current user: public

If you have questions about the server, please let us know.

Query: gi|15604726|ref|NP_219510.1| ribonuclease HIII (CT008) [Chlamydia trachomatis D/UW-3/CX], from C.trachomatis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MPSSFVSQLSPSLFSILREQLEKKGFTISIPPHTVFQGRSPTVSCTVYQSGKIVVQGKGTQEFVEFFLEPEILQTFSSQNVQQDLRSRIGVDESGKGDFFGPLCTAGVYASSPQAIEALYKTSICDSKLIPDAKILSLAQNIRSLCACKVITLFPEKYNALYANFQNLNSLLAWTHATIIDNLAPHPAGAVFAISDQFASSERVLLQAVRKKCSDIELIQRHRAEQDVVVAAASILAREAFLSSIHALESQYQIRLLKGASGKVKQRAKEILHNKGQVVLEKVCKTHFKTFNEVLGSGNQLast
1 -96.2002d0a_A mol:protein length:310 ribonuclease HIII  ali model follow..  26  1.MSNYVIQADQQLLDALRAHYEG-ALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPH-IAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAPAEPEAIIIDEFLKRDSYFRYLSDEDRRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKR 308
2 -85.2003vn5_A mol:protein length:257 Ribonuclease HIII  ali model follow..  27  2....PSLKISPSEAEKIQNYLVSSGFRKINAPYTLWALEGNGVKVYYYKTGSLLIQGKNSEKVLKEVLN------------LLEKKKLPGCDESGKGDIFGSLVLCCVCIPEEN-YLKVSSLNPRDTKRLSDKRVERLYLALKPLVKAYCYEIKPEEYNKLYRKFRNLNKMMTHFYKLLIERVKEE-CGVSEVVVDKYQPSNPFGED----------VIFETEAERNLAVAVASIFARYKFLQSLKEVERELGIKIPKGTSKEVKELAKSLKN------PERFIKLNFNV.......... 257
3 -76.3004py5_A mol:protein length:271 Ribonuclease  ali model follow..  31  1.....SMKLSSSEKEKLLKKLKALGAKEEKPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELVAE---------TVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKC-LKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEK-FSPKVVVVDKFSNR---AEEVLKDVVKGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTG-----LAELLKKTPKELHEKLFKLHFSVGGK....... 270
4 -67.5001eke_A mol:protein length:230 RIBONUCLEASE HII  ali model follow..  21  3.......................................................................................IIGIDEAGRGPVLGPMVVCAFAIEKER-EEELKKLGVKDSKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNS-INLNDIEINAFSKVAKNLIEKRDDEIEIYIDACSTNTKKFEDIKERNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYG---DIGSGYPSDPKTIKFLEDYKHKKLPDIARTHWKTCKRILDKSKQ 224
5 -65.8001i39_A mol:protein length:225 RIBONUCLEASE HII  ali model follow..  25  1........................................................................MGSSSSGLVPRGSHMKAGIDEAGKGCVIGPLVVAGVACSDE---DRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAA-KTINEILKECYAEIILRL-----KPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFG---DFGSGYASDPRTREVLKEWASGRIPSCVRMRWKTVSNLRQKT.. 215
6 -63.3003p83_D mol:protein length:217 Ribonuclease HII  ali model follow..  25  9..................................................................................PGRLMKAGIDEAGKGCVIGPLVVAGVACSDE---DRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAA-KTINEILKECYAEIILRL-----KPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFG---DFGSGYASDPRTREVLKEWASGRIPSCVRMRWKTVSNLRQKT.. 213
7 -63.1002dfe_A mol:protein length:209 Ribonuclease HII  ali model follow..  19  3.......................................................................................IAGIDEAGRGPVIGPMVIAAVVVDENS-LPKLEELKVRDSKKLTPKRREKLFNEILGLDDYVILELPPDVIGS---REGTLNEFEVENFAKALNSLKVK---PDVIYADAADVDEERFARELGERFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYYREEFPPIVRKGWKTTQDMINKST. 209
8 -63.0002dff_A mol:protein length:213 Ribonuclease HII  ali model follow..  19  3.......................................................................................IAGIDEAGRGPVIGPMVIAAVVVDENS-LPKLEELKVRDSKKLTPKRREKLFNEILGLDDYVILELPPDVIGS---REGTLNEFEVENFAKALNSLKVK---PDVIYADAADVDEERFARELGERFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYYREEFPPIVRKGWKTLKKITQDMIN 210
9 -62.9001x1p_A mol:protein length:212 Ribonuclease HII  ali model follow..  18  3.......................................................................................IAGIDEAGRGPVIGPMVIAAVVVDENS-LPKLEELKVRDSKKLTPKRREKLFNEILGLDDYVILELPPDVIGS---REGTLNEFEVENFAKALNSLKVK---PDVIYADAADVDEERFARELGERFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYYREEFPPIVRKGAGAIIGLAVG... 207
10 -62.7001uax_A mol:protein length:220 Ribonuclease HII  ali model follow..  18  3.......................................................................................VAGVDEAGRGPVIGPLVIGVAVIDEKN-IERLRDIGVKDSKQLTPGQREKLFSKLIDLDDYYVLLVTPKEIDERHH---SMNELEAEKFVVALNSLRIK---PQKIYVDSADVDPKRFASLIKAGLEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYG---EFGSGYPSDPRTKEWLEEYYKQDFPPIVRRTWETARKIEERFRK 210
11 -61.2002dfh_A mol:protein length:221 Ribonuclease HII  ali model follow..  19  3.......................................................................................IAGIDEAGRGPVIGPMVIAAVVVDENS-LPKLEELKVRDSKKLTPKRREKLFNEILGLDDYVILELPPDVIGS---REGTLNEFEVENFAKALNSLKVK---PDVIYADAADVDEERFARELGERFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYYREEFPPIVRKGWKTLKKIAEKVES 210
12 -58.7003puf_A mol:protein length:302 Ribonuclease H2 subunit A  ali model follow..  17  7.............................................................SELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPR-LADLEALKVADSKTLLESERERLFAKMEDTVGWALDVLSPNLISTLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEDLDTDYGSGYPNDPKTKAWLKEHPVFGFPQFVRFSWRTAQTILEKEAE 253
13 -58.4003kio_A mol:protein length:301 Ribonuclease H2 subunit A  ali model follow..  17  4.............................................................SELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSR-LADLEALKVADSKTLTENERERLFAKMEEDVGWALDVLSPNLISTLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVEDLDSDYGSGYPNDPKTKAWLRKHPVFGFPQFVRFSWSTAQAILEKEAE 251
14 -50.9005y9p_A mol:protein length:266 Ribonuclease HII  ali model follow..  16  1......MGSMTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTYFE-----NEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYL-----GLDDSKKVPVTKRLELNEALKNVTAFAYGIATAEEIDEF-----NIYKATQIAMQRAIDGLSVQ---PTHLLIDAMTLDNAL-----------PQVSLIKGDARSVSIAAASIMAKVFRDDYMTQLSPEYGFEKNAGYGTK---QHLLAIDDIGIMKEH---RKSFEPIKSLLLE... 260
15 -48.6002etj_A mol:protein length:250 Ribonuclease HII  ali model follow..  19  2.....................................................................GSDKIMGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIE-------GINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLY-----NIFNATKLAMNRALENLSVK---PSFVLVDGKGIELSV-----------PGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHPQFSFHKHKGYATK---EHLNEIRKNGVLPIH---RLSFEPVLELLTDDL. 202

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.