current user: public

If you have questions about the server, please let us know.

Query: gi|15604726|ref|NP_219510.1| ribonuclease HIII (CT008) [Chlamydia trachomatis D/UW-3/CX], from C.trachomatis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MPSSFVSQLSPSLFSILREQLEKKGFTISIPPHTVFQGRSPTVSCTVYQSGKIVVQGKGTQEFVEFFLEPEILQTFSSQNVQQDLRSRIGVDESGKGDFFGPLCTAGVYASSPQAIEALYKTSICDSKLIPDAKILSLAQNIRSLCACKVITLFPEKYNALYANFQNLNSLLAWTHATIIDNLAPHPAGAVFAISDQFASSERVLLQAVRKKCSDIELIQRHRAEQDVVVAAASILAREAFLSSIHALESQYQIRLLKGASGKVKQRAKEILHNKGQVVLEKVCKTHFKTFNEVLGSGNQLast
1 -92.500[L] COG1039 Ribonuclease HIII  ali follow..  23  2...NIVLKLETKERQQLAEKYKSY-EQVSKNPYITFFAKVGKTSISVYTSGKVVFQGNEAEKLASDF-------GHIAQVVPQKQTNLIGTDEVGNGSYFGGLMVTASFVSEEN-LNFLKEIGVADSKKLTDEKICQIAPKLIDRIPHVALVVEPAKYNEVIASGYNAVSIKVALHNQAIYLLEKQGHKPENIVIDAFTTEANYKKYVNKEHPLTKVTLLTKAEDQFLAVAVSSIISRYLFLENLKKLSKESGFTLPSGAGNLSDKIAAQIIKSQGVDALNQLAKLHFANTQKAIKIAQ. 291
2 -58.700[L] KOG2299 Ribonuclease HI  ali follow..  17  3...................................................................LKCETERSKTWNNFGNGIPCVLGIDEAGRGPVLGPMVYAAAISPLDQN-VELKNLGVDDSKALNEAKREEIFNKMNEIIAYALRCLSPELISCLKRQKYSLNEVSHEAAITLIRDALACNVNVVEIKVDTVGPKATYQAKLEKLFPGISICVTEKADSLFPIVSAASIAAKVTRDSRLRNWQFREKPDAGYGSGYPGDPNTKKFLQLSPVFGFCSLVRSSWKTASTIVEKRC. 247
3 -53.500[L] COG0164 Ribonuclease HII  ali follow..  22  1...........................................................................MSETFIYPQANLIAGVDEVGRGPLVGAVVTAAVILDPNRPIV-----GLADSKKLSEKRRLSLYDEITEALSWSLGRAEPEEIDQL-----NILHATMLAMQRAVSGLHIV---PDYVLIDGNRCPKL----------QMPSLAVVKGDSRVAEISAASILAKVTRDREMTELDPEYGFAQHKGYPTA---FHLEKLAALGATVHH---RRSFGPVKRVLG.... 196
4 -7.890[S] COG2410 Uncharacterized conserved protein  ali follow..  10  2.......................................................................................YCGIDVGLKKCHAALISDRLEFVGDYTELDLVRVTGIDAPLSFPAKGSLRECERLLLKMGIRLFPSGAPFFRGIALRGMEIAEELRSKGVEVYEVYPYATRVILNIAPKAKKHTKSGLEEIRAELSRWVEIPELSHDEVDAVIAA--LTVKLFSEGMGVKLEGIDGS.............................................. 168
5 -6.380[K] COG2101 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali follow..  1MSEREKITIEN-DLSRIALALDGSEYEPEQFPGLIYRLQDPKTAVLIFRSGKVNCTGAKNIEDVKRTIKIIIDKLKAANIEVYDDPDI---------------IVAVYDLESELNLTDIAMSLGLENVEYEPEQFPGLVYRVEEP-RVVLLLFGSGKVVCTGAKEESEIEQAVIKVKKELQKV..................................................................................................................... 181
6 -5.920[L] COG0389 Nucleotidyltransferase/DNA polymerase involved in DNA repair  ali follow..  14  25..................................................................................RDIPIAIGGSRERRG-----VISTANY--------PARKFGVRSAMPTGMALKL--------------LTLLPGRFDAYKEASNHIREIFSR-YTSRIEPL-----SLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDAEVPAFLQTLPLAKIPGVG----KVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGR 220
7 -5.900[K] KOG3302 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali follow..  14  39............DLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAAR....................................................................................................................................................................................................................................... 95
8 -5.860[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  11  25.......................................................................................FLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIK--GHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFL---------ILGNKIDIPYAASEDELRYHLGLTNFTTGKGGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN............................................... 193
9 -5.510[R] COG3911 Predicted ATPase  ali follow..  14  11.......................................................................................LTGGPGSGKTTLIAALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIDEERKQTPDEAKCTYHALAE---IYTELGYELVPLPLAPVETRLRFVLADAGLN................................................... 183
10 -5.430[I] KOG1176 Acyl-CoA synthetase  ali follow..  16  302MINKADQIMKKYDVSFLRTVRCG-GAPLSKEVTQGFMKKYPTVDVYLTESNGAGASIESVEESRRYGAVGLLSCGVEARIVDPNTGQVMGLNQTGELWLKGPSIAKGYFRNEEEIITSEGWLKTGDLCYIDNDGFLFIVDRLKELIKYKGYQVPPAELEALLLNHPDILDAAV............................................................................................................................... 477

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.