UniRef50_Q9I3K7 GTP 3`,8-cyclase 2 n=113 Tax=Proteobacteria TaxID=1224 RepID=MOAA2_PSEAE  ali  47  2..................SDSRLVDPFGRRITYLRLSVTDRCDFRCTYCMSEDMQFLPRDQVLSLEELYAVADAFIGLGVRRIRITGGEPLVRKGITGLLARLGQRAE---LEDLAITTNGSQLRERAAELKAAGVRRLNVSLDSLQRERFAAFTRSDRLEQVLDGIQAAREAGFERKLNCVVQKGRNDDEILDLVEYALANQLDISFIEEMPLGSITSHRRELTCTSDEVRAIIERRWPLTPSLARSGGPSRYYQIGDEPSRIGFISPHSNNFCGDCNRVRVTAEGKLVLCLGHEGALDLRELLRSHPGDRELSAALVAALNLKPERHHFDAQE-QVQVLRFMSMTGG 331
209 4.000e-85UniRef50_A0A2C5XGD8 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Hypocreomycetidae TaxID=222543 RepID=A0A2C5XGD8_9PEZI  ali  31  91..PVAPAGSLSTPHAAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPPRNILTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRSDIVPLMQQIGALRSR-GLRELCITTNGISLHRKLDAMVDAGLTGINLSLDTLDPLQFQIMTRRKGFEAVQRSIDRVLAINHKLKINCVVIRGVNDREILPFVELTRSHNLEVRFIEYMPFDGNRWNKAKMLSYADMLDIIRRVHPDVHAVRGHANDTSKTWQVPGHVGRLGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDVLRQANSENQLLHVIGQAVRRKKEKHAGI-GELEHIKNRPMILI.. 490
210 4.000e-85UniRef50_D9S0C9 GTP 3`,8-cyclase n=15 Tax=Bacteria TaxID=2 RepID=D9S0C9_THEOJ  ali  39  1......................MKDRFGREIDYIRVSVTDRCNFRCIYCMPEGVMPKTCADILRFEEIARFLEAIVPLGISTVRITGGEPLVRKGIADFVRMV---RRIPGVKDIAMTTNGSLLAGMAADLKSAGLNRVNISLDSLRPERFGRVTRGGDLKSVLKGIDAALENGEPVKINCVVIKGFNDDEIMDFAKLTIERNLTVRFIELMPVGESKKARMNFVPAG-RISRSLGGELEPVEYPEEGKGPAVYYRLPGAKGFIGFIAPMTRHFCAECNRVRLTSDGKLKVCLDSEEEFDVKAALRGGASGEDLRRIFTGALMRKPDGHRMNAVRFGKP-GRTMCQIGG 324
211 4.000e-85UniRef50_A0A085MT03 Uncharacterized protein n=2 Tax=Trichuris suis TaxID=68888 RepID=A0A085MT03_9BILA  ali  33  373...VEPQAAEGPTSSSQPMNWTLRDSFGRFHNYLRISLIDQCNLRCQYCMPEGIPHCSSDKLLSKEEIVHLTSLFVRLGVTKVRLTGGEPTIRKDLTDIVDSLSG---IPGLKKIALTSNGLILGKVLPGLREKGLTHLNLSLDTLIEPKFQLITRSVGWKRVWKTIEIAEKLFPIVKINCVVIRGVNDDELCDFVELTRRRPLDVRFIEYMPFGGNKWEHRKMVSYAEMMETIQRQFGNLRKLDNEMQDDTSK--VPGFHGRVGFITSMSQHFCATCSRLRLTADGCLKVCLHGNSEVSLVKALRSGASEEELIQLINEAVKLKKKHHAGEKWSFHCNK......... 705
212 4.000e-85UniRef50_A0A0D2AEF7 Molybdenum cofactor biosynthesis protein A n=1 Tax=Verruconis gallopava TaxID=253628 RepID=A0A0D2AEF7_9PEZI  ali  31  66..PRRVMSRKEAIRNAKPFSDFLTDNFNRQHDYLRISITERCNLRCLYCMPEGVQLSPPEHLLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRPDVVQLMQQIGSLRSK-GLKELALTTNGISLHRKLDAMVEAGLTGINLSLDTLDPFQFQIMTRRKGFEAVMRSIDRVLEANLKLKVNCVVMRGMNDREIVPFVELGREKDIEVRFIEYMPFGGNKWSKGKMLSYQEMLDIIRTKHPGIHRVQGHRNDTSKTYQIPGFVGKVGFITSMTDDFCGTCNRLRVTSDGNLKVCLHGNTEVSLRDILREGNREHKLLDIIGRAVKRKKEKHAGM-GELENMENRPMILIGG 455
213 6.000e-85UniRef50_A0A2H0LXL8 GTP 3`,8-cyclase n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_42_13 TaxID=1974746 RepID=A0A2H0LXL8_9BA  ali  37  1.....................MLQDNFGRKIDYLRLSVTDRCNLRCRYCMREGIGYLAQYEILTLKEIARIARVFARCGIVKIRLTGGEPLLRQDIAAIMRSIFDHG---GIRDICLTTNGVLLKDKAASLKAAGLRKINISLDTLKRDRFAFISRGDFLNNVLSGVDEAVNAGFLVKLNVVAIKGVNDDEILDFVEFCQKKKIILRFIELMPVSANFNLGDCRYLSRRDIEKVLRTLGALTPQGQLGSGPADYYGMPGFLHPVGFISAMSGKFCFRCNRLRISAKGEIFPCLSSRRKINLRNYLRSGASDEELMALIKQSVADKPREHCLNQ--GENVLTSFMSVIGG 324
214 6.000e-85UniRef50_A0A1G1LEC8 GTP 3`,8-cyclase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1LEC8_9BACT  ali  38  6.......................VDSFGRGISYLRISVTDRCNLRCCYCIPPGFPFTCRTDILSYEEILRLSECFVDLGIDKIRLTGGEPLARRNLSSL---VNALSQIPGIKDLSLSTNGIFLADQAEDLFEAGLKRINISLDTFSSAKFRQIAGWDVHHRVVTGIEKAIQVFHPVKINAVIMKEINDDEIESFVAFAMEHPVEVRFIELMPTHNSFVAKKKYFVSNDWVKNEIAKWAVLLPEPRLPGDVSEVYRPAHGVGKIGFISSISHPFCSECNRIRLRVDGTLKLCLHGEETFDLRTPLRGGKSKAELVQLIREAAQLKPKGHQFTGSVEDEAVA-YMCQVGG 329
215 7.000e-85UniRef50_A0A250WPM6 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250WPM6_9CHLO  ali  37  126......................LTDQFSRRHTYLRISLTERCNLRCVYCMPEGVQLTPGGSLLSTSELLRLASLFVEAGVNKIRLTGGEPTVRPDLIELCRHLSMLS---GLKTLAMTSNGIKLERQLPELKAAGLNALNISLDTLKAERFEVLTRRKGHDRVIKSIATAVNLYNPVKVNVVVMRGVNDDEISDFVMLTKDRPINVRFIEYMPFDGNIWRDTKMVTYKEMLERVEQSISRMNRLTDPKGEVAKNFKIEGFQGTVSFVTSMTSLFCGDCNRLRLLADGSLKVCLFGANEVSLRDAMRGGASDSDIRLIIGAAVQKKKASHAGMFEIAATA-NRPMITIGG 473
216 8.000e-85UniRef50_A0A2P6MX67 Phospholipase D1 n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MX67_9MYCE  ali  35 1683...SNSSIQRSAQSMPV-VDEMLIDTFSRKHNYLRISLTERCNLRCQYCMPEGIELTPSENIMTQDEILRIATLFVESGVTKIRLTGGEPLVRKDVVDICERLG---ALPGLKHLGMTTNGLTLPRKIGDLHRVGVNLLNISLDTLKADKFTFITRRLGFERVKESIDLALNKYNPVKINCVVMKGFNDDEIWDFVEMTKEQDMEIRFIEYMPFGGNRWSDKKFISYQEIIDKIKRLHPEFKRIPEEESETSKLWKVPGYKGRIGFITSMSQHFCSSCNRLRLTADGNLKVCLFGQEEVNLKDYMRKGATDEELRRWIDMAVKKKKSSLGGDMYELAKGTNRPMILIGG 2031
217 8.000e-85UniRef50_B9XSN7 GTP 3`,8-cyclase n=6 Tax=Verrucomicrobiales TaxID=48461 RepID=B9XSN7_PEDPL  ali  37  7......................LVDSHGRTLRDLRVSITDRCNFRCMYCLPETEQWQPKSKLLTFEEIERVVRIAAELGIQKIRLTGGEPLLRKDVEQLVSLI---AKVPGIEDLAMTTNGFLFPEKGKALRDAGLKRISFSLDSLDRANFQKMTGRDGLTEVLESIRFAQELGMPVKVNAVIIRGINDHEIEALAAFARERDLSMRFIEFMPLDSAHAWKKEFVMPGREILERLQRSHQLQPVSDNPAETARRWRFSDGRGELGLISPVSEPFCGHCNRLRLTADGKIRTCLFSVTEHDLRERLRSGASDDELNEYLQSVAWQKEDRHHIGEADFVAPE-RSMSCIGG 352
218 8.000e-85UniRef50_A0A291GZ82 GTP 3`,8-cyclase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A291GZ82_9MICO  ali  38  10.MPTPRRTDDTAAALPRPATPALADRFGREATDLRLSLTDFCNLRCTYCMPSGMVFLPKDQLLSAEEVVRLVRIGVELGIEQVRFTGGEPLTRPDLEQIIAGVAALEQRP---DISLTTNAIGLDHRAARLREAGLDRINVSLDSVVSETFERLTRRPLLHRVLAGIDGARAAGSPIKINAVLLPGVNDHELPDLLDWCLDRDLQLRVIEQMPLDADHIWERDTMVTAGDVQGMLAERFLLAPVSEARDGPAELFEVADRRGRVGIIASVTRPFCADCRRTRLTAEGRVRTCLFSREETDLRAALRSGADDEHIAQIWRAAQWGKKAGHGMDRADFVQPE-RPMSAIGG 366
219 1.000e-84UniRef50_A0A101EX67 GTP 3`,8-cyclase n=33 Tax=root TaxID=1 RepID=A0A101EX67_9BACT  ali  41  5........................DRFGRKISYLRISVTDRCNFRCVYCMPPGVPWRPHGEILRYEEIVRVVRAAATLGIRKVRLTGGEPLVRRGLADLVREL---SEIPGIEEVVLTTNGALLSENAEALAAAGLSRVNVSLDTLRPERFREITRLGRLEDVWEGILAARKAGVPIKLNAVVLRGVNEGEVAEIAALAR-EGFKVRFIEWLPLGGVGEADPGWFVPWEEVRARVEALGPLRPLGVQ--GPARVFSLPGG-GEVGFIAARSAPFCPSCNRMRITADGKLRPCLLSPLEIDLKGPLRAGATQDELVRLLAEGLRTKPWAHG-----AEAPNDRGMSEIGG 320
220 1.000e-84UniRef50_A0A183EPV4 Uncharacterized protein n=1 Tax=Gongylonema pulchrum TaxID=637853 RepID=A0A183EPV4_9BILA  ali  29  3...TQTVAAVPSQCSSLPESHKLVDAFGRQHKYLRISLVEKCNLRCRYCMPEGVQLSASDKIMRLEEIVRLATVFAESGVKKIRLTGGEPTLRKDLVEIVE-------INGIEHVAMTTNGIAARRKLETLAKNGLRSVNISLDTLDPERYLEVTRRRGLNEVLRTIELAISIFTQNKINNVVIRDFNDDEVPAFVRLTQNKNIEVRFIEYMPFMGNNFTTKKLISYKELLKRLDGEFPQILKIANEPNSTAKIYKVQGFRGTFGFISSMTEHFCGSCDRLRITADGNLKVCLHGSSEVSLRDILRSGGTNEDIRRTIIEAVKRKKERHAG.................. 348
221 1.000e-84UniRef50_A0A2E1MTH9 GTP 3`,8-cyclase n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E1MTH9_9RHIZ  ali  51  15......................LIDNHGRTINYLRLSVTDRCNYRCTYCMPEKMKFLPKKDLLTFEEMDHLCSLFISRGIKNIRLSGGEPLVRKGIFKFISNLSRYISNGDIDEITLTTNGSQLKSFSDDLFQSGVRRINVSLDSLSEEKFNQITRRDDLNNVIDGLEAAKKAGLKIKINTVVIKNKNLDEIENIISWSHKNNFDISLIETMPMGLTDKDRIDQYISLSDVKSIIEKKLTLNDSNYKTSGPSKYYRVKETDGLIGFITPLSDNFCSSCNRIRLTSTGKLYMCLGQNNNIDFRNLLRKG-DEKSLNLAIDSAMKNKPKSHDFDISHKNQTPDRHMSVTGG 342
222 1.000e-84UniRef50_UPI000D781026 molybdenum cofactor biosynthesis prote n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D781026  ali  32  71..............SSSKSAPSLVDSHSRHHSYLRISLTERCSFRCTYCMPEGVPLTPDDRLLSTEEVKRIARVFVQMGVKKIRLTGGEPTLRKDLVDIVRYLDSLRGE-GLESIGITTNGLVLARSLPELVAAGLTHVNISIDSLLPDRFASISRPKTLARVLATIDDSLRYAPKVKLNVVVIKGMNDDEVASFVEMTRHRNLDVRFIEYMPFNSNAWSTQALIPAAELLQRVQAAHPPVQRHVDEANDTTRHYAIRGYKGRFGFISSMTDHFCSTCNRVRVLADGNLKVCLFGNKEVSLRDAMRSDVDDEGLGKLISGALDRKHFKHAGMRDPKEIWEGREMSRIGG 423
223 1.000e-84UniRef50_A0A0L1HDP8 Molybdenum cofactor biosynthesis protein n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HDP8_9PLEO  ali  31  63........RRAAIKKAKPFSDFLTDTFNRQHDYLRISITERCNLRCLYCMPEGVPLSPSANMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGSLR-PKGLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEANVKLKVNCVVMRGLNEREILPFVEMGREKDIEVRFIEYMPFGGNKWSENKMISFQEMLDNIKTKYPGLRPVAGHKNDTSKTYEVPGFVGKVGFITSMTNDFCGSCNRLRITSDGNLKVCLHGNAEVSLRDVLRQGNNERELLDVVGAAVKRKAEKHA-DLDDLANMENRPMILI.. 440
224 1.000e-84UniRef50_Q721B9 GTP 3`,8-cyclase n=257 Tax=Firmicutes TaxID=1239 RepID=MOAA_LISMF  ali  35  4......................LKDKFGRVHDYIRISVTDRCNLRCVYCMPEGLTFLPHEKVLSKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIVRGLG---AIPEIEDISITTNAMYLAKKAEALKDAGLTRVNISLDSLHEDRFKAITRGGRLQKVLDGIQKAEEVGFPIKLNVVLIKGQNDDEITDFLRFTKDKDINIRFIEYMPIGHAGTSWKEKYLPLDTIFEACNEAGYEYEPVDSINGPSENFRIKGAKGTFGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEMNIRPFIQDPV---KLMQLVQKAIDNKPENHEMDEVQSNKPTWRRMSQIGG 333
225 1.000e-84UniRef50_A0A1X6ZF27 GTP 3`,8-cyclase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1X6ZF27_9RHOB  ali  58  4.....................PLIDPFQRPISYLRVSVTDRCDFRCVYCMSENMTFLPKKELLTLEELDQMCSTFIGLGVEKLRITGGEPLVRRGIMTFFDNMTRHLDSGALKELTLTTNGSQLARFAGDLHSAGVRRVNVSLDTLDEQKFADITRWGRLPQVLKGIDAAQAAGLRVKLNVVALKGFNEDELFTLVEWCHARDIDLTFIEVMPMGDGNEDRLDQYWPLKDLRARLGEEYTLIDLTERTGGPARYVQLAETGQKIGFITPLTHNFCESCNRVRLTCTGELYMCLGQEDMADLREPLRKSPDDMQLEDTIRAAIARKPKGHDFDRQDVAGKMTRHMSHTGG 335
226 1.000e-84UniRef50_A0A2H3ILQ3 Elongator protein 3/MiaB/NifB n=1 Tax=Penicillium occitanis TaxID=290292 RepID=A0A2H3ILQ3_9EURO  ali  32  779.TPTPSRRFEAI-KSAKLFSDFLTDTFHRQHDYLRISITEKCNLRCLYCMPEGVPLSPPAHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDLVPMMQAIGDLRKD-GLKELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFKYTIMTRRNGFEAVMKSINRIEEAGIKLKINCVVMRGLNEHEIVPFVEMGKEKDIEVRFIEYMPFDGNKWSEQKMVPYQEMLDIIRKTYPQLEKVADHKNDTSKTYRVPGFQGKVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIREPIDDEALLDVIGLAVKRKKAKHAGIGKL-ENMKNRPMILI.. 1161
227 2.000e-84UniRef50_A0A1Q7SQG0 Cyclic pyranopterin phosphate synthase MoaA n=3 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A1Q7SQG0_9ARCH  ali  34  2...........ITEASVPRPKLLVDTKGRIAAKLRISVTDRCNFACLFCMPDKMRWLPSADLLSFDEIERVTRVFVSMGISKVRITGGEPLLRNGVEELVKQLTG---IDGLESVDMTTNGWFLGSRAQALKAAGLRGVTVSLHSLKEDRFAKVSGMNALPRVLESISEAIRVGRPLKINSVAIRGYNEDEILDLVNYARKLNVAIRFIEFMPLDGLDIWDRDKMVTGQEILETVRSRYSILPAGRGNGETASIWKFADGRGELGVITPMSEPFCDDCDRLRLTSDGKLLSCLFDTEYHDLKPILRNGEDDEKLAAFVREAVWKKPEGVGYMPWIKQGWKNRNMNAIGG 340
228 2.000e-84UniRef50_A0A2T2PA60 Uncharacterized protein n=1 Tax=Corynespora cassiicola Philippines TaxID=1448308 RepID=A0A2T2PA60_CORCC  ali  32  57.SPVPRASLQQRREAAKPFSEFLTDSFDRQHDYLRISITERCNLRCLYCMPEGVPLSPPAHMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQSIGTLR-PKGLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMRSIDRILEANLKLKVNCVVMRGLNERDIIPFVEMGREKDIEVRFIEYMPFGGNKWSQGKMISFQEMLDIIRTKYPGLRSVPGHKNDTSKTYEVPGFVGKVGFITSMTNDFCGTCNRLRITSDGNLKVCLHGNDEVSLRDLLRKGDRERELLNVIGVAVKRKAEKHA-DLGDLEKMENRPMILI.. 444
229 2.000e-84UniRef50_A4A2Z3 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A4A2Z3_9PLAN  ali  39  1................MTPQTPLADRFGRVHTSLRISVTDRCNIRCFYCMPENVQFKPRAELLTFEEIERVARLAVSLGVRKFRLTGGEPLVRAQLHELIQRL---AAIPGVEDLALTTNGVLLADQAAALHDAGLRRLNVSLDGLSEEMFRRITRRQGVDRVLQGIAAAQAVGFQIRLNAVSIRGLTESEIVPLARFSREHDLELRFIEFMPLDADKNWGEAQVLSGAEVREVISRDVAEPACRADLSQPAVDYEYADSPARVGFINSVTEPFCGDCNRLRITAEGQLRNCLFSTAEWDVRALLRSGATDEVVAKLFHDCTSAKRRGH-GSDDQGFADTQRAMYQIGG 333
230 2.000e-84UniRef50_A0A2I0RZY9 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Cercospora TaxID=29002 RepID=A0A2I0RZY9_9PEZI  ali  33  51..PSRPERREKLRD-AKPFSDFLTDTFDRQHDYLRISLTERCNLRCTYCMPEGIQLSPDREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRR-NGLKELALTTNGISLHRKLDDMVEAGLTGVNISLDTLDPLQFPLLTRRNGFNAVMKSIDRVQEAGIKLKVNCVAMRGVNDDQIPKFVEMTREQDLEVRFIEYMPFGGNRWAQKKMLPYAEMVDLIKMQYPTLARLQDAKNDTSKTWQVPGFRGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLLRADNKERQLLEVIGAAVKRKAAKHA-DMGDLENMQNRPMILIG. 437
231 2.000e-84UniRef50_A0A2A4P4E7 GTP 3`,8-cyclase n=180 Tax=Bacteria TaxID=2 RepID=A0A2A4P4E7_9SPHN  ali  54  1......................MRDAFGRQIDYIRLSVTDRCNLRCTYCMAEDMQFLPRRDLLTFEEIEALARHLXARGVRRIRLTGGEPLVRKGIMDLVGRLARLRGD-GLQELTLTTNGTRLPDMAQDLYDAGXRRINVSXDTLDRERFAQLTRRDEFDRVISGIEAARAAGLXIRINAVAMRGLNDDELPALLXWCSERGLDLGLIEAMPLGEVSLDRQSTHLPLDDVRAEIERXFTLVPSLHRTGGPARYFDVADTGTRLGLITPLSDNFCAGCNRIRIGATGTVYGCLGHDQKVELRDIIRAGG-EEALDAALDRLLAGKPLRHAFDVXQREPALARHMSVTGG 325
232 2.000e-84UniRef50_A7GU01 GTP 3`,8-cyclase n=161 Tax=Bacteria TaxID=2 RepID=MOAA_BACCN  ali  32  2...................HEKVRDSFGRPLQDLRISVIDRCNFRCTYCMPPDYAFLQEEFLLTFDEIERLAKLFAGIGVKKIRLTGGEPLLRKDLPKLIKRL---ASLDGITDIGLTTNGIHLTKQAKALKEAGLQRVNVSLDAIEDNVFQKINGRNSTKPVLKGIIAAKEVGLEVKVNMVVKKGMNDSQVLPMATCFKEQGIPLRFIEFMDVGSTNGWNFEQVVTKQELIEMIGNVYPIEPAEPHYFGEAKRYCYIGSDVEVGFITSVSESFCSSCTRARISADGKFYTCLFATEGTDLRALLRTNCSDNELLQVIQDVWRYRKDRYSDEEESAKNRAKIEMSYIGG 337
233 3.000e-84UniRef50_A0A1Y4L991 GTP 3`,8-cyclase n=1 Tax=Lachnoclostridium sp. An181 TaxID=1965575 RepID=A0A1Y4L991_9FIRM  ali  36  1......................MQDQYGRVIDYLRISVTDQCNLRCVYCMPENLRFLPKDELLTDEEIVRLCRIFADIGISRIKFTGGEPLLRKGLADLVFRIG---QIPGVKEMTLTTNGVLLKDQIGALYQSGISSVNISLDAAQKEHFSSIAGIDYFEQVMEGFEEAKKYPMTVKINCVLARELNEGQWLSLAEYAKDAKVDVRFIEMMPIGTGKQYTSGGQD--ELLARIKERYGDVEEQKEKGNGPAIYYKVQGFLGRIGFISAMSHKFCSQCNRIRLTADGVLKPCLQYESHVELKRMLRQGRTEHELTELIVKSIFQKPKEHKFQEQQGNMLEKKKMSEIGG 331
234 3.000e-84UniRef50_V9WF21 GTP 3`,8-cyclase n=46 Tax=Paenibacillaceae TaxID=186822 RepID=V9WF21_9BACL  ali  38  6.......................TDRYGRNHDYLRISVTDRCNLRCVYCMPEGMKFEPEDRLLSFDEIIEFVRVAARMGISRLRLTGGEPLVRKHLSVLIRRL---AEIPGIQDIALTTNGMLLAKQARVLKEAGLTRVNISLDSLRPDRFRQITRGGEVSRVLDGIRSSCEAGSPVKLNVLLMKGRNDDEIADFLRMTIDHPVEIRFIEYMPIGTRNEEWREGYIPLQVVKERLQAGYDFTGTDKGIGGPAEYYRIQGAAGTFGLIHPVSEHFCKTCNRLRLTADGNLKPCLYWSDEWNVRKWI---GNEEGLKRLIQRALELKPESHEMARSLSRTPTGRKMSQIGG 334
235 3.000e-84UniRef50_A0A1F2WJE0 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1F2WJE0_9ACTN  ali  38  1......................MIDPYSRTIDYLRLAVTDRCNLRCLYCMPEGLQLLRHEDILSYEEILRLLKICIQAGISKVRLTGGEPLVRKDLDYLISQI---SKLQPSLDISLTTNGLLLSKQAESLAAAGLKRVNISIDSLDPDTYRRITRTGNLSQVLSGLEAAIAAGEPVKINVVVLKHVNE-ELEAFVELARRLPVHVRFIEYMSPCGI--FDESFYVSAEEIKQGLAEFGRLEVAEPPLGGPARYFKLAGAKGLIGFISPISSHFCPNCNRLRLTADGKMKTCLFSPDEDDIREILRSGSEDGYVLETIKRSLERKPRDYG-----KGSSPGRTMSQIGG 319
236 3.000e-84UniRef50_A0A010YZ07 GTP 3`,8-cyclase n=13 Tax=Clostridiales TaxID=186802 RepID=A0A010YZ07_9CLOT  ali  36  1......................MKDSCNRTIDYIRISVTDRCNLRCLYCMPEGIAPLRHEDILTYQEIVRICEAGARLGIRKVKVTGGEPLVRKGIEVLIKEL---AEIPGIEDVTMTTNGCLLKEKSAELKAAGLSSVNVSLDTLDPRRFARITRRDCFESVMEGIDSALAAGLKVKINCAVMEDLTKEEVLAFARFSMERRIPVRFIEMMPIGQGKNY--KALENDDLAGILSEAFGELKESREVKNGPAVYYTWGDETGFIGFISAVSHKFCHNCNRVRLTSDGFLKLCLDSPAGVDLKGPLREGISDDGLFDLMNESIRNKPESHHFEEDQGKTGLN--MNQIGG 322
237 4.000e-84UniRef50_Q8Y0K4 GTP 3`,8-cyclase n=1349 Tax=root TaxID=1 RepID=MOAA_RALSO  ali  36  1................MPAQGWLADTYGRRLHDLRISVTDRCNFRCIYCMPKDYRFLQHSELLSFEEIERMVRLFIEHGVEKIRLTGGEPLLRKDIERLVEMLARLNTRDGKPDLTLTTNGALLARKAQALKDAGLTRVTVSLDAIDDATFRRMNDVDAVAEVLHGIEVAQRVGAPLKINMVVKKGDNDDQIVPLARHFRNSGIILRFIEYMDVGVTNHWEMASVVPSAEVIRRLSAAFALEPLSNYAGETAERWRYADGAGEIGVISSVTQAFCHDCTRARLSTEGKLYLCLFATQGFDLRALLRGGASDLEVSNAIRTVWQARTDRYSELRASGTAPPTIEMSYIGG 345
238 4.000e-84UniRef50_U5HE94 Uncharacterized protein n=4 Tax=Microbotryum TaxID=34416 RepID=U5HE94_USTV1  ali  33  79....QARIARVDSTSPSKVSPFLIDSFGRKHDYLRISLTEKCNLRCTYCMPEGVKLLPRDDLLTTDEIERTAKIFVTNGVTKIRLTGGEPTVRKDLIDVVTRLGR----LPLDSLGMTSNGISLKRRLPQLVEAGLTHLNLSLDTLDPFKYELMTRRRGFSAVMESLQVARGLASKTKINVVVIRGLNDDEVPHFVELIKDMDITVRFIEYMPFEDNRWSTTKLVPSAQLVAKLQTIHPTLEKLIDPHSDTTRSWRVPGYRGKVGFISSMSDHFCGECSRLRIGADGRVKVCLFGPPVLSLRPLLRSPETDQDLMESVGRAVWGKKFAHGGAEGIRENGKMGPMVGI.. 425
239 4.000e-84UniRef50_A0A1F8PW37 GTP 3`,8-cyclase n=78 Tax=Bacteria TaxID=2 RepID=A0A1F8PW37_9CHLR  ali  37  21..............APAGRYPMAFDRFGRCIHYLRISLTDHCNLRCVYCMPEEITFRPNAELMQDEEIIRLARLFAGLGFDKIRLTGGEPTVRAGIVNLVGEI---ASTPGVRSLSMTTNGVLFSKLAEPLAKAGLTRVNFSLDTLDPAKFYRLTRRGSLHEVWSGVQASEEAGIPIKLNCVVVRGYSDEEVVPLARLTLEHPWQVRFIEMMPFAGATEFQRSQIVTAEEIIRRIEMEPFVEINNGKLDGEARLYKLKDAIGSIGFISTISQPFCTTCTRARLTADGRLRLCLLCEDEVDLLTPLRAGVSDSDLRRMILDGIWDKPWGNRLTEGLI--PLNRVMSEIGG 353
240 4.000e-84UniRef50_A0A1W9VX88 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9VX88_9BACT  ali  37  4......................LIDNFGREISYLRVSITDRCNYRCIYCQSEEFEFIPHQEILRFEEIVEIVQEAVNLGITKVRITGGEPLVREGIVNFIKQL---RKIDRLEDISLTTNAFFLSEYAEKLKEAGLNRVNISLDSLQEEKYKKITRGGSLGKALKGISSALKAGLPIKINTVLIRGINDDEVEDFVRLTLDRPLNIRFIEFMPSGEINEFESKFISVQEIKEKLIKKYLLDPVKISTANGPAKYYQIKGGQGTIGFITALSQHFCKTCNRIRLTSEGKLRPCLFSNTEVNIKQAIRKGKSEGFLRKKIKEAVRLKPEGHKLNIKNQENL-SFHMSRIGG 338
241 4.000e-84UniRef50_A0A149R4B6 GTP 3`,8-cyclase n=43 Tax=root TaxID=1 RepID=A0A149R4B6_9PROT  ali  54  5......................LVDPAGRRISYLRVSVTDRCDMRCTYCMSERMTFLPRADVLDFEELLRLCQVFVKHGVKRLRITGGEPLVRRDIETLGQWLHHPEQAGSLDELTLTTNGSRLALYAETLFRAGVRRVNVSLDTLDEERFASITRRGKLAATLDGIKAARDVGMAVRVNAVAMAGVNDDEFDAMLAWCGEIGADLCLIETMPMGDTGEDRTARYLPLSEVKADLAKRWTLEPLADRSGGPARYMRVAETGQRIGFITPMSHNFCSTCNRVRLSCTGQLYTCLGHEDGVDLRAILRSGGDDAAILAGIQAAIDRKPTGHDFMLGAKPSGPVRHMSVTGG 338
242 5.000e-84UniRef50_A0A2E9QMB7 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E9QMB7_9DELT  ali  34  1.....................MLQDAYGRTIRDLRISVTDRCNYRCFYCKPHSQKLTYRAGIMTYEEIIRLANVFVHLGVNKLRITGGEPTIRRELPFLLKEL---ASIPGVDDLAMTTNAHFLAKQAQMLKDTGLHRLTVSLDSLRQDRFKEVTGVDGLKKVLHGIEVAQQVFDPIKINVVVIRDVNDDELLDFAHYARETGNIVRFIEFMPLDADKQWDHKRVVTQAEMLQRLQEIETLEPIRSYTSETANKFRFADGKGEIGIIASVSAMFCGQCSRMRLTADGKLRPCLFSEKEYDILSVMRAGCSDEELIDKIAEITKLKEAGHRINDPNYTYPEQ-SMSSIGG 327
243 5.000e-84UniRef50_A0A1M5WA02 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1M5WA02_9CLOT  ali  35  1......................MIDKYGRQIDYARISITDRCNFRCRYCMPEGIEKKTRDDILRFEEIIPLIKALSKLGVKKIRFTGGEPLVMKNITEL---IYKTSQIEGIKDIALTTNGYLLEDMAQELFDAGLKRVNISLDTLDAEKFKYITRGGDLLKVLRGIEKCLSIGTPLKINTVLIKDFNDMEIIDFINLTKDIELNVRFIEMMPIGEGKQFYDKGIITA---NQVIERIPQLVPIKSKEKTVAKVFAIKNHKGNIGFITPLSCKFCDECNKIRITSTGTLKPCLHSKQEINLKPYL---NNEEELLSLLKISIFDKPKEHFLSEENVTRTLRR-MNQIGG 319
244 5.000e-84UniRef50_A0A194S9S7 Uncharacterized protein n=2 Tax=Rhodotorula TaxID=5533 RepID=A0A194S9S7_RHOGW  ali  31  40.SALSRARTRIANRDHVQVAPPLVDSFGRKHDYLRLSLTEKCNLRCTYCMPEGVPLLPKDDLLTADEIERVARVFVDHGVRKIRLTGGEPTIRRDIVDIVERLGRLS----LSSLGMTSNGIALKRKLPALVSAGLSSLNLSLDTLDPFKYELVTRRRGFDAVMDSLDIAQGLKPKTKVNVVVIRGLNDHEVPDFVELTRERDITVRFIEYMPFEDNRWSTAKLVPSSELLSLISARHPGLDKLQDAASDTTRAYRVPGYAGSFGFISSMTDHFCGGCSRLRIGADGRVKVCLFGPPVLSLRPLLRSPTSDAALMHAVGGAVYGKKFAHDGLEGIKREGKMGPMVGI.. 394
245 6.000e-84UniRef50_A0A0T5ZQF7 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A0T5ZQF7_9BACT  ali  40  5......................LSDRFGRKIDYLRISVTDRCNLRCVYCMPEGIELFEKNEILTFEEMERFSRVAINLGVRKIKLTGGEPLVRKGIVDFIASI---SKIEGLEDLSLTTNGIFLEDMANDLKASGLDRVNVSLDSLNPKRYGEITRGGDLRSVLRGINKVLEVGFKVKINTVVLGSLSEKEIFELIEFGKEKGIEVRFIEFMPLCGNG-WNRDYFIPLVDVKKKIEQMYKLTNLKN--DGVADRYSIDGG-GIVGFITTISEPFCSSCSRLRLTARGTLRPCLFSTLEINVFPLLRKVAPDEEIEKAIRRAVYVKPEWNPVLSGL-EDPKKVFIRNIGG 324
246 6.000e-84UniRef50_A0A212FEK0 Molybdenum cofactor biosynthesis protein 1 B n=3 Tax=Papilionoidea TaxID=37572 RepID=A0A212FEK0_DANPL  ali  33  50....................PPLVDLYGRKHDYLRISLTEKCNLRCQYCMPEGVKLSPRDKILSNEEVLRLARVFAALGINKIRLTGGEPTLRKDLVNIVQELTN---LHGITTVAMTTNGIALTRKLPSLQRAGLSALNLSLDSLKPERFERMARRPGLPHVLASMDLALQLGFKSKINTVLMKGFNDDEICDFIELTRDRDMDIRFIEFMPFSGNRWEKGERMVSKDAISAAIERYGDLIPLPPTPCRTATLWQVPGYTGRVGFISSMTKPFCSTCNRLRLTADGNLKVQTDKPRETNLRDAIRAGVNDDDIETLVRSALRRKLPRHAGMIKVIIVMTH........ 371
247 6.000e-84UniRef50_A0A2E8DCU6 GTP 3`,8-cyclase n=8 Tax=Planctomycetaceae TaxID=126 RepID=A0A2E8DCU6_9PLAN  ali  39  2..................TKGKLIDSLGRIHNNLRISVTDRCNIRCFYCMPENIQFKPRNEILTFEEIVRFARVAAQQGVNKLRLTGGEPLVRAGLPKLIRQL---ATIPDIDDIALTTNGILLAEHVDALKRAGLRRLNISLDGLKEETFERIARRKGLDRVLQGIFAAKAAGFERRLNAIAIRGITESEIVPLGEFARQHGLELRFIEFMPLDAEGNWSDDQVLSGEDIRQTLQEAFGVPTVRPDPSQPAMDYRFADGVGTIGFINPVTQPFCSDCNRLRITAEGNIRNCLFSIAEWDARKIMRCGGSDDDLVRLLHECIAAKKSGHGIDSPDFVKPE-RAMYQIGG 332
248 7.000e-84UniRef50_A0A2G5KZ04 GTP 3`,8-cyclase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2G5KZ04_9BACT  ali  34  2...............SASSQTRLTDQWGRQMDYLRIAVTDRCNLRCFYCMPEGIQYLPKKELLTYEEILRLTRLSAELGVTKVRITGGEPFLRKDLTSL---LHNIKNTEGIQSLNLTTNGVLTLPYLDELQEIGIDHVNLSLDSLDRDNFRRITRRDEYDRVLDTLHGLIHRGIKTKINMVVMQGKNTHEIIDMAALTREHDISVRFIEEMPFNGSTDMQN-TWTATQILQELSTRFGTLTPIVTDANAPSTDYLIDDHLGKVGIIAAFSRSFCGTCNRLRLTATGSIKNCLYDEGVLDIKNLIRSGYSDEQLKNALVSTVKHKEKNGFLAEAKRKKGITESMSTIGG 334
249 7.000e-84UniRef50_A6QXR9 Molybdenum cofactor biosynthesis protein 1 A n=10 Tax=leotiomyceta TaxID=716546 RepID=A6QXR9_AJECN  ali  33  53.............................QHDYLRISVTERCNLRCLYCMPEGVELSPAVKILTTPEIIYLSSLFVSQGVTKIRLTGGEPTVRKDIVHMMQQIGSLRRD-GLRELCLTTNGISLHRKLDSMVEAGLTGINLSLDTLDPFQFQLMTRRNGLEAVMKSIARILEAGIKLKINCVVMRGMNDGEILRFVELGREKPLEVRFIEYMPFDGNKWNQAKMLPYKEMLTIIREKYPNLEKVADHKNDTSKTYRVPGFKGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDMIRKENDERELLNIIGMAVKRKKAKHAGM-GELKNMKNRPMILIGG 409
250 7.000e-84UniRef50_A0A1J5E4B4 GTP 3`,8-cyclase n=5 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A1J5E4B4_9BACT  ali  38  3.....................MLIDNYQRQVNYLRISITDMCNLRCLYCQPKEAGWKIHREILRYEEIIKLASLMVQLGIKRIRVTGGEPLIKKDVLLLIKGL---ARIDGLEELTLTTNGTKLAQFAEQLKENKVDRINISLDSLNRERYSSITGGGNLEDVLAGIDEALSVGVPLKINMVVMKGINDDEVESFARLTLDKPVIVRFIEFMPISQQGVEWDERYLPAYILKQRLSSNFEIIKCNSHGNGPAEYYQIKGAVGNIGFISPISDHFCVSCNRLRLTPDGHLRLCLGQDAEVDLKLPLRQGATDEELQRIITQAVWNKPAGHQF---QLDRPTGRQMVAIGG 342
251 8.000e-84UniRef50_B5EED9 GTP 3`,8-cyclase n=11 Tax=Deltaproteobacteria TaxID=28221 RepID=B5EED9_GEOBB  ali  38  2.....................ALIDTYGRRINYLRLSVTDRCNLRCRYCMPEGVEKLDHSQVLSYADLLRISTEAVAAGIEKIRVTGGEPLVRKGIISFLERLG---ALPGLKELVLTTNGLLLKEMAQGLREAGVQRLNISLDSLKPETFAAITRGGELKRVLDGLEAAEKAFPPHKINVVVMRGVNDDEILDFVELTMKRPYAVRFIEYMPTCGDADWRELCVPGAEIRERIGERYLIEEVSNSELSGPSKNFKVQGAQGSLGIITAMTGHFCNGCNRLRVTASGIAKGCLFSGDGVDLRPVLATG-DDALLRQEVQRIVAAKPGRHEVTDEGAETVP-FAMSRVGG 326
252 1.000e-83UniRef50_A0A2V8LUI2 GTP 3`,8-cyclase MoaA n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LUI2_9BACT  ali  35  16......................LKDSYGRAIRDLRVSLTDRCNFRCFYCLPHGEPPIPKEQMLSYEEIEYLCDIFVELGIEKIRLTGGEPMMRRDIETIIRKLAKLKQHRGLRDLALTTNGYFLPDRAEGLKAAGLDRITISLDSLKRNVFKQMTGVDVLDRVLEGIEAARHAGQPIKINAVIVRGHNDDEVADFAAFARERDVKMRFIEFMPLDSGHEWSRDDVISGREIRERIEARFPLVPLDLHRGSESRYRFADGAPGEIGIIAPVTEPFCGACSRIRLTADGQIRTCLFSTVEHSLRDVLRDGAPRAEIIDFVRTVVMKKEPRHYINDP-GFVAPSRSMSFIGG 373
253 1.000e-83UniRef50_E4ZRZ1 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E4ZRZ1_  ali  31  147LPPTKPVDRKQAIQNAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEGVPLSPNANMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMHQIGSLRSK-GLRELALTTNGISLHRKLDAMVEAGLTGINLSLDTLDPFQFQIMTRRKGLDAVMKSIDRILEAGVKLKVNCVVMRGLNEREIIPFVELGREKDIEVRFIEYMPFGGNKWSEGKMISFQEMLDIIRVKYPGLAAVPGHKNDTSKTFQIPGFVGKVGFITSMTNDFCSSCNRLRITSDGNLKVCLHGMAEVSLRDLLRQGNNEHDLLNLIGKAVKRKEEKHA-DLNELAKLDNRPMILI.. 532
254 1.000e-83UniRef50_A0A1Z8WXC4 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A1Z8WXC4_9CHLR  ali  34  6........................DKLNRPVKDLRISVTDRCNFRCTYCMPESFKFLPKDELLDFDEIYRIANTFAKLGVNKIRLTGGEPLVRRNIEELIAKL---SKINGIDDIAMTTNAYLLEPKLDSLIDAGLNRLTVSLDSIDNETFKKMSGQNEVSKVLSAIDQANKKGFESKINCVVQKNVNEHSIIDLLDYFRDSGNIVRFIEYMDVGNLNGWELKDVLSIEEILKLIEIKYKVEKIPPNYGEVAKRFNLVDYSAEFGFISSVSQPFCSTCTRARITMDGKLVTCLFANSGFDLRSIIRQGCTDEKLDEVIKGVWLKRKDKYSEIRHELTKSKKIEMFXLGG 337
255 1.000e-83UniRef50_H1XTW8 GTP 3`,8-cyclase n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XTW8_9BACT  ali  31  1.........MEMDQPSLKPASVLTDPYGRILNYLRIALTDRCNLRCTYCMPEGVPFIEHEQIMRFEEILRLVQIMLPYGLRKIRVTGGEPLVRRGTISFLQKL---RQVGPELQIHLTTNGVLLEDYFKELVEISISGVNLSLDTLNPQKFKKITRHDSFVKVWRALQQVLDSNIPLKLNMVVQRGLNEDEIIPMAELARQHSLEVRFIEQMPFDGLSR-KIERPFTGEEILQTLRTAFGTLESTKKQNGTAQLYKIPGFKGTIGIISGYSRTFCSDCNRLRLTSTGVLKTCLYDRGSVNLKDLMRAGYDDARLLKAIERAVRERHKDGFEAEKESFDVQKLSMSQIGG 337
256 1.000e-83UniRef50_A0A1H5MV18 GTP 3`,8-cyclase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1H5MV18_9MICO  ali  37  11.....................PMVDRFGRVHRDLRISLTDKCNLRCAYCMPEGVPWLSKNNILTTDELVRVAEVAAVLGIEEVRLTGGEPMLRQDAVDVVRRMAAIEGPSGPLEVSMTTNGMALPKHAADLAAAGLARVNISLDTLSKERFHELTHRDRLSDVLAGIDAALAAGNPVKINAVAMRDVNDDELVDLVRFAARSGCEMRFIEQMPLDAGHVWSRVRMVRGEEILESLEQAFELTPLPGRGAAPAERFLVDGGPTTVGVIRSVTKPFCGACDRVRITADGQLRNCLFAREESDLLTVLRSGGSDDDIATLMHRCIAGKLPGHGIDDPGFLQP-DRPMSAIGG 339
257 1.000e-83UniRef50_A0A1V5CZT3 GTP 3`,8-cyclase n=4 Tax=Syntrophorhabdus TaxID=513557 RepID=A0A1V5CZT3_9DELT  ali  34  2........................DKFNRIIDYVRISVTDRCNLRCRYCVNEALPHIPHTEVLRYEEIIRFVRICAELGVTKIRLTGGEPLVKLDIEFLLKEIN---AIDGIEDISLTTNGVYLGKKVRQLKEAGLRRVNISLDTMQPERFTYITGVDAYKEVLDSIEKAKDMGNPVKINTVIIRGFNDDEILDFARFAKAWDVEVRFIEFMPFGESTLWDSTKIIPSREIEELIRKTYALSPSLSTHKGPAKMFNMVGSLGRIGFISPVSTHICKECNRLRLTSNGMIRPCLFSDTEFDVKQLLRNNAGDDELKEFISRCVREKPERHEIGLVRKCQKSLRN---IGG 322
258 1.000e-83UniRef50_A0A0C2V5S0 GTP 3`,8-cyclase n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0C2V5S0_MAGMG  ali  54  1......................MIDRFGRKITYLRLSVTDRCDLRCVYCMAEDVTFKPRAELLTLEELGRLCEAFVRKGVRKIRLTGGEPLVRRNIMSLIDRLGALVADGRLDEVTLTTNGTQLAKHADGLATAGVRRINVSLDTLDPTRFTSLTRHGRLEQVMEGIFAAKAAGLAVRINTVTLPGINDHEFDDLVAWCGLHGFDLCLIERMPMAG---DSTSRHLALSQVRSDLERRWTLVDCDWQTAGPARYATIAETQCRIGFITPMSACFCDGCDRIRVTCTGALYTCLGQEDAIDLGTPLRASESDHHLERIIDSAISAKPERHGFVGDVQINRLARGMNITGG 324
259 2.000e-83UniRef50_T1J5S9 Uncharacterized protein n=3 Tax=Opisthokonta TaxID=33154 RepID=T1J5S9_STRMM  ali  33  1.................................................MPEGVDLTPKERLLTTSEIVTLAKLFINEGIDKIRLTGGEPLIRSDIEEIVGDL---KKIPGLKWLAMTTNGIVLKRKLSALRQAGLDALNISLDTLVPVKFEFITRRNGWKKVIEGIDCALELYDPVKINCVVMRGLNEDEINDFVAFTKDKKVDVRFIEYMPFDGNKWNDKKMVPYQEMLGIIKSKYPDIKRLEDKDNDTSKAYKVDGFAGQIGFITSMSEHFCGSCNRLRITADGNLKVCLFGNSEVSLRDALRSGVSEDELLSIIGAAVGRKKKQHAGMFELAK-MKNRPMILI.. 296
260 2.000e-83UniRef50_J3P3P1 Uncharacterized protein n=10 Tax=Eukaryota TaxID=2759 RepID=J3P3P1_GAGT3  ali  31  35.PAMPSHTRRDGLKGARPFSDFLTDTFSRQHDYLRISLTERCNLRCVYCMPEGVPLSPDRELLTTPEVLLLSSVFVSQGVTKIRLTGGEPTVRRDIVPLMRQMGDLRR-HGLHELCLTTNGIALHRKLEAMVEAGLTGVNLSLDTLDPWQYQVMTRRNGFEAVRRSIDRILEAGIRLKINCVVMRGLNDAEIVDFVDLTRDADLEVRFIEYMPFDGNRWSERKMLGYREMLDRIREAHPGLHRVAGHKNDTSKTFQVPGFRGRVGFITSMTQNFCGSCNRLRITSDGNLKVCLFGEAEVSLRDMLRKTNNSQELLDLIGMAVKRKKAKHAGI-GELEHMKNRPMILI.. 435
261 2.000e-83UniRef50_A0A0Q6I8J9 GTP 3`,8-cyclase n=47 Tax=root TaxID=1 RepID=A0A0Q6I8J9_9BACI  ali  35  5......................IKDSLDRPLRDLRISVIDRCNFRCQYCMPDNFQFLPKSELLSFKEIVRLSKIFASLGVIKLRLTGGEPLLRKDLTTLISKLV---KIEGIEDIGLTTNGVFLKKQAGNLKSAGLKRVNISLDSLDDELFKQMNGRGGIKPVIEGIAAAKEAGLGVKVNMVVKKETNQSQILPMARFCKEEGIQLRYIEFMDVGHTNGWQMKNVLTKKELLEILQAKFDLEPVEDYFGEVAKRFRYKGTTTELGFITSMSESFCSSCTRARLSANGSLYTCLFNGKGHDLKSLLRSKISDEELTCFIISLWNQRDDRYSDERSAGKKQEKIEMSFIGG 337
262 2.000e-83UniRef50_A0A260EEM4 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A260EEM4_9NOCA  ali  36  39..............AAAPREGGLLDRFGRVATDLRVSVIDKCNLRCTYCMPDGMPWLPQSQLMSTDEIRRIVRVAVALGAEELRLTGGEPLVRKDLEFIIAGI---REDNPDLPISMTTNAVGLDRRAQALKDAGLTRVNVSLDTLHPETFAELTRRPHLDKVLAGLQAARAAGGPIKINAVLLRGINDTEIVPLVDWAVSNGFEMRFIEDMPLDGDRSWTATNVISAHDIRTEIETAFSLAPDPRGRGAAPAERWEVRRPGHVGIISSVTEPFCSSCTRTRVTADGKVRSCLFSHEETDLLSTLRAGADDEGIAQVWRDAMWAKPRAHGLARADFVQPE-RTMSAIGG 383
263 2.000e-83UniRef50_A0A0L0NLF4 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0NLF4_9HYPO  ali  34  67...............ARPFSEFLTDTFHRQHDYLRISVTERCNLRCMYCMPEGVPLSPNRELLTTPEMVLLSSLFVSQGVTKIRLTGGEPTVRRDILSLMQQIGALR-PRGLKELCLTTNGISLHRKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFDAVLKSVDRILEAGIKLKINCVVMRGINDREVVPFVEMTREKDMEVRFIEYMPFEGNKWSQGKMFSYSEMLDLIREKYPDLQKVQDHKNDTSKTWHVPGFVGRIGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRKSNSEAELLDVIGMAVQRKKAKHAGI-GELEHMKNRPMILI.. 437
264 2.000e-83UniRef50_A0A2G6LA99 GTP 3`,8-cyclase n=16 Tax=Bacteria TaxID=2 RepID=A0A2G6LA99_9GAMM  ali  43  1.....................MFIDGYQRKITYLRISVTDRCDFRCVYCMGEEMEFLPRANLLTLEEIARIGKIFVDNGTTKFRLTGGEPLIRKEVEWLIKELGSY---PGVSQIGITTNGSQLRRVAPALKAAGTTKLNVSLDTLDADNFASITRTGKLSVVLDGIAAAQQAGLKNRLNAVIMRGKNEDQIIPLVDYARQHGLHLAFIEEMPLGDISHNRQKTYIDSQMIRHKIHARYPLIKSADDENGPADYWLFQDGNTKIGFISPHSCNFCADCNRLRLTVEGRLLLCLGHEDSINLRAMLRGGKSDKEISQAIQQGLQHKPEKHEFKLTE-KPIIFRHMSHTGG 329
265 2.000e-83UniRef50_A0A1G1MXD0 GTP 3`,8-cyclase n=4 Tax=root TaxID=1 RepID=A0A1G1MXD0_9BACT  ali  39  1......................MIDSFGREIDYLRISVTDRCNLRCVYCMPHGIIHKQPSDILSFEQIYSIVKAAVGLGIRKVRITGGEPLVRKDLPALIAEL---KTINGLKEICLTTNGIYLSEYALAIKEAGLDRINISLDSLNKEKFRKITQGGNLEMVLSGIDRALAAGAPLKINNVLLKDFNTDEIADFANLTKARPLHVRFIEYMPTGLGHGSYDDIFLSAQEAKNICRSVGELEPVEQGTADTAEVFKIRGFLGSVGFISPISRPFCASCNKLRLTSEGRLRNCLHSSKTIDLKKAFANNNSQDELAALIQEAISLKPEGHHKDEKNGLEAENFSMCQIGG 347
266 3.000e-83UniRef50_A0A1S8WA11 Molybdenum cofactor biosynthesis protein A n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8WA11_9FUNG  ali  37  68...................KHPLRDTFQRNHTYLRISLTERCNLRCTYCMPEGVDLSPASALLTTDEIIRLATLFVDQGITKIRLTGGEPTVRKDLLEIVARLNALK-PRGLQSIGMTTNGIALKRKLPALFENGLNQLNISLDTLHVDRFEELTRRKGLDAVMDAINTAAHMPFQAKLNSVVVRNTNDDEIVDFVRLTKDLPIYVRFIEYMPFGGNKWDVEKFISYKEMLALVHREFGTLTKIQDDPNDTSKAYQVEGFKGTFGFITSMSEHFCGVCNRLRLLADGNMKVCLFGNSEVNLRDSLRRGASDDELMQLVGMA............................ 370
267 3.000e-83UniRef50_A0A1Y3Q6B3 GTP 3`,8-cyclase n=30 Tax=root TaxID=1 RepID=A0A1Y3Q6B3_9BACL  ali  36  4.....................AVTDPYQRPLRDLRISVTDRCHFRCTYCMPDDHPFLPERDLLTFGEIGRLARLFASLGVRNIHLTGGEPLLRRDLDELIRRL---AAVDGIEDIALTTNGHLLHHHARRLYEAGLRRVNISLDALDPDIFGRMNGRGGPERILANIDLAREIGFEVKVNMVVQRGVNEGEIIPMAEYFRKRGITLRFIEFMDVGNDIGWSREKVVTKREMLELLGRAHELKPERSRCGEVAEYYRYVNSGGRIGFITSVSESFCSTCTRARLSSDGKLFTCLFASEGFDLRAMLRGGASDDEIREAVVRVWTRRTDRYSDERAALAGLRRRKMSYIGG 337
268 3.000e-83UniRef50_F0XBX0 Molybdopterin cofactor biosynthetic protein n=3 Tax=Ascomycota TaxID=4890 RepID=F0XBX0_GROCL  ali  33  80....PQKTRQAELKHARPFSDFLTDTFQRQHDYLRISLTERCNLRCLYCMPEGVELSPARNLLTTPEVLLLADVFVGQGVKKIRLTGGEPTVRRDILPLMRQLGDLRRR-GLRELCLTTNGLALHRKLDAMVEAGLTGVNLSLDTLDPFQFRLMTRRDGLVAVRRSMDNAAGADVRLKINCVVMRGLNDGEMVDFVGLTRDHDLEVRFIEYMPFDGNRWSTGKMVSFNEMLERIRKSYPTLQRTTPDAHDTSKTYEVPGFAGRVGFITSMTSNFCGGCNRLRITSDGSLKVCLFGNAEVSLRDIIRQTNGGEALLDVIGMAVKRKKERHAGMDEL-KHMKNRPMILIG. 470
269 3.000e-83UniRef50_K1YWH2 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1YWH2_9ZZZZ  ali  39  3......................LIDSYNRKLDYLRISLTDRCNFRCVYCMPEGITLLPKNEVLSLEEIGRLAGIFISLGTKKIRLTGGEPLLRKNIVSLVRDL---ASVAGLEELGLTTNGFFLAPLAHELKANGLSSVNISIDSLNRLRFHHVTRTDSFEDVFAGFMASLEAGLKVKVNVVAMNDLGEKEVESFVELAKKFPVELRFLEFMPLCGSA-WQSEKRLSLSQLKQWVSSHCSLVPIPRGRN-VADTFQIEGHEGKIGFISSMSEPFCGDCSRLRLTSTGMLRLCLFSPLEMDLRTPLRQGALDEEIAALITRSVLQKPKGHEEYLEKTKYSELPKIRSVGG 325
270 3.000e-83UniRef50_UPI0009E0AA5D GTP 3`,8-cyclase MoaA n=1 Tax=Candidatus Magnetobacterium casensis TaxID=1455061 RepID=UPI0009E0AA5D  ali  35  15.....................QLCDTYGRVIDYIRISITDRCSLRCMYCTPNSASPYDRAEVLTFEEILRFVRAASELGVKKIRITGGEPLMRRGLPELITEI---KAIGGIVDLSLTTNGLMLPEYAQKLASAGLNRVNISLDSLLPQRYAHITGGGNLKKVLDGIQAAKNANTPIKLNMVPMKGINDDEIESFARMTLTQDIHVRFIELMPTVVIGRQYKEMLISSSEIHQRLQQISPLYPVKIRLNGPARYYRFESAAGVIGIISAITCHFCQDCNRMRLTAIGKLKPCLFSSKLIDLKPYLTEDSSLEQLKELIRTATELKPRGHNIT----ATESTLAMSQIGG 337
271 3.000e-83UniRef50_Q1III4 GTP 3`,8-cyclase n=60 Tax=root TaxID=1 RepID=Q1III4_KORVE  ali  34  11.....................TLTDKFGRTINDLRLSITDRCNYRCVYCRSGNNG--PSFAELRFQDYVRIARVFVSLGITKIRLTGGEPLLRRDLLELVRELRALKTLDGEPDIAITTNGHLLADLAQPLKEAGLNRVTVSMDAVDPELFAKIRVPNGFEKVVQGVRAAKAAGTPVKVNCVLLRGFNEEQIVPFGVFAREEGVVVRFIEFMPLDEDRHWSPEIVVPLNEVVARLNTYMPLRHLDHGHSETARRYVFEDGRGEMGIIAPVSLPFCGACSRIRVTSDGKIRTCLFSVREHDLASLILEGASDEEIADRIRYAVENKEQRHHIGEADF-MPASRTMVHIGG 338
272 3.000e-83UniRef50_A0A1H6GEZ8 GTP 3`,8-cyclase n=45 Tax=Firmicutes TaxID=1239 RepID=A0A1H6GEZ8_SELRU  ali  38  1......................MYDNLGRRIEYVRISVTDLCNLRCRYCMPEGVPKLRHEDILSYEEILRLVRCFAKLGARKIRLTGGEPLVRAGILDLIKEI---KCIPGIEIVVLTTNGVLLPQMAEKLKAAGLDYINVSLDTLDETAFFRLTRRRDLPAVREGLKALKEAGFRHRINCVPLRGMNEADIPKLAELARNEEINVRFIELMPVGCAYEAGLERIPMAEVRQILQSSFGTLQEARESLWGPAEYVRPAGFKGKIGFIDAMEHKFCSSCNRLRLTAEGFLKLCLHSSAGLDLRTLLRHGITDEDLIEAIANAARKKPAEHLFSAIEQRERDSRYMYQVGG 328
273 3.000e-83UniRef50_A0A1Y0MP78 Cyclic pyranopterin phosphate synthase MoaA n=24 Tax=cellular organisms TaxID=131567 RepID=A0A1Y0MP78_9FLAO  ali  36  2....................EALKDTFGRAHNYLRISLTERCNLRCTYCMPEGIPLSPRAQLMTADEIFALAQQFVKLGVTKIRLTGGEPLVRKDFEEILSRLSGLP-----VELTITTNAVLIDRYITQLKSAGIKTINVSLDTLHPEKFRSITRRDDFAAVKRNIKLLLAEGFKVKINCVLIKGFNDEEIVDFVAYTETMPVSMRFIEFMPFDGNRWNKDKLVAEQEILKSVFDRWSQVERLTDSMNDTSRNYKVKGYAGSFAMISTVTNPFCDTCNRIRLTANGRIKNCLFSNAEVDLLTPFRAG---QDILPLINQAVKAKFAVRAGMESDENYNNNRSMIAIGG 331
274 3.000e-83UniRef50_A0A2D3UXE8 Uncharacterized protein n=1 Tax=Ramularia collo-cygni TaxID=112498 RepID=A0A2D3UXE8_9PEZI  ali  33  115...............AAPFSAFLTDTHSRQHNYLRISLTERCNLRCTYCMPEGVQLSPDRDILTTPEIVYLSSLFVNQGVTKIRLTGGEPTVRKDILPLMQQIGALRRT-GLKELALTTNGISLHRKLEGMVEAGLTGVNISLDTLDPLQFPLLTRRNGFEAVMRSIDRVKDAGIKLKINIVAMRGVNDDQILPFVAMTESEDLEVRFIEYMPFGGNKWSQKKMLPYEQIRQRIQDKWPTFERMRDERNAVSKTWRVPGFVGRVGFITSMTEDFCGTCNRLRITSDGNLKVCLHGNTEVSLRDLLRAEGDERQLLDVIGAAVKRKKAKHAGM-GELEKMENRPMILIG. 481
275 3.000e-83UniRef50_A0A0E4CZM3 GTP 3`,8-cyclase n=35 Tax=Bacillales TaxID=1385 RepID=A0A0E4CZM3_9BACL  ali  37  2....................EPLTDPFGRLHDYMRISVTDRCNLRCIYCMPEGMQFQPQDEIMSYEEITAVVKALAPLGLSKIRLTGGEPLVRKDLDKLVSMI---AAIPGIEDISLTTNGLMLPAKAALLKQAGLSRVNISLDSLRQDRFAMITRGGEVAKVLKGIEAAEAAGSPIKLNVVLMKGINDDEIKDFISLTLNSPLNVRFIEYMPIGSASDAWRQTYLPLETVVEACHEAGWATEEADMPNGPSQNRRVVGARGTFGLIHPVSEHFCDNCNRLRLTADGHIKACLYWADEYNVRPL---TSDPAAVQALFRQALGNKPHNHEMAKAQSHTPTVRRMSQIGG 333
276 4.000e-83UniRef50_A0A1V4MJU8 GTP 3`,8-cyclase n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MJU8_9DELT  ali  37  8......................LVDRYGRQLTYLRVSVTDRCNLRCKYCMPRNFSWLPHDKILTYEEILKVCRAFAAIGITKIRLTGGEPLVRRDLTNLAERLT---EIDGLKKICITTNGVLLEEYADALFKTGIRHINISLDSMSPERFAYITGFNLFEQVWRGIKKALEKGFPIKINSVIIKGINDNEITALAELSLKYPLQIRFIEFMPFGHDIFWNPARFVSCDKIRNQIEQAFGKLPDKSKSAGPASVYALDKGPGSIGFIGALSHPFCKSCNRLRLTAEGRLRLCLFSDEEVNVKKALRQGQNEGDLALFLHRAILKKPKELKFSNKE-KLSCTRSMYSIGG 335
277 4.000e-83UniRef50_A0A2T3AMU4 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2T3AMU4_9PEZI  ali  30  114.GPRNPDARPPSRHDVKPFSDFLTDSFHRQHSYLRISLTEKCNLRCVYCMPEGVPLSAPASLLTTPEILLLASTFVSQGVSKIRLTGGEPTVRPDILPLMQQLGDLR-PHGLRELCITTNGIALHRKLEKMVEAGLTGVNLSLDTLDPWQFQIMTRRRGFEAVQKSIARIHEAGIKFKINCVVMRHVNDRELLDFVDMTRDKDVEVRFIEYMPFDGNKWSKGKMYSYTEMLDTIRARYPSVAKVQDHQNDTSKTWHIPGFAGKIGFVTSMTHNFCGSCNRLRITSDGSLKVCLFGDAEVSLRDILREINNSERLLHVIGAAVKSKKAKHAGM-GELEHMKNRPMILI.. 503
278 4.000e-83UniRef50_A0A1F8XHJ3 GTP 3`,8-cyclase n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8XHJ3_9DELT  ali  39  1.....................MLRDPYGRLVDYLRVSVTDRCDLRCVYCMPEGIPLKPVSEILTYDELIRTVRVAASLGVRKVRVTGGEPLVRRGIVSFVRRVAGIR---GIRDLGMTTNGTALSGMAVPLRQAGLSRVNISLDTIRRDRYAEITRRDALPKVIEGIEAAIRAGSPVKINVVLLHGLLRSEVDDFFTMAREMPVKVRFIERMPIGCSP---SEGYVSAAGIRERILSLPGVREERNGASSAAVTFEVPGFAGRLGIISPVSWKFCSDCNRLRVTADGRLRTCLFGRETLDLRGVLRSGRGDDAVADLFREAVRTKPQGHDLCAGGDVPSPAEPMSRVGG 324
279 5.000e-83UniRef50_A0A139IRP7 Uncharacterized protein n=1 Tax=Pseudocercospora musae TaxID=113226 RepID=A0A139IRP7_9PEZI  ali  33  51..PYMPNPTPILASRAKPFSDFLTDTYDRQHEYLRISLTERCNLRCTYCMPEGVQISPNREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQKIGSLRR-NGLKELALTTNGISLHRKLDAMIEAGLTGVNISLDTLDPLQFPILTRRQGFSAVMKSINRVQEAGIKLKINCVAMRGVNDDQIIPFVEMTRDEDIEVRFIEYMPFGGNKWSQRKMLPYAELVELISTRYPTLGRLKDATNDTSKTWQVPGFKGRVGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNTEVNLRDVIRADNRERQLLEVIGAAVKRKKAKHAGMGKL-ENMENRPMILIG. 447
280 6.000e-83UniRef50_A0A2D7H227 GTP 3`,8-cyclase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D7H227_9BACT  ali  33  15........KPAPAPAHATQEGKLFDAHGRQIRDLRLSITDRCNFRCVYCMEPDVKYIPKMQLLTLDEYVRVIKVAISLGMNKLRITGGEPTLYPHLDELLEQVG----KLGLKDIALTTNGSNIKKWATRWKKLGLNRVTVSLDTLRPERKDAITRSKSLNTVIESIDALRDAGTPVKVNAVVIRGVNDDEAIDFADFAQEHEIDMRMIEFMPLDAGKRWEKRHVVSANELLERIKTKHDVIREVDAKTSTSMNYRFTKGGGRIGFIASVSEAFCGACDRMRMMADGTLRPCLFSDEEWSIRPLLRNSASDDALRQFFRDALWQKSAGHGMDRDDFKRPEK-TMSRIGG 353
281 7.000e-83UniRef50_A0A2E7UQ22 GTP 3`,8-cyclase n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UQ22_9DELT  ali  43  5...........LPTPTLTRRQPLVDRLGRVHTYLRVSVTDRCNFRCVYCMPEGLNWQPREDLLTYEEIGRLVGVFAEMGVQKVRLTGGEPTVRSDIEALIAQIASCK---GILDLAMTTNGHTLARLAPRLARAGLNRINVSLDTLRPERFGRVTRGGQLTRVLEGIEAARQAITPIKINVVLMKDENDDELFELVEYFAQWAQDTELRFIEYMPFGK--RRHGTVPSHSLRDRLSQQYTLCAQPQHSAGPASTWTLAENSLKVGFISPLSEHFCATCNRLRLMCDGHLRTCLAHDDTPSLRDLLRSGATDHALEDAIRAMVYAKPDGHDAQINGGTHFEGV-MTRIGG 340
282 7.000e-83UniRef50_A0A1H3FP86 GTP 3`,8-cyclase n=2 Tax=Eubacterium TaxID=1730 RepID=A0A1H3FP86_EUBBA  ali  36  1......................MKDQYGRHIDYMRLSITDRCDFRCVYCMPEGVAPITHDEILTFDEILRICRSAVDLGITRFKVTGGEPLVRKGAVDLLAR---MKALPGVEQVTLTTNGYVLGQYVEALKALGIDGINISLDTLDRERFREITKRDGLDRVLQSLEKAVDAGIRVKTNTVLMP-QNRKDWLGIADLARFWPVHVRYIEMMPIGMGRDYSG--CTGDTVMAMLKEKHPNLTAVEPLGNGPAQYFKIPGYLGRIGIISAVSHEFCQTCNRVRVTSDGILKLCLNRAGHVDLRKLLRDGGDDGALTQALATAILNKPLRHGFEIQGQEDEETRRMVGIGG 323
283 8.000e-83UniRef50_A0A0F4GGF9 Uncharacterized protein n=2 Tax=Zymoseptoria TaxID=1047167 RepID=A0A0F4GGF9_9PEZI  ali  32  57.....QGDRIQDLRAAKPFSDFLTDTYQRQHDYLRISLTERCNLRCTYCMPEGIQLSPDRDILTTPEIYYLSALFVNQGVTKIRLTGGEPTVRKDIVPLMKQIGSLRR-NGLQELALTTNGISLHRKLEDMVEAGLTGVNISLDTLDKLQFPLLTRRNGFDAVMKSINRVQEAGINLKINCVAMRGVNDDQILPFVEMTREQDLEVRFIEYMPFGGNKWSQKKMLPYAELVEIIRSRYPDIGRLQDGKSAVSKTWQVPGFKGRIGFITSMTNDFCGSCNRLRITSDGNLKVCLHGNTEVSLRDLLRNEHNERQLLEVIGAAVKRKQEKHAGM-GELENMTNRPMILIG. 437
284 8.000e-83UniRef50_A0A1V4QW93 GTP 3`,8-cyclase n=1 Tax=Candidatus Latescibacteria bacterium 4484_107 TaxID=1956171 RepID=A0A1V4QW93_9BACT  ali  40  1......................MKDRFGRTISYLRISVTDRCNLRCLYCMPQGISLVQHKDILRYEEIVRLVRIAAGLGFRKFRLTGGEPLVRKGIIGLVGTLTRNCPPRNNHSLAMTTNGVLLSEYARPLKTAGLGRINVSLDTLDRAKYQRITGFDAFDRVMAGIRKARAVGFPLKINVVAMRGINDDEVGDFVRLAR-EGFEVRFIELMPFRVRAEGWSDRFISGAQIREKIAQTFHIRRTDEGPAGPARMYRAEDWPGRIGFIEPISSRFCSACNRLRLTADGFLKPCLLSDVEVDLKTPLRTGATDEDIAGLFRETILEKPRGHHLKE---HKIPVRTMAQVGG 344
285 8.000e-83UniRef50_A0A191HU32 GTP 3`,8-cyclase n=1 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A191HU32_9FIRM  ali  40  4..............................IDYLRIAVTDRCNLRCVYCMPEGVDLKSHDEMLSIEEVEKLVKSVAPMGIKKIRLTGGEPLVRKNIEILVKKI---ASVEGVEHITMTTNGILLGSMAKALKVSGLNRVNISLDTLKADKFKAITRWGDLNDVLAGIDASLKFGTPVKINVVAMKGFNDDEIIDFVELAIKKRVQVRFIELMPIGESDEKARIEHISIDAIKAIIEEKYKLISTDDITDGPASNYFIEGHPGSVGFIGSLSNHFCGRCNRLRVTADGKVRLCLHKDVEFDVLALLREGKSEAEIRAFFESIIPLKPKGHSMTEEGWGNQK-RKMSQIGG 322
286 8.000e-83UniRef50_A0A2E1CEB1 GTP 3`,8-cyclase n=34 Tax=Bacteria TaxID=2 RepID=A0A2E1CEB1_9ACTN  ali  35  5......................LTDLFGRVHKDFRISVTDRCNFRXQYCMPEGLDWLKREELLSFEEITRITKIXVENGIXSVRLTGGEPTLRANLSDXISMLSXLP-----IEIALTTNGISLDKNAHNFRSAGLHRVNISIDSLKAERFKEITLRDDMKKVITGIEASIEAGSPVKINVVVMRGINDDEIIEFAKFGRERXVIVRFIEFMPLDADEKWSTLSVVSLXEIFSTINSVYPLEVVKRS-NAPASRFRYXDGQGEIGIVASVTQKFCDTCDRIRITADGQFRNCLFSNEEFDLKEALRSESXDKEICELLEMAVSAKREGHGIGNVDFIRP-ARSMSQIGG 327
287 8.000e-83UniRef50_J9K129 Uncharacterized protein n=4 Tax=Macrosiphini TaxID=33386 RepID=J9K129_ACYPI  ali  33  12.......SVKSISTKKSSFNEVLTDTFGRKHNYLRVSLTERCNLRCEYCMPKGAKLSEQSKLLSNNEIVRLVSLFAKQGVDKIRITGGEPTVKKDIIQIVESLRDIRK---LKTIAMTTNGLTLTKHLVDLQRAGLNALNVSLDTLQENTYGKITRRDGLKRVLAGIDLALQLGFPVKVNCVLMRGINFDELGDFVEMTRDRKINYRFIEFMPFSMNDWEEKRMVPYKEAIREIMKSYPNFEPCDNEPNSTSKMYRVPGFAGSIGFISSMTDDYCDSCNRLRLMADGNLKACLFQNNEISLRDPLREGASDEELLDIISNAVKDKKRKHAVADRT.............. 340
288 9.000e-83UniRef50_A0A125NXQ4 GTP 3`,8-cyclase n=3 Tax=Nitrospirae TaxID=40117 RepID=A0A125NXQ4_9BACT  ali  38  2.....................QLTDNFGRSIDYIRISVTDRCNLRCVYCMPDTMKKINTDSILTYEEIVRFVDVAATLGIKKIRLTGGEPLVRNSIDELVKGI---KEIPGIEELSLTTNGQRLAGMTSALAQSGLDRVNISLDSLRADRYAEITKGGDFDKVMAGIRAAEAAELPVKLNMVPMVGINDDEIEAFVRFGIQTGCQIRFIELMPTVVNEHLFNKGFIGTDEIKRRIEREFHITPLKLRKHGPARYFSVTDHNGIIGIISAVTCRFCSQCNRLRLTADGRLRPCLYSNIEVSLFDALRHNASKEELQGLILQAVDLKPERHHITDGTETDTPTASMSGVGG 343
289 9.000e-83UniRef50_A0A2G9XGM6 GTP 3`,8-cyclase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2G9XGM6_9DELT  ali  39  1......................MIDKYNREINYLRVSVTDRCNLRCVYCTPEGQSLLGHDDILRYEEISRIIRMAVKIGVAKVRITGGEPLVRHGIVDFIASL---KTIEGIDDISLTTNGTFLEAFAERLFDAGMKRINISLDSLHAGKYARITRGGDLDAVLRGIDKVCRIGFPIKINTVAIKGFNDDEILDFTRLALYKPYQIRFIELMPIGQAGMENNGKYLSNDIVKERISRFYRLEPVNGNQSGPAQIFRIAGGVGEIGFISPVSRQFCRSCNRLRLTADGHLRACLLSEAEVDLKGPLRNGCSDEELERLLKRVIAGKQKQYSMACNENHKKCMREMSSIGG 345
290 9.000e-83UniRef50_A0A2A4QIW5 Cyclic pyranopterin phosphate synthase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4QIW5_9RHOB  ali  53  1......................................................................................................MSRHLGQG-LDELTLTTNGSQLSKYADELASYGIKRINLSLDTLDADKFKAITRWGRLEQVLDGIRAAQAADLRIKINMVALKGTNEDELETIVAWCADMGLDLTFIEVMPMGDLNENRLDQYWALSDVRKRLAQSYTLTELSERTGGPARYMRLNETGQKIGFITPLSHNFCESCNRVRLTCTGQLFQCLGQEDEADLRAVLRANPDDGPVIKAIHAAIALKPKGHDFSYQSVSGEMTRHMSHTGG 250
291 1.000e-82UniRef50_A0A2H6B761 GTP 3`,8-cyclase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H6B761_9BACT  ali  37  25........AHAALSRRAMGSPALVDSFGRVARDLRLSVTDRCNLRCRYCMPEGVPYAPRTELLTIGETVRLVALLARLGIRRLRITGGEPLLRGDLVDLAAAL---RRIPEIERLAITTNGVLLERRAAELAAAGISHFNVSLDSLSAQRFAAITRRPLLRRVLAGLAALERTPERIKVNVVATRDFSDRELFAFVELARTRPYEVRCLEFMPLDGERSWRPDAVVTASELRERIERRYALEELPRPAGATARAYRFADGSGTIAFVSPVSAPFCGDCTRLRLTADGHLKTCLFASEELDLRTPLRAGASDRELAALVRGAVARKPRGHTIATARF-TPPERTMSAIGG 364
292 1.000e-82UniRef50_A0A2J6NG18 GTP 3`,8-cyclase n=21 Tax=Bacteria TaxID=2 RepID=A0A2J6NG18_9STAP  ali  32  3.....................QVTDKFGRPLRDLRISVTDKCQFRCSYCMPDDYAFLPEEHLLSFDEIERLARIYADLGVKKLRITGGEPLMRKDLHELIARLN---KIPGIEDIGMTTNALLLKKHGQKLYDAGLRRLNISLDAMDDELFGQINDRGGTSRILENIDYAISLGFKIKVNMVVQKGLNDHEILPMARHFKNTPITLRFIEFMDVGNDNGWNFEKVVSKEDILDMLREEFTLEPVDPYYGEVAKVYKHTDTDAHLGFITSVSENFCSTCTRARLSADGKFYGCLFATEGFDIKTLMREGISDETLEDILMGEWNKRDDRHKITEEERKARRKIDMSYIGG 339
293 1.000e-82UniRef50_A0A1H0AJ01 GTP 3`,8-cyclase n=1 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1H0AJ01_9FIRM  ali  38  4......................LRDLFGRRIHYLRVAVTDRCNFRCRYCMPQDNNWLPDHSMLSDQELVLLIHMFASLGVDKVRFTGGEPLMRAGVADLLAQI---KAVDGINEVNITTNGKLLPEYALSLKTAGVDRVNVSLDTLNRKLFKALTGQDALEQVLNGIKQVLEAGFTVKINMVVMKGVNSGELADFARLTLEYPFQVRFIEYMPFNFGENY---LMTAADMLEQLAATGITGLIAVPGQLTTARIYRLPDAKGTIGFISPVSQHFCSCCNRVRITPDGFLKPCLLTNLEYPLRDWLRAGLSQQELTRLIVEAVRAKPRS---SQLGSQPLKGRPMFRIGG 322
294 1.000e-82UniRef50_A0A2H5XA55 GTP 3`,8-cyclase n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2H5XA55_9BACT  ali  35  9..........CDATADALLRAPLVDRFGRVARKLRLSVTDRCNFRCHFCMPLNPVWLPKEHLLTYEEMVWVARLLAGMGVTKIRLSGGEPLIRRDVDALVAML---AAIPAVESVTMTTNGFYLLEMAARLKAAGLSGVTVSLHSLKPDRFEIVGRREVFDRVMAGIAEARRVGLPVKVNVVITRGCNDDEILDFTELARRTGMTVRFIEYMPFDGQKLWSSERLVSGAEILERIGERYLLVPLPREPGSTAQVYRFADGPGEVAVITSMTLPFCDDCDRIRLTADGKIVPCLFSRDEYDLRPLLRGGADDVELARFIRAAFWRKFAGETLLRTAQHVGHVRPMHTIGG 347
295 1.000e-82UniRef50_A0A0M4HFU2 GTP 3`,8-cyclase n=6 Tax=Bacteria TaxID=2 RepID=A0A0M4HFU2_9BACT  ali  35  2................PATASVLYDNHGRPLEYVRLAVTDRCNLRCFYCMPEGIDYVPRQALLSYEELERVVRILARLGVHKVRLTGGEPFVRRGLLPFIGRL---RQIEGITDIGLTTNGVLTAPHVPELVRLGIRSVNLSLDTLDRARFLRITRRDELPQVLATFDALVAAGIQVKINAVVMDGQNTEDIISLAELTRDLPVEVRFIEEMPFNGGSHAAMSLPWNHVRIREHLAAHFPLMPVPTAPGATAAEYTIPGYAGNVGIIAAYSRTFCGTCNRIRLTAEGGLKTCLYDQGVLDVRALLRGGATDEEISTALTTAFRYRAANGFEAEQQRHQLSFESMSTIGG 335
296 2.000e-82UniRef50_A0A1V5D6D7 GTP 3`,8-cyclase n=10 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5D6D7_9DELT  ali  42  17...............ALEQKADLTDRHHRTINYLRLSVTDRCNLRCVYCMPEGMTFIPHREILTYEEMLHLVELCVANGIRKIRLTGGEPLVRRGIISFIDRLN---RIENLKEITLTTNGVLLKEFARDLRKYGICRINVSMDTLKPEKFNAITRRPFFEKVWEGIEEAESVGMPIKLNVVAMKGFNDDEILDFARLTYRKPYHVRFIEMMPIGAADARMKGFISSGEILERISTLGPVRRVESESMAGPAEMYILEGARGRIGLIGALSHHFCETCNRLRLTADGQLRGCLFSDRETDLKTPLREGREGPYLSALIRDAILNKPRGHDLDLNN-PRKCVRPMSRIGG 348
297 2.000e-82UniRef50_A0A2E7SU48 GTP 3`,8-cyclase n=3 Tax=root TaxID=1 RepID=A0A2E7SU48_9BACT  ali  32  23....................PLLKDQFGRTFNYLRIAVNEICNLRCIYCMPEGVPFKPSKELLTSDEIIRFIKVAAGLGVIKIRFTGGEPLLRKGLVQL---ISDVSNIPNIQSVHLTTNGVLLEGMAVELKGAGLHGINISIDTLDPDKYKMITRRDEVEKALKGLKAAKEVKIPSKVNIVALRGFNDSEISDFVNLTKHYPLTVRFIELMPFDAHQIWKTGKFFSAKQIINDLKQLFPNIKTSIGTATEHSIFSVPGFKGKVAVIPSYSRDLCSACNRVRLTADGQIRNCLYAKNEYNVKELLMNGSTDNDIADLLLKAMWKKPIDGWKAQRSGKEHRE-SMTQIGG 349
298 2.000e-82UniRef50_A0A1Y0G9G4 GTP 3`,8-cyclase n=7 Tax=root TaxID=1 RepID=A0A1Y0G9G4_9PROT  ali  40  1................MPNLTGLSDPFGRRIEYLRLSVTDRCDLRCSYCIPEDFDFEEPAHWLSFDEIERLLGAFARLGLQRIRMTGGEPLLRRHLPQLAQRI---AALPGINDLSLSTNATQLDKHAAALKAAGVSRLNVSLDSLHPERIKVITGRDALPDILAGLQHARQAGFPIKINMVAMKGTNDDEIDDMVAFCIEQGFTLRLIE--TMPIGATGRNSAYLDLQPVKARLAKQFGLIDATFHGAGPARYLATPDGAFSVGFITPISQHFCETCNRVRLSVDGTLYLCLGQEDKFEFRPLLRGGATDSELEDAIRLALTHKPERHEFREQPEKIM--RFMSMTGG 328
299 2.000e-82UniRef50_UPI000C084FF6 GTP 3`,8-cyclase MoaA n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI000C084FF6  ali  37  1......................MKDQFNREISYLRISVTDRCNFRCKYCMEEGIKLLDHKDILTFEEIYEIVQIMTDLGVKKVRITGGEPFVRKNIMNLIEKIASIKA---LEDIGITTNGSLIYDKLERLKEIGVNRINFSLDTLKEDKFKKITKSCDFDKTIRSLEKALDLGFKVKINTVLIKGFNEDEIDSFINLTKDRDIEVRFIELMPIGQAKDFDKENFMGNQDILKAYSYK------DLGYKGVARNYQIDGYKGKIGLISPLSNKFCKDCNKIRLTSDGKLKACLHSADEINIK-----GLSKEEKKEQIIRAIYNKPQKHQLE--NSTSASLRNMNSIGG 312
300 2.000e-82UniRef50_A0A1H7YZQ6 GTP 3`,8-cyclase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1H7YZQ6_9FIRM  ali  36  1......................MFDLQNRNIDYLRISVTDRCNLRCVYCMPEGIEPCLHDEVLTYEEILKVCRCAAALGICKIKLTGGEPLARKGTAELIRSL---KAIEGIEQVTMTSNGILLYEQLPALAKAGLDAVNISLDTLDPDRFERITRRRGLDTVLKSIDLALELGLRVKINCLPVREFNGDHLMQMAELARTRPVDVRFIELMPIGYGKDLTP--VPSCEIQEQLRQTYGELAPCNKKGNGPASYFSIAGFQGNIGFISAVSTGFCGTCNRIRLTSTGFLKLCLHYNKGVELREYLRKGIEDADLTQLLQQAILQKPLQHHFGSHISDEEQH-TMAQIGG 323
301 3.000e-82UniRef50_A0A1I2SJX5 GTP 3`,8-cyclase n=81 Tax=root TaxID=1 RepID=A0A1I2SJX5_9CORY  ali  35  54.........PNMPPADAQGKRQLIDRFGRVARDLRVSLTDRCNLRCTYCMPEGLEWLPREDTLNDEEVCRLINLAVKMGIRQVRFTGGEPLLRKGLEDILRYTKTLRTDEGIAPTALTTNALGLHRRAQVLKGAGLDRVNISLDTIDPQLYAQLTRRDRLGDVLKGIKAAAEAGHPVKVNAVIMPGFNDSGIVELATWCLTHKVQLRFIEQMPLGPRDKWDRSKMVTADDILAELHTEFHMSPAIAPRGSAPAALWDTEGIGQIGVIASVTHPFCGDCDRTRLTTDGAIRNCLFSRSETNLRDLMRAGASDDEVMEAWAGAMWAKNAGHGIDDPHFLQP-DRPMSAIGG 405
302 3.000e-82UniRef50_V9H760 GTP 3`,8-cyclase n=5 Tax=Clostridium TaxID=1485 RepID=V9H760_9CLOT  ali  37  1......................MKDKYGREIDYLRISLTDNCNLRCIYCMEENNTFLKKEDKLTNDEIYKIVCESAKLGIKKVRFTGGEPLVRKDIVELMQRIN---TIQGIEEIYLTTNGILLEENVEILAKAGLKGVNISLDSLKKETFKRLTRLGDLNKVLAAIDKCISLGIKVKLNTVMIEDINDDEIIDFVNLTLQKPIDVRFIELMPIGVGSKYKG---INNEVIIDIIKNNYKDFEERIKSGGPATYIKLKDAKGKIGFISAISNCFCEDCNRIRLTPEGFLKQCLHFNYGIDLKELIRKGGSDNELSLAIENSIFDKPEKHLFMQKSNDK-ELKFMNQIGG 323
303 3.000e-82UniRef50_Q93KD1 GTP 3`,8-cyclase n=49 Tax=Bacteria TaxID=2 RepID=MOAA_PEPAC  ali  39  1................MDNKSVLLDGYGRRINYLRISVTDRCNLRCMYCMPEGIPKRAHHDIMTLEELQEVAVALVELGIDKIRITGGEPLVRKGIVGLVRELSKC---EGLNEITLTTNGLLLSEYARELKAAGLKRVNISLDTLNPQKFEYITRGGSLEKVLEGIKEAQSVGTPIKLNTVLIGGFNDDEIEDFVALTVDNEIDVRFIELMPYRGSRLWSLEKFISSD---SVLKKVPSLEKIKEDISSPAEYYRIPGALGKVGLINPITCKFCENCNRLRLTSDGKLKLCLHSDSEIDLAGPLRRG---EDIRGIVLDEIKNKPREHSLEDGEY---IKRDMFKIGG 325
304 3.000e-82UniRef50_A0A174B8G0 GTP 3`,8-cyclase n=1 Tax=Turicibacter sanguinis TaxID=154288 RepID=A0A174B8G0_9FIRM  ali  37  1......................MRDQYQRKIDYVRISITDRCNLRCTYCMPEEVDFMHHEKLLSTEEILKIVKAFEELGVTKVKITGGEPLVRKDIIELIASI---KKMAGIQEVSITTNGVLLEKMIDDLEQAGLDSINISLDTLKPAQYALMTRRNQFDIVMRGIQCAIKSSIPKKLNCVLIKEINGDEILDLVELAHQTRVHVRFIELMPIGYAKNLTP---ISEDEVLDLLSKHYEGVKPFEGKNGPAHYYEIEGFLGKVGFISAMSHRFCSTCNRVRVTSEGYLKTCLHFKKGIDLKAHIATGN----LKEAILESLQKKPKQHQFNEVLNEEEVDRMMVQIGG 322
305 3.000e-82UniRef50_W0DGZ9 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=W0DGZ9_9AQUI  ali  32  1.....................MPIDQLGRELKDLRVSVTDRCNFRCQFCMPEGYEFFKREEILSFEEIARVVRIVKGLGVKKVRLTGGEPLLRRHLENLVALISQE-----VEDIALTTNGFLLKDKVQDLASAGLKRVTVSLPSLRDQTLSKLVGRDKVGQILEGIHRSLELGLSVKVNVCVVRDINDDEILDFIEFFRPLGVEVRFIEFMDVGTLNGWSLERVFSAKEIINAISQRYRVKPIGRQRRGETAERFMLEDGYKFGIIASVTQPFCGECNRLRLTADGKLFTCLFASDGYDLKSLLRGGAKDEEIRDFIVALWEKRKDRYSEERKKGIKPKKVEMFKLGG 330
306 3.000e-82UniRef50_A0A1H1JHP6 GTP 3`,8-cyclase n=6 Tax=unclassified Rhizobiales (miscellaneous) TaxID=41292 RepID=A0A1H1JHP6_9RHIZ  ali  59  23....PDGGAGGRAASSVPHPAPLIDPFLRPITYLRVSVTDRCDLRCVYCMNEEMTFLPKRDLLTLEELDRLCTAFVRRGTTKLRITGGEPLVRRDVMSLFRSLSRHLVSGALKELTLTTNATLLARYAQELADCGVRRVNVSLDTLDPARFRRLTRWGEIGKVFEGIAAARAAGLEVKINAVALKGENEHELTELMRWAHGEGHGLTLIEVMPLGELTTMRSDQYLPLSLVRARLAREFTLDDLDHSSGGPARYVRVKETGGLLGFITPLTHNFCESCNRVRVTCTGTLYMCLGQEDAADLRSALRASPGDELIDQAIVEAIARKPKGHDFERQHSEPSVGRHMSVTGG 369
307 3.000e-82UniRef50_W8F2M6 GTP 3`,8-cyclase n=190 Tax=Bacteria TaxID=2 RepID=W8F2M6_9BACT  ali  38  2...............SASVSSVLFDNHGRPLEYLRLAVTDRCNLRCFYCMPEGIKYLPKQELLTYEEMERLVAIMAGLGVRKVRLTGGEPFVRRDLVPFMDRL---SQIPGIEELTMTTNGVLTAPHVPEMARMGLKAVNLSLDTLDRARFASITRRDELPRVLDTFYALLAAGIRLKINAVVMDGQNTQDLLPLAELTRDLPVDVRFIEEMPFNGGSHDAASLPWNHHRIREHLQNLGELTPVPTRSGDTASHYTVAGHQGRLGIIAAYSRTFCGTCNRIRLTAEGGLKTCLYDQGVLDIRALLRGGSSDEQIAEALKLAFRNRAANGFEAESQRHQLSFESMSTIGG 336
308 3.000e-82UniRef50_A0A1Y5GQI7 GTP 3`,8-cyclase n=10 Tax=root TaxID=1 RepID=A0A1Y5GQI7_9GAMM  ali  47  6......................LIDQFGRKVSYLRVSVTDRCDYRCVYCMAEEMTFLPRSQILTLEEQFRLCKNFVEMGVQKIRLTGGEPLIRRNIMAL---IEPLGALEGLRELVITTNGSKLKELAKPIRKAGVSRINVSLDSLQPERFKEITRTGKLSKVLEGIEEAVEAGFERKINAIIIKGRNEDEIMPLIRYVKSLGIDITFIEEMPLGTSAYDRAETFMSSVELQKVIAQEFTLVATDRDSGGPARYFDLAGSRSRVGFISPHSNNFCSTCNRVRLTSEGRLLLCLGNEHSVDLRALVRQNLDDDQIKQALLDSMDIKPEKHHFDLAE-KPQIVRFMNMTGG 331
309 4.000e-82UniRef50_UPI000B939BC4 GTP 3`,8-cyclase, mitochondrial isoform X1 n=4 Tax=Aphididae TaxID=27482 RepID=UPI000B939BC4  ali  33  12.......SVKSISTKKSLVNEVLTDTFGRKHNYLRVSLTERCNLRCEYCMPKGAKLSEQSKLLSNDEIVRLVSLFANQGVDKIRITGGEPTVKKDIIHIVESLRSIKK---LKTIAMTTNGLTLTKHLVDLQRAGLNALNVSLDSLQQNTYGNITRRDGLKRVLAGIDLALQLGFPVKVNCVLMKGVNFDELGDFVEMTRDRKINYRFIEFMPFSMNDWEENRMVPYKEAIREIMKSHPNFEPCDNEPNSTSKMYRVPGFAGSIGFISSMTDDYCDSCNRLRLMADGNLKACLFQNNEISLRDPLREGASDEELLDIISNAVKDKKRKHAVADRT.............. 340
310 4.000e-82UniRef50_A0A2M7G2F8 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2M7G2F8_9BACT  ali  33  2..................AHGQLKDQWGRVARKLRVSLTDRCNLRCQYCMPEGLNWQAREEILSFEEIFRLLTIFAELGIEEIRLTGGEPLLRKDLEILLSQIQSLH----FKKVSLTSNGILLPEKMPALYQAGLRSFNISLDSLLPERFAKITRRDDYQRVLAGLNCLDRYPDEIKLNTVMIRGFNDDEALSFARLARERNWAIRFIEFMPLGQGDGWLPQEVVKGAELKAQIEAEFRLVAVEAAGKNPASRWHFADGPGEIGFINAVSEPFCHSCNRIRLTADGYLRNCLFSSQELNLKTPLRQQATSTELTNLICDWVWQKEAGHQINQIGFERP-LRSMSQIGG 330
311 4.000e-82UniRef50_A6TVF9 GTP 3`,8-cyclase n=40 Tax=Bacteria TaxID=2 RepID=MOAA_ALKMQ  ali  37  1......................MKDTFQRSINYMRISITDLCNLRCQYCMPEGIYKKTHQDILTLEEIEQIVRIGAENGINKVRITGGEPLVRKGVIGLIKNISN---IPGIQDIALTTNGLLIKKYGEALKDAGLKRINISIDSLRPDRYKEITRGGDLSQVLEGIQEALRLGMPVKLNVVVIGGYNEDEIEDFANLTVDDPIDVRFIELMPIGEASGWAKDRFLSNEEVKSKIE---GLVPIITDATSPARLYRLPGAKGRVGFINPISSHFCESCNRIRVTSDGKLKPCLHSNHEIDLLRVARE--NPEQIGAVLSNGIQLKPEKHYLY-TNKHEMSARSMSEIGG 320
312 5.000e-82UniRef50_B6BWC5 GTP 3`,8-cyclase n=2 Tax=OM43 clade TaxID=1233498 RepID=B6BWC5_9PROT  ali  42  1.....................MLQDPFKRKINYLRLSVTDRCDFRCQYCMSEDIEFMPKHQMLTIEEMNRLANIFINLGVEKIRLTGGEPLVRRGVNELIDKLSQNKK---LKELTLTTNGSQLDQKLDVLKQSKIKRINVSLDSLCSENFKKITRIGNLNEVLANLEIAKE-YFQIKLNTVLMKNINDHEIIDLVSYAVEQNFNISFIEQMPLGEIGYDRSTSFINSNEAKKIIEKKYILEENNKRTGGPAVYWKIKGSNSFVGFISPHSHNFCDSCNRVRVSADGYLHLCLGHDEKVNLIEPLRDHDTDHAVERLIIDSLSNKPKSHEFNLENKTNVI-RFMSHTGG 323
313 5.000e-82UniRef50_UPI000C07A0A1 GTP 3`,8-cyclase MoaA n=2 Tax=Firmicutes TaxID=1239 RepID=UPI000C07A0A1  ali  40  1......................MIDSYQRRINYLRISVTDLCNLRCRYCMPEGIDKISHSDVLTLEEIETIAKVFVELGVDKIRITGGEPLVRKGMLGLIENIG---KLEGLKDFAITTNGIMLKKHAKELKDAGVNRLNISLDTLDEEKYEYITRGGQLKDALDGIKKAQEVGSPIKLNTVLIKGFNDDEIQDLVDFTNS-GIDVRFIELMPMGEARNWAIDNFISNEYVLEKIN--GLKEVKRDDINSPANYYKLPSAKGKVGFINPISCKFCSNCNRVRLTSDGKLKLCLHSNEEVDLKTPLRNK---EDIKDIIIDAISKKPKEHHLEEGDYIT---RNMIAIGG 317
314 6.000e-82UniRef50_A0A259U1N4 Cyclic pyranopterin phosphate synthase MoaA n=15 Tax=cellular organisms TaxID=131567 RepID=A0A259U1N4_9BACT  ali  36  2...................NPALIDPLGRRHTQLRLSLTERCTLRCTYCMPEGLDWTPNRLLLTTDELERVAALFVGMGVNKVRLTGGEPLARKDAVEVARRIGAMGGVQGL---AMTTNGLALEKHLPALDEAGVTQITLSLDTLRDDRFRTLTRRDGLDRVLGAMEAALARGYPLKINVVVLRNENDDEVQDLAALALRYPVEVRFIEWMPFAGLGWEKSALVPWTETHARIEDAHGPLAPREDAPDSTSRTFTFAGGPGRVGFIASMSAPFCRGCTRLRVTADGALKVCLFGSAEVSLRDAMREGATDDDLRALVAGAVARKKPAHDGDALASGANANRSMIAIGG 349
315 6.000e-82UniRef50_D0LV10 GTP 3`,8-cyclase n=2 Tax=Haliangium ochraceum TaxID=80816 RepID=D0LV10_HALO1  ali  47  1...........MSRRSLPVIAPLSDGFARRVRYLRVSLTDRCNFRCTYCMPAGMVFRARKELLSFEELERLIGVFASVGVRRIRLTGGEPTVRAEVVSLVGRI---ARVPGIDEVVMTSNGHLFPELAQPLAEAGLAGVNISLDTLDPERFRALTRRGDLARVLAGIDAARAAGLEVKINAVALKGENDAEVPALCAYAWGRGITPRFIEHMPMSEGQLYSETRQLTAAEIRAAVSAHFGAELVPEQPAGPSRYWRLGEGERRLGIISAMSEHFCDTCNRLRLSAVGALHTCLGYDDAHSLRDLMRAGASDDELRAAITAAVLEKRAGHQFQRTGGGGPTK-HMIAIGG 346
316 6.000e-82UniRef50_Q31JB9 GTP 3`,8-cyclase n=43 Tax=root TaxID=1 RepID=MOAA_HYDCU  ali  41  2.....................ALIDPFNRKIDYLRVSVTDKCNYRCGYCMPEGAHPERHTEYLDYDELARIIKAFVDLGVTKVRITGGEPLVRKGLPGFIEEIQPY---EGLEEIALSTNAHHLDKHAVALKKAGLSRANVSIDSLQPEKFNKITRGGNLEKVLAGVDAGLAAGNPIKFNMVVMKGTNDDEIEAMVDYGIEKGVEVRFIETMPIGEAGISLMDQHYPMEKIMARVRAHVGTDLIPKSHDGPSKNFHIKGTDAKIGVISAVSQHFCESCNRVRLTARGVLALCLGQEDSVDLRTPIREGISDEALKQMIVDAMLKKPEKHFFNE-NVHNIEFRQMVSLGG 331
317 7.000e-82UniRef50_R8W1Y2 GTP 3`,8-cyclase n=3 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8W1Y2_9CLOT  ali  37  1......................MIDRLGRNITYVRVSVTDRCNLRCRYCMPEGVPFLPHEEILRFEEITEVVRALAQLGLRQVKLTGGEPLCRHDLPTLARMLG---EIPGIEEVTLTTNGLLLPGQAQALADAGISRVNLSLDTLRPDRYAEITRCGKLKDALSGLQAAQKAGMRVKLNVVPVRGFNDDEIVDLVRFGREHDCPVRFIEL--MPVGLGASRQGLSNAEVLDIIQKAMPGFTPFRKLGNGPAVCYGWQDG-GVFGLIGAVHDRFCASCNRVRLTADGMLRLCLAQPDGLDLKPYLRDGK--EGMQAAIERAIYGKPTGHHFSEHD---TADRTMNGIGG 319
318 8.000e-82UniRef50_UPI00093102B3 GTP 3`,8-cyclase MoaA n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI00093102B3  ali  35  1......................MIDQFNRKITYLRISLTDRCNFRCRYCMPEGIDKLDCKDIMSYEEILRIVRVCAGLGIEKVRISGGEPFVRKNPMDFLEKL---AKIQGIKDIGITTNGSLVLPYLDRLEKAGIKRLNFSLDTLKKDKFAYITRRGNFETTMQAIERAIDRGFKVKINCVLMGSFNTDEIDDFVYLTKDNDIDVRFIELMPIGPAGAFKKEIFFKNSDLLDRLFKEYGRPLEEVETDGVAKMFKICGYKGRIGLISPISHSFCASCNRIRLTADGKIKPCLHSAKEYDLK-----GLEGEELTRALEEAILAKPQSHHLQEAAS--LSKRGMNMIGG 324
319 8.000e-82UniRef50_A0LYJ2 Molybdopterin biosynthesis MoaA protein n=11 Tax=Bacteroidetes TaxID=976 RepID=A0LYJ2_GRAFK  ali  33  5...................KKQIVDNFGRKHTYLRISLTDRCNLRCFYCMPEGIELMEKSSIMTIEEIIELATKFRDLGVDTIRLTGGEPLVRKNFGYLVEELAKLG-----VTLKITTNGIMLDRYLELFQKIGLKKINLSLDTLNKARSVFITKRDYFDRIWKNIQQALEMDMEVKLNIVLIKTVNDKEINDFIELTKHKNLTVKFIEFMPFKGNKWDWSKGVGKQEILDTISEKFGSIKELENPKHSTSTNFKVPGHVGNFAIVSTITNPFCSECNRIRVTADGKMKNCLFANSETDLLTPLRNG---EKMEELIINAIKTKKDGMDVKMDADHYENNRSMISIGG 330
320 8.000e-82UniRef50_A0A174FDP5 GTP 3`,8-cyclase n=7 Tax=Bacteria TaxID=2 RepID=A0A174FDP5_9CLOT  ali  37  1......................MKDKFEREIDYLRVSVTDNCNLRCVYCMKEKENFLKNDEKLTDDEIYKIVKESAKLGIKKIRITGGEPLVRAGIVNLIGRINN---IPGIEEIYLTTNGILLADKLEELKLNGLKGVNISLDSLKEERFSKLTRLGKLENVLVAIDKAIELGIKVKLNTVIVNDVNKDEIIDFVNLTKEKPIDIRFIELMPIGIAINYKG---VTNEEVLKVIEDNYTDYEVRSKSGGPATYIKLKGAKGKVGFISALSNCFCEDCNRIRLTPEGFLKQCLHFDYGVDLKSKLRKGISDENLREIIQENIYDKPEKHLFLEK-SEHKELKFMNQIGG 323
321 8.000e-82UniRef50_A0A2E2PIV5 GTP 3`,8-cyclase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E2PIV5_9RICK  ali  44  1......................MFDSFGRNIDYLRFSITDRCDLRCRYCMPQKMTFTEKXDMLNLEQLKXXXSLFIKLGIKKIRITGGEPLIRKDLIPFIKYLKKKLDAEFLNELTMTTNGTLLEKYAKEIYECGIKRLNVSLDTLIPEKFNFITNGGNLNKVLSGISRASEEGIKIKINCVLLKNFNEEEIIPLSKWCSKNKFILSFIETMPLGXIKYSRKEQFLPISFAXKIIEKEFGLXSSNYKTNGPSRYFLCKKLNSEIGFISPLSNHFCSTCNRIRITSNGILYTCLGHEDSVDLKPFL-NEDDNSKILMNIKNAIXKKPEKHFFEISXKEPTVKRXMNLTGG 326
322 9.000e-82UniRef50_A0A1W9IT93 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A1W9IT93_9PROT  ali  33  1...........MTSRPLPAAPSVPDTFGRPLKSLRLSVTDRCNLRCKYCMPEDYAWLPRETLLSFEEIYALTDLFTELGVDKVRLTGGEPLLRRDLPALIRMLRSHAR---ITDLALTTNGILLNEQAEALRDAGLHRLTISLDTLKPERFKTLTRRDTLAQVLDGIEMALGVGFQGKLDTVVMRGFNDDELADLIEYGRRFRAEVRFIEYMDVGGATDWSLAKVYSRDAMLETLRRYGRIEPIVEVSSAPAQRYRLPDGL-TFGIIASTTAPFCATCDRSRLTADGLWYLCLYAKDGTDLREPLRGGVSREAIKDLIRNGWAQRKDRGAEERKALEPLGLRE...... 331
323 1.000e-81UniRef50_A0A291QYF4 GTP 3`,8-cyclase MoaA n=1 Tax=Chitinophaga caeni TaxID=2029983 RepID=A0A291QYF4_9BACT  ali  34  1.....................MLTDRYGRKINYLRLAVIDRCNLRCTYCMPEGLTWLNKKELLNDEEIIRLAGILVELGIRKIRITGGEPFVRKDILHLLKELSG---IPGLDELALTTNGILTAPFIPKLKEIGIKSVNLSLDTLDEYRFHQITRRKGLNQVLETLQSLQEHQIKVKINAVVMDGINIDDIFPLVRLTEQKDIDVRFIEEMPFNGTNEHHSLKWDYLQILNHIKTEFPSISKIADPLHATAYSYQIPGFVGKVGIIAAYTRSFCGSCNRLRITPTGDLRTCLYDNRGTNLKEAIRGNMPVTEIKKLIVEAVQQKAENGAERGSAGNKSFHESMANIGG 329
324 1.000e-81UniRef50_A0A2A3ERQ9 Molybdenum cofactor biosynthesis protein n=8 Tax=Apis TaxID=7459 RepID=A0A2A3ERQ9_APICC  ali  35  43..................NNDILTDSFGRRHTYLRISITERCNLRCLYCMPEGIKLTKNDGILRTDEIIKIADLFVNEGINKIRLTGGEPTVRKDIVDIIAGL---KQLSNLKQVAITTNGLTLTRQLPFLQKAGLDAINISLDTLQENRFEQFTRRKGWSRVMAAIDLAIQLYNPVKVNCVIMKGFNDDEIIDFVNLTKNRPIDIRFIEYMPFQGNEWNQNKMVSFETMKKFIRDIYPNLQRLPNKYNDTSKAYHVPGFTGQIGFITSMTNHFCNSCNRLRITADGNLKVCLFGKGEISLRDALRSGVSNDILKEMIGQAVQR......................... 348
325 1.000e-81UniRef50_UPI000362203C GTP 3`,8-cyclase MoaA n=1 Tax=Sporichthya polymorpha TaxID=35751 RepID=UPI000362203C  ali  38  4......................LADTYGRVATDLRVSLTDKCNLRCTYCMPEGLDWLPKPQLLTDEEIVRLIRIAVKLGVEEVRFTGGEPLVRNGFVGIVSEV---AKLDPRPKMSVTSNGLGMERLAQPLKDAGLDRVNISLDTVDPELFHKLTRRDRWHDVERGLAAARDAGVPVKVNAVLMRGQNDEHPEDLLQFCLDRGYELRFIEQMPLDAQHGWNRADMITADEILEKLQRRFDLTPEPSSVRGPAERWYVDGGPATVGIIASVTRPFCGDCDRVRLTADGQVRNCLFAREESNLRDAMRAGATDAELAVRWQVAMRGKKAGHGIDDPTFLQP-DRPMSAIGG 331
326 1.000e-81UniRef50_G8T808 GTP cyclohydrolase subunit MoaA n=8 Tax=Bacteroidetes TaxID=976 RepID=G8T808_NIAKG  ali  34  1.....................MLIDQFNRAHDYLRISLTDNCNFRCFYCMPEEYEFTPASKLMQANEIEAIAKTFVDQGVKKIRLTGGEPLVRKDAADIILALSKLP-----VTLTMTTNGARLHEFLPILKQAGITSLNVSLDTLQADKFHLITRRDQFQRVYDNIHLLLENDIRAKVNVVAMKEFNDHEINDFVRWTKDTPVHVRFIEFMPFQGNK-WTSNKVLTWQQILQIVESEFSFLPLKDEGNDTAKKYIVPGHAGTFAVISTMSAPFCGTCNRMRLTADGKMKNCLFSKEETDLLTAFRNG---QDIIPLIRQSIHAKAKELGGQFSEASAIQNRSMITIGG 326
327 1.000e-81UniRef50_A0A068NUD3 GTP 3`,8-cyclase n=2 Tax=Armatimonadetes TaxID=67819 RepID=A0A068NUD3_9BACT  ali  38  2....................PLLLDRFDRTIDYLRVSVTDRCNFRCVYCMPEGFPCTPKEEHLSAEEFARIIGVAAGLGMSKVRFTGGEPLLRKDLPEIVR----AARDAGVVDLSATTNGHRLPEMAEPLAAAGLSRVNISLDTLRPDRFTAIARRGSLEIVLEGIRAAVEAGAPVKLNVVALRGINDDEAADFAAWTLREPVHVRFIEVMPMRWNADMRRRFVPCEELMASIEAVHGKLEPADLRTNGPARTFRLAGAPGTVGFISQISNDLCSRCNRLRLTHDGFLRGCLMSDGELDLRNPIRSGATDEEIRALFEHVVAHKPERHYLAEGQRVTG--RGMSQIGG 357
328 1.000e-81UniRef50_A0A0P0C5R1 GTP 3`,8-cyclase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0P0C5R1_9BACT  ali  34  2..................SESLLIDKYGRQLSYLRLSVTDRCNFRCYYCMPEGMNFAARQELLSFEELYQLSALFCSMGVNKIRITGGEPFVRAGIIPFLRKL---SQIPGLEEITVTSNGTLNQKQIKALQEIGIRKINISLDSLDRERFFKITRRDSFDSVFASIFSLMESGFDIKLNCVVAENKNIQDIVPFVELTKDRPIAVRFLEEMPFNGSSTFGTPQWSHREIYQHITNHYPTLEKLQSEASSTSVNYKVPGYAGSFGIIPSFSRTFCGTCNRIRLGATGELRTCLYGPPATNLRDVIRSGNTTEQVAQEILEAVSRREKDGFAAEASHGTAIHESMSVLGG 330
329 1.000e-81UniRef50_A0A1T1BSS3 GTP 3`,8-cyclase n=62 Tax=Bacteroidetes TaxID=976 RepID=A0A1T1BSS3_9FLAO  ali  33  3.................PSKTILTDDFGRKHNYLRISLLEKCNLRCTYCMPDGITLSPKASLMTADEIFAIAQTFVENGVDKIRLTGGEPLLRKDFPEIISKLSTLET-----SLSITTNGILIDRHIDVLKQAGVKKINLSLDTLVASKFHSITLRNQFEKVIDNLHLLLNNNFQVKVNVVLIKGFNDNEIVDFINLTESLPISVRFIEFMPFAGNEWDRIKMVSQNEILSQVETCFYKIQKLEDEKNFTARTYKIKGFQGDFGIISSITNPFCDSCNRIRLTANGKIKNCLFSNSETDLLTAFRNGES---ITELISQSVQNKKKVRAGMDDPAKHLDNRSMIAIGG 335
330 1.000e-81UniRef50_A0A0R0LHG9 GTP 3`,8-cyclase n=51 Tax=cellular organisms TaxID=131567 RepID=A0A0R0LHG9_9PROT  ali  33  10......................LVDQLERPLRDLRISVTDRCNFRCSYCMPQNYPYLPRPDILSFEEIARVGQVFSTLGVRKIRLTGGEPLLRKNLEQLISQL----SLLPNVETALTTNASLLAKKAYALKEAGLNRLTVSLDALDNATFQLMSDADDVEDVLQGIEEAHRVGFENKVNCVIKRGVNDHALEDLTRYFKGTAITVRFIEYMDVGSTNNWHAKEVVPAKEMKETIERMFPLKDEQSYPGEVAKSYRYEDDSGKVGFITSVTQPFCGDCTRIRLSTDGKLYSCLFATTGFDLRQQLRSGASDQALSTMIIALWQKRSDRYSELRQIASEKKKIEMSYIGG 341
331 2.000e-81UniRef50_A0A2H6ECN7 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H6ECN7_9BACT  ali  33  3......................LIDKYNRVHNYLRISLTDKCNFNCIYCNPDGDHFLSKNNILTYEEILRIIHIFAKLEFKKIRFTGGEPLVRKSVFEFFNEVKKIKDKFNL-QLGITTNGTLLEGNAQRLKNTGIEKLNISLDSLKPELFYKITGRNNLQNVLDAIDESVEAFDPVKINMVVIKNINDNEILDFVEFIKNRNLNVRFIEFM-PFGNNQWARDGFISFDEMKNLIESKYILKPLITDVNEVAKDFSIEGYEGKVSFITSMSEHFCNTCNRLRITADGKLRLCLFSTGEIDFKALFKNNYSDNEIVQLLLEAIIFKWEKHPEAEELTILEHN-NMLKIGG 332
332 2.000e-81UniRef50_A0A2G6ME17 GTP 3`,8-cyclase n=1 Tax=Desulfobulbus propionicus TaxID=894 RepID=A0A2G6ME17_9DELT  ali  38  6.............STSHENKSRLVDLFARTISYLRLSLTDRCNLRCLYCDPEDEELLAHCEMLSYEELLRIVGVAVGMGISKVRLTGGEPLVRSNVIDF---IRAMGKIEGLTDVRLTTNGVLLEQYAEDLFQAGVTKVNISLDTLKPERFKRITGVDCFDKVWRGVLKALEVGFPVKVNVVTMRNVNDDELKDFIRLAKKLPLQIRFIEFMPIGDATRWSTNTYISCDEIKERLVAFEKLVPLRKETDGPAQVYRLTGSQGSIGFISPMSHKFCDRCNRLRLTSAGTLRACLLYDQETDLKNIIRNGASDEDIRQTLIAAILNKPKGHEMAENTPANSCHGQMSRIGG 349
333 2.000e-81UniRef50_R5WQW2 GTP 3`,8-cyclase n=39 Tax=Firmicutes TaxID=1239 RepID=R5WQW2_9FIRM  ali  34  1......................MIDRCGRTIDYLRISVTDRCNLRCIYCMPEGVKLVERSQILREEEIIRISRVMAQLGITRIKLTGGEPLVHVRMPELVRQI---KEIPGIKKVTLTTNGTLLKEQMKELAEAGLDAVNISLDTLNRDCFQKITRRDLLNEALEGIQEALRYPGISVKINCVPLGIEGQDLCEIAELARKYPVHVRFIEMMPIGCGMEFKG---MSEKELTELLEKRFGLYQGEPLGNGPSRYYEAQGFEGKLGFISAVSHKFCKDCNRIRLTSQGYLKTCLQYSAGKDLREIIRNGGTDEELTEAILEALEQKPDGHQFLEKQADDTEKLCMSQIGG 326
334 3.000e-81UniRef50_A0A2S5BJE9 Uncharacterized protein n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BJE9_9BASI  ali  33  38...SRQQARLKIQAQDA-VSPHLIDSFGRRHDYLRISLTEKCNLRCTYCMPEGVPLLPNDSRLTAAEIERVASVFVRNGVRKIRLTGGEPTVRSDLVDIVERLGRLRQ---LDSLGITSNGIALKRKLPALVDAGLTHLNLSLDTLDPFKYELMTRRRGFDRVVEVLDLAQRLPLRVKLNVVVIRGVNDDEVADFVALTRDQNITVRFIEYMPFEDNRWSTRKLVPSADLLATLESKHPDLVKLRDSANDTTRAYAVPGWRGSFGFISSMTDHFCGTCSRLRIGPDGGVKVCLFGPPVLSLRPLLRSPATDDQLMEAVGRAVYGKKFAHNGLGATASRRP......... 387
335 3.000e-81UniRef50_A0A178MZM8 GTP 3`,8-cyclase n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A178MZM8_9PROT  ali  50  1.....................MLIDSFKRTVDYLRLSLTDRCDLRCVYCMSESTRFVPRDQVLSLEEIERLCAVFVRGGGRKIRLTGGEPLMRPNALGLIRALGSWVADGRLAELTMTTNGTRLAEFAGDLAAAGIRRINVSLDTLDATTFKTLTRGGTLQRVLDGLEAAKAAGLRVRINCVAVPGIADRDAEALVEWCVGQGFDLCFIEMMPFGEGAASLGWSRLPLAELRICLARRWSLFDVADRSSGPAQYVRVGDTGRRIGFIAPERHGFCQECNRVRLSCTGQLYPCLGREIRYDLRAALRAGAGDDELERHFATAVTLKPVGHAFAEQGDHAAPMRAMSVTGG 328
336 3.000e-81UniRef50_A0A2E1ZKN3 GTP 3`,8-cyclase n=51 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E1ZKN3_9GAMM  ali  44  8......................LVDKFGRHVDYIRLSVTDRCDFRCVYCMTEDMTFLPRTQILTLEELYQIAKAFTELGVKKIRLTGGEPMVRTDVMTLIEKLG---ALPGIEELNLTTNGAQLDKHAPALKRAGVNRINISIDSLNAGRFKKISRVGKLEKVLAGIEAAREAGFDRRLNSVIMRGYNEDEVISLTDYALDRDIDIAFIEEMPLGEADHDRKETTCSNDWVKNAISQKYELINSTEQTAGPSRYAQIAGKKSRIGFISPVTHNFCEDCNRVRVTVEGRLLLCLGNEHSIDLRSILRDESSSDDLKQAIIASMEIKPERHYFYDKEHAQPV-RLMNMTGG 333
337 3.000e-81UniRef50_W2T4R8 Molybdenum cofactor biosynthesis protein A n=2 Tax=Strongylida TaxID=6308 RepID=W2T4R8_NECAM  ali  32  26LKPKRDAIRALINQIEKEKGAPFVDTHGRVHSYLRISLTEKCNLRCLYCMPEGVQLTPPSNLLTSDEIVRLVELFASHGIDKIRLTGGEPTIRRDIVEIVERI---RNIDGIVDIGLTSNGIVLAKKLRQLKEAGLTKVNISLDTLVDHKFTLMTRRNGFAKVMKSIDLAEALFPTVKINTVVMRNINDDEVNDFVNLTKNRRLDVRFIEYMPFGGNHFSTKKFIDFKALLAIINQKYNGLVKLQDAPHATTKAFKIAGFKGQFGFITSMSDHFCGTCNRLRITADGNLKVCLHGNAEVSMRDLLRRHASSDEISDVIQKAVTRKKKQHA................... 383
338 4.000e-81UniRef50_D4J8E2 GTP 3`,8-cyclase n=152 Tax=Bacteria TaxID=2 RepID=D4J8E2_9FIRM  ali  38  1......................MIDGFNRTIDYIRLSVTDRCNLRCRYCMPDGISCLPMREILTYEEIEHLCRIFAALGIHKVKITGGEPFVRKNICHLIRRI---KQIPGIDSVTLTTNGTLALHHLEELKAIGIDGINFSLDTLKPAVFQQITGGRGLENVLVAINKAVSLQIPNKINCVPVRDFNLSEIPDIAALAENYPIHVRFIEMMPIGLGKDFQ--MISESEICHLLKDTYGSLEPIDGIFNGPAHYYHIPGFKGHIGFISAMSHMFCDGCNRIRLTTDGQLKTCLFYENGIDLKSLIRNNCSDEELRQQVCLALQSKPQHHEI---SSLPPELRGMSQIGG 322
339 4.000e-81UniRef50_A0A267T491 GTP 3`,8-cyclase MoaA n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A267T491_9BACT  ali  33  1.....................MIYDNHGRPITYLRLAVTDRCNLRCFYCMPEGIKYLHKSKLLSYEEMLRIVGVLAELGVHKVRITGGEPFVRNNLVDFLYRL---ADIQGIDELNITTNGVLTGQYLKQMKEIGIRSVNLSLDTLDAQRFFEITRRDEFSKVYQTLFDLLDAGFEVKINAVVMDGKNTDDILPLVALTEHYPVAVRFIEEMPFNGEGSHYPVLHWNIHRILEIRGTYPSLSKIEDAPHSTSYNYHVPGFKGNIGVIAAFSRTFCGTCNRIRMTAQGELKTCLYDEGVLSIRDLIRSGISNEELKGVFINTFQKRAKDGFEAEKRRTKLVTESMTTIGG 327
340 4.000e-81UniRef50_A0A1F9GK97 GTP 3`,8-cyclase n=4 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9GK97_9DELT  ali  38  1......................MIDSFGRTIDYLRISVTDRCNFRCVYCMPEGIPNLSHNDVLTFEEIARIARIFLQMGGKRLRITGGEPLVRKNIIELVFQLSN---LPGLESLGLTTNGFYLKEFAKFLKEAGLKKINVSLDSVRPSRFSELTHCPSFEKVWEGIEEALFVGLQTKINVVALKGISEEEILSFGEMAKRLPVEVRFIEFMPLCGTG-WHPEWMIPLREIRNALNSNFELLPLPRGT-EVAESYQVKKGRGRIGFISSMTEPFCKNCSRLRLTCDGKIRPCLFSNLEIDLKSWLRGGWPDTDIMATILEAVRAKPSGHHITFPIPDARELPRIRFIGG 342
341 4.000e-81UniRef50_A0A0P6XCF1 GTP 3`,8-cyclase n=6 Tax=root TaxID=1 RepID=A0A0P6XCF1_9CHLR  ali  36  1.....................MLIDHYGRAITYLRMSITDRCNLRCAYCQPSGLDWIPDDQRLTKDDFIRLARVAAALGITKIRLTGGEPLVNPDILEITAQI---AAIPGIEDLSLTSNAILLGKLAGPLADAGLKRVNISLDTLHPEKYRRVTRFGDFDQAWQGILAAEKAGLPLKLNTVVVGGFNDDEIPELARLSIDHPWHIRFIELMPVANSQDWGDQRYVSVQTMHEKLADLSLVPEATPPNAGPERMFRIPGAAGTVGFIAPLGEHFCARCNRLRLTADGRLRSCLLVDKEISVRDALKSGAD---LKLFIQKAVEEKPRGHKLEEHN--CPDSRCMSQIGG 328
342 5.000e-81UniRef50_S6AKI2 GTP 3`,8-cyclase n=255 Tax=Proteobacteria TaxID=1224 RepID=S6AKI2_9PROT  ali  43  3...................DAMLCDSHGRRIEYLRLSVTDRCDLRCTYCMPAGFKYEEPANWLTFDEIERVVGAFARLGVHKIRLTGGEPLLRRNLAELAGRL---SSLPGIADLSLSSNGTQLAKHAQALRAAGITRLNVSLDTLDQARFATITGRDALDAVLHGLMAAKEEGFPIKINMVVMAGTTDNEFDAMAAYCIEHRFVLRLIEAMPVGETG--RKTAFVALGTIRERLRTCFGLVDGVVAGGGPARYLVSPDGSCQIGFITPISQHFCDTCNRVRLSVDGTLYLCLGQDDKVDLRALLRSGCSDDQLEQALLDGIGRKPLKHEFCEHPTQVV--RFMSSTGG 327
343 5.000e-81UniRef50_G7E107 Uncharacterized protein n=2 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7E107_MIXOS :  ali  32  46VMPTSSRLAQMRRKLAASPREPLVDRFGRRHDYLRISLTEKCNLRCTYCMPEGAPLSPAEHLLSTPEIARIARLFVANGVRKIRLTGGEPTLRPDLLDLMAQLDSM---HGVESIGITSNGIKLLRQLPALISNGLTHLNISLDTLDPFKFTLMTRRQGHSRVLQAIEGAVALLHKPKVNVVVIRGLNDDEVLDFAALAARLPVQIRFIEYMPFDDNHWEQKKLVPSAELLDRLRQVYPSLTRRPAQMSDTSRDYTVAAWRGTVGFISSMTDHFCSGCSRLRLNADGGVKVCLFGPPKLNLREKIREGHSDARLLSEIGAAVQQKYFAHDGKSSPSDIAKSRN...... 402
344 6.000e-81UniRef50_A0A2E4IS27 GTP 3`,8-cyclase n=19 Tax=cellular organisms TaxID=131567 RepID=A0A2E4IS27_9RICK  ali  32  1......................MEDKLSRKLTDLRISVTDRCNFRCRYCMPEEYEFLSRDQVLSFEEIVRLTKIFIKLGINKIRLTGGEPLVRKNIEELISLISRLDKNI---DLAMTTNGYLLNKFSNILFSSGLRRLTISLDSLDNDIFQKMSKKFSVEDILKGISSAKEAGFKNKINSVIKKGVNDKGIIDLVDYCKQEGHILRFIEYMDVGTLNSWNRKSVVDSKEIIEIISEKYSIHPIKKNYSSEADRYQFDDGEGELGFISSVSNPFCMSCTRSRITADGKFVTCLFSNKGLDLKRYLRSKATDEDILNLISDNWLVRDDQYSLDRSLGKGKDKIEMFQLGG 334
345 6.000e-81UniRef50_UPI000D6BD000 GTP 3`,8-cyclase MoaA n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6BD000  ali  32  11......................LEDTFGRKHDYLRLSVTDRCNLRCFYCMPENVEFSPSEELMQTDEIEAICHDFVKMGVRKIRITGGEPLARKDIDDILLRLAKMP-----VSLHMTTNGVLVSKHQEALLKSGIESINVSLDSLNPKGFHHITRRNDFEKVMEAIEWLKTTPIKTKVNVVLMRGENDHEITDFADFAIQHNLDVRFIEFMPFQGNEWSINKRVSHQEVVSILENHLGKLQTLAHQAHETSTNFKIEGTSAIVGLISTVSQPFCGDCNRLRLTADGKMKNCLFSDSELDLLSAFRNGTS---IQPIVRKGVMKKRKERGGKDFNAKRENNRSMVRIGG 332
346 6.000e-81UniRef50_C7N1E2 GTP 3`,8-cyclase n=22 Tax=Actinobacteria TaxID=201174 RepID=C7N1E2_SLAHD  ali  37  1......................MKDSHGRVIDYLRISLTDRCNLRCRYCMPEGVSALSHEDILSLEEIERIIRVAAGMGISRLRLTGGEPLVRKGIAGLIKEAM---RTPGIESVALTTNGILLPKMAAELKEAGLSRVNISLDTLDEEQFHYITRRGHVADVMAGIDAALEAFNPVKINAVVVRSLN-QDLYEFARMSVDRPLHMRFIEYMPVYDGTGWGPQDVVSCDEVMETINARCREEKHTPTGWGPARYYEFEGAKGTVGFISPLSRHFCSECNRLRMTADGKIRPCLFSDEELDVRAAVREG-TDEDIRNVFLAALGMKPDEHH-----DKIGTERKMSQIGG 333
347 7.000e-81UniRef50_A0A1Z4EN08 GTP 3`,8-cyclase n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A1Z4EN08_9MYCO  ali  37  9..PTMPGRGSAPDAADAPAEGPLLDSFGRAATDLRVSLTDRCNLRCSYCMPDGLDWLPGEQLLRPDELVRLLHIAVRLGVTSVRFTGGEPLLAHH---LEEVVAAAAALHPRPEISLTTNGVGLARRATALADAGLDRVNVSLDSVNRAHFAAITRRDRLADVVAGLAAAKRAGTPVKVNAVLDPGTGRDDVVALLRFCLEHGYQLRVIEQMPLDAGHLWQRDAALSADDVLTALRPHFRLRPDPAPRGSAPAELWLVDAAGKFGLVASVSHAFCSTCDRTRLTADGQIRSCLFSAEETDLRALLRGGASDGAIETAWRAAMWGKPAGHGINDPSFIQP-ARPMSAIGG 359
348 7.000e-81UniRef50_A0A1F9U2H5 GTP 3`,8-cyclase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9U2H5_9BACT  ali  37  1.....................MTEDGLRRRVSYLRVSLTDRCNLRCRYCMPNGIRFFPKDSLLDLEELKRLLKVFRDMGMTKIRLTGGEPLLRPELEEILSEII----RLGIEDVSLTTNGVLLSHRVQSLVAAGLKRVNISLDTFQAERFHKITGMAALDRVLRGIDTVDAGLEPVKINMVVMREWNLDEVEEFALFAKRAPVEVRFLELMPTANNFEGDPDSFVSADEIKMRIERVVTLG-AEEPCSGVAKVFPIEEGLGKIGFISPVSNHFCGSCNRIRLTARGALKTCLHGPDSADLRAALQGGADDTELKQIIRDALTIKPDEH-FIRPDHYVSGNLRMSQVGG 328
349 8.000e-81UniRef50_A0A1Q8B907 GTP 3`,8-cyclase n=14 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q8B907_9BACT  ali  40  17........................DVLQRPMHDLRISVTDRCNFRCTYCMPDEYTWIGRQEVLSFEEIERLARIFVGFGIQKIRLTGGEPLVRKGLPGLVKRL---AKLDGLGDLSLTTNGAFLSEQAEALYSAGLRRINVSIDTLKPERFRALTKRGNLDEVLSGLFAAKKTGMPIKINAVVIRDTNDDEILDLVQFARANGFEMRFIEYMDVGNSNAWSLEKTVTKKEILDTVNSRFPVREIGHANGSPAVDYEFLDGAGEIGIIGSVTEPFCSTCTRVRLTADGKLVTCLFAESGFDLKRLLRSGASDEEIAQQISGIWGGRVDRYSGGDYQPRVHKKIEMITLGG 349
350 8.000e-81UniRef50_A0A2G2H535 GTP 3`,8-cyclase MoaA n=17 Tax=Bacteroidetes TaxID=976 RepID=A0A2G2H535_9FLAO  ali  32  2...................KSQLIDSFGRQISYLRLAVTDRCNLRCQYCMPHGIDIVDRKELLTFKEMYRITRALSELGVNKVRLTGGEPFVRKGFVDFLEMLDF---NDLLDEINITTNGVLISKHLDKIEQLKVKAINLSIDSLKKDKFAEITRRDAFDEVYETLEILEKSSINLKLNIVVQSGINTDEIIDFVELTKHKNIAVRFIEEMPFNGGQKEVKEVWNYNRIIKEIENKYDTITKLVDGKSSTSRNFKIDDYTGTFGIIPAFTRTICDDCNRIRITATGMFKNCLFDDGVFNIRDFIRNGASNDELKKLFLSIVAKKPKDGFVAEKARNSDVSESMSTIGG 330
351 8.000e-81UniRef50_A0A1G1DES4 GTP 3`,8-cyclase n=2 Tax=unclassified Nitrospinae TaxID=1449243 RepID=A0A1G1DES4_9BACT  ali  37  3.....................PLIDKYNRRIKYIRISVTDRCDLKCLYCTPKDDSYSRRRAILRFEEITRIVRCFADLGVSRVRITGGEPLVRKDVVSLIGQLSNIK---GIEDLAMTTNATLLSKYAIDLKNAGLKRVNISLDTLKSETFKMICGGGKLKDVLEGIRGAVNIGTPVNLNTVVMKGLNNNELIDIVHFAIENMANIRFIECMPVRRIVNLSKERFVSVKEIKSLIESHFELEPAESSGGGPASYFCNPQSAIKIGFISPITQHFCKSCNRVRLTAEGILKLCLAYKDGIDLRDYIRSGISDESLKEIFIKAIQDKPQGHQFL-NDKCIPIEQSMSMIGG 334
352 1.000e-80UniRef50_UPI00097740CC GTP 3`,8-cyclase MoaA n=1 Tax=Desulfatitalea tepidiphila TaxID=1185843 RepID=UPI00097740CC  ali  39  8.....................PLSDHRHRVISYLRVSVTDRCNLRCRYCMTSHTRWLPKGHILTLEEIHRMVRIAVGLGITKVRLTGGEPLYRKGIVGLVQKL---AAEPGIEDLSMTTNGTLLAEKASALKAAGLKRINISLDTTDPQGFAELTGRDLFSAVWQGIMTAREVGFPIKINAVVLRGCNDDQIEALADLSRRYPFHVRFIEYMPIATDPHEAEHFFFPITEIAQRLEKMGRLLPVAHERDGPAQRYRFADAPGEIGLIGSMSSHFCDTCNRMRLTADGHLRPCLLSDEEVNVIDALRQGAGDEEIAAIYARAVAMK-KGHHRLSFTGDCSLRTKMASIGG 333
353 1.000e-80UniRef50_A0A2G2J8R3 GTP 3`,8-cyclase MoaA n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2G2J8R3_9FLAO  ali  34  6....................PILTDSHGRTHNYLRISLTEKCNLRCTYCMPDGIALTPRAHLMTADEIEAIAKIFVANGVDKIRLTGGEPLVRKDFSAILERLASLP-----VKLSITTNALLTHRFIDDFKRFGLNAINVSLDSLNPEKFKFITRRDEYKQAFDNINQLLDEGFNVKLNAVLMKDFNEDEIVDFVALTKDRNINVRFIEFMPFDGNLWNKNKLVSQAEILNRVNDHFGALQPLPTEQNFTARNFRIEGYRGSFGIISSVTNPFCDSCNRIRLTADGKLKNCLFSNAETDLLKPFRAG---ENLETLINGALNKKKAVRAGMTDFDQHNNNRSMIAIGG 335
354 1.000e-80UniRef50_C0Q9H2 GTP 3`,8-cyclase n=27 Tax=root TaxID=1 RepID=C0Q9H2_DESAH  ali  38  2...................DSKLMDRYHRHLNYLRVSITDRCNLRCLYCIPDGIPMLSHEEILTYEEILRIVKTGSKMGISKVRITGGEPLVRKGACDFLSRL---SKIKGLLDISLTTNGVLLEKNIEQIKAAGIHRINVSLDTLQPKKYKQITRMNMFKRVWDGIMAAHAAGFPIKLNVVVMKGINDDEIEDLARLTFTYPFHVRFIEYM-PIGPESIESGRILSGEGILKRLSVLGELLPIENIRDGPARRYRYKGAPGEIGLIFAMSNPFCSACNRLRLTASGQIRPCLLSDEQIDLKGPMRNGCTDEELAGLFIEAARTKKRRHHLGDKNAHRLNGR-MSAIGG 329
355 1.000e-80UniRef50_A0A2G2F9H8 GTP 3`,8-cyclase MoaA n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2G2F9H8_9FLAO  ali  34  8......................IIDKFGRVHDYLRISLTERCNLRCFYCMPEGVKLRDKANFMTSEEVLGIAKTFVRLGVKKIRLTGGEPLIKKDAKHLLLELGKLP-----VELAITTNAVLVDQFIETFKEAGINSVNVSLDSLEEKSFNAISRRNYFDRIKANIDLLIKNDFHVKINVVVIRNLNEHEIPDFISWTKNENIHVRFIEFMPFDGNQWNWDKKVSYKEIMQIAKDRFGEIFKIEDAKNDTARNYRLIDGEGTFGVISSVTNPFCDTCNRIRLTADGKIKNCLFSQDETDLLTAYRK---EKDIETLIYAAIRDKKKERAFDDGFVENMKNRSMTTIGG 333
356 1.000e-80UniRef50_B5GGI0 GTP 3`,8-cyclase n=1362 Tax=Bacteria TaxID=2 RepID=B5GGI0_STRSH  ali  40  56........ARSPTAYEREAGPVLLDTHGRTATDLRVSLTDRCNLRCAYCMPEGLQWLGKPELLTDEEIVRLVGLAVRLGITDVRFTGGEPLLRRGLVDLVRR---CAALAPRPRLSLTTNAIGLARTARALADAGLDRVNVSLDTLDADVFHRLTRRDRHHDVLAGLAAAREAGTPVKVNTVLMPGLNADEAPALLAWALAEGYELRFIEQMPLDAQQGWKRAGMITADDILTSLRTRYTLTPEPGAERGPAERWLVDGGPGRVGVIGSVTRPFCAACDRTRLTADGQIRTCLFATEETDLRALLRSGADDETLAERWRTAMWGKKAGSGLDDLSSFLQPSRPMSAIGG 398
357 1.000e-80UniRef50_A0A1Q6RDD1 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A0A1Q6RDD1_9FIRM  ali  41  1......................MIDQYGRTIDYLRLSVTDLCNYRCQYCMPDGVEKGPHGAVLSVEEYGEIARAAVKLGIRKIRLTGGEPLVRRGILDICRTL---RTIPELKELCLTTNGSLLPELAKPLREAGVDRLNISLDTLRAERFREITRRGDLEDAFAGIRAAEDAGFQNKLDTVLMGGVNDDEIEDFLNLTKEHPWEVRFIELMPMGPCAAWPKERFLP---VTEILNRFPALEEIEP--NGVARRYRLPGAMGAVGLITPMSHEFCGACRRIRVTADGKLKGCLHSREEISLR-----GLHGRELEDAILRGILHKPKGHHLTEHASDTP--RTMNEIGG 314
358 1.000e-80UniRef50_A0A1G1LE67 GTP 3`,8-cyclase n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1LE67_9BACT  ali  38  1......................MKDQFGRELSYLRISVIDRCSLRCLYCMPHGAGFEPWGELLSYEEIIALTKCFAELGIRKVRLTGGEPLVRKDIAELVFRI---REIPEIRELAMSTNGVFLKGQARKLKEAGLDRVNISLDTLNRIRFQQIAGIDRLAQVLDGIEEALVCGRPVKLNTVLLRGINEDEILDLVRFAIERSIEVRLIELMPTNEIQLDPEERFLSTEEAKEKIEQAYELIPVDTYDSSPARVFSIKGTGARVGFISPLSNLFCARCNRLRLKANGALKTCLHGKEDLDLRALVRSGVPKEEMKRKIQEVVWLRPEQHFLNDTQVK-HKDFQMSHVGG 326
359 2.000e-80UniRef50_A0A1C5YLU1 GTP 3`,8-cyclase n=27 Tax=Firmicutes TaxID=1239 RepID=A0A1C5YLU1_9FIRM  ali  38  1......................MKDNYQRVIDYMRISITDRCNLRCKYCMPEDIAFLPHDTVMRYEEFLRLTKIFAKQGIRKIKVTGGEPLVRRGCVDFIRNL---KAIDGIDNVTITTNGVLLEQYLYELLDAGIDAINISLDTLKRESYKAITGRDEFDRVWNGIKAAADSGVKVKINCVPIGNVNASEIPAFFELAKNNKIDVRFIEMMPIGHGKEF--EAVSTEDILNELKKRYPGIYEIEKKGNGPAIYYESQEFQGSIGVIGAVHKKFCDSCNRIRLTSEGFLKLCLYYSQGIDLKTPIRNGATDRELEAIIRKAIEEKPREHQFDGKSGNVEEIKNMSQIGG 335
360 2.000e-80UniRef50_A0A239TXM5 GTP 3`,8-cyclase n=5 Tax=Megamonas TaxID=158846 RepID=A0A239TXM5_9FIRM  ali  37  1......................MQDCFNRNIEYLRVSLTAKCNLCCVYCMPENGCVVTK-ETLTLDEFWRLIKLICKTGIKKIRLTGGEPLLYPKLLDLIRRI---KTSTQIEEIALTTNGILLENKIEMLKQAGLDSINLSLDCLDKDLFFKITRGGNINSVLAGIDKACTSGIKLKINSVILKDINETEIIPLVNFAQKNNILLRFIELMPINAAQNYQGVDEV---IILDKLTQFFGKAELILENNSPAHYYNFADLKVPVGFISAMSHKFCAKCNRIRLTSVGFLKPCLHDNRGLDLKSLLKKGTSDEELMQKIKKTIYTKPQCHHLNDVSFAQKETQSMSLIGG 320
361 2.000e-80UniRef50_A0A2E0FLZ7 GTP 3`,8-cyclase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2E0FLZ7_9FLAO  ali  34  8......................LQDSFGRIHDYLRISLIERCNLRCFYCMPEGVSLRPRSEFMRNEEVLELAEQFVGLGVKKIRLTGGEPLIRKGVEDIIEGLAKLP-----VELTLTTNAVRVNEYVHVFKDADIKQLNVSLDSLDRERFRSITRRDYFDQVMNNIELLLMEGFKVKVNAVLMRGENEDEILDFVRWTEQTDIHIRFIEFMPFDGNKWNWEKKVSFQEILDKVTGAYGGVVQLPTEKNATARNFRLLNGKGSFGVISTLTNPFCDSCNRIRLTADGKIKNCLFSNQEVDLLGPLRSGQSVEPL---ILEAIEKKKHARAGIEDFSKGHKNRPMITIGG 331
362 2.000e-80UniRef50_A0A0Q1B2B9 GTP 3`,8-cyclase n=1 Tax=Smithella sp. SDB TaxID=1735324 RepID=A0A0Q1B2B9_9DELT  ali  36  1..............................MNYLRVSITDRCNLHCRYCRPEGISLQGHDDILRYEEIIRVVSVAVKMGLVKVRVTGGEPLVRRGCIDFLSRL---KKIEGLQDISLTTNGILLEEFAQKIFDAGICRINISLDSLNKDKYSYITGGGGIDAVLRGIMRAEEIGFPIKINTVAIKGFNDDEVMDFVRLAADKPFQVRFIELMRPQTNLDYVGDYMPTSQLIDKIKQKYEPIRNKKKRSDGPARIFKIKEGCGEIGFINPVSDHFCSTCNRLRLTSDGNLRACLLNEKEVDLKKALRENCSDEALERLFWEAVLLKPKQHDLICTENALKKCRNMSAIGG 322
363 2.000e-80UniRef50_R6RD13 GTP 3`,8-cyclase n=4 Tax=Firmicutes TaxID=1239 RepID=R6RD13_9FIRM  ali  34  1......................MIDSYGRNINYLRISVTDRCNLRCQYCMPESLPSIDHEEIFRFEEILQICESMGALGIHRFKVTGGEPFVRKGCMDFLRQL---KALPCTEQVTITTNGILLGKFLPELKEIGIDGINISLDTLQPEVFQQITGHTGLESVLENIVKSQEMGIRTKVNTVLLKSINDKEFPDLLHLARDYAVDVRFIEIMPIGFGKNY--EGYSRKKLLPKIAELYPNYQITTKQRNGPANYIKIPGFRGCIGFIDAVHGKFCHQCNRIRLTSDGMLKLCLYYENGLNLKKLLRNGAAPTEIRSAIESAILQKPSEHRFYLSALEEPEHRKMSQIGG 324
364 2.000e-80UniRef50_A0A1F3C2X7 GTP 3`,8-cyclase n=1 Tax=Anaeromyxobacter sp. RBG_16_69_14 TaxID=1797238 RepID=A0A1F3C2X7_9DELT  ali  36  2....................GTLQDAFGRHIHYLRLSVTDRCNFRCVYCLPQGCAKGPESAPLSLEEIERLARGFARLGFWKVRLTGGEPTTRPDIAEITRSISD---IPGIRRVGLTTNGYRLAGIASALCGAGLTSLNVSLDSLDPERFARLTGCSRLESIVAGVEAALAAGIPSKVNVVLLQDLCDRELDQFLAWTRHLPLGIRFIELMQTGENGAFFRQHHLSAEWMRRMLQSRGWGRLAREESDGPAKYYGRSGHVGKVGLIAPYTAGFCETCNRVRVSSTGNLRLCLFGGEEIPLRHLLQSHTQEDDLVRLIESSIEAKPASHRLQQGHCEATTNLA--SIGG 326