current user: public

If you have questions about the server, please let us know.

Query: gi|15604726|ref|NP_219510.1| ribonuclease HIII (CT008) [Chlamydia trachomatis D/UW-3/CX], from C.trachomatis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# E-value Template Links and tools%idFirst MPSSFVSQLSPSLFSILREQLEKKGFTISIPPHTVFQGRSPTVSCTVYQSGKIVVQGKGTQEFVEFFLEPEILQTFSSQNVQQDLRSRIGVDESGKGDFFGPLCTAGVYASSPQAIEALYKTSICDSKLIPDAKILSLAQNIRSLCACKVITLFPEKYNALYANFQNLNSLLAWTHATIIDNLAPHPAGAVFAISDQFASSERVLLQAVRKKCSDIELIQRHRAEQDVVVAAASILAREAFLSSIHALESQYQIRLLKGASGKVKQRAKEILHNKGQVVLEKVCKTHFKTFNEVLGSGNQLast
1 5.000e-88UniRef50_Q65GD8 Ribonuclease HIII n=308 Tax=Terrabacteria group TaxID=1783272 RepID=RNH3_BACLD  ali  26  1.MSHSVLKVPPSVIERMQSHY-GPDITSLSVQGAVFQAKPQGCTITAYRSGKVLFQGKNAEKEAERWTADAETPAPKKPASKKSIPSVIGSDEVGTGDYFGPITVACVYADKAK-LPLLKELGVKDSKNLKDPQIVQIARDLIKTVPYSLLVLRNEKYNEMQEKGMSQGKMKALLHNQAIGNLLKKGTRPEAILIDQFAEPAVYFKHLAGKTAVKERTYFSTKAEIHLSVAAASIIARYSFLMEMDKLSKQAGITLPKGAGPLVDEAGAKLIKKHGEDALRVFTKLHFANTQKAKRIASK 312
2 8.000e-84UniRef50_P94541 Ribonuclease HIII n=1168 Tax=Terrabacteria group TaxID=1783272 RepID=RNH3_BACSU  ali  26  1.MSHSVIKVSLSAIDQMKMTY-SGSLTASVPQGAVFQAKPPGCTITAYQSGKVLFQGKNAAAESARWGTAEPQEKKKTAKKPADPRYVIGSDEVGTGDYFGPMTVVCAYVDK-TMLPLMKELGVKDSKDLKDPQIIEIARNLIKTIPYSLLVLKNEKYNSMQEKGMSQGKMKALLHNQAITHLLRKGVKPEAILIDQFAEPGVYFNHLKGRDIVKERTYFSTKAEIHLAVAAASIIARYSFLMEMDKLSRAAGMTLPKGAGPHVDEAAAKLILKKGASALRTFTKLHFANTQKALADKK. 311
3 1.000e-83UniRef50_A0A1H0RAG5 Ribonuclease HII n=10 Tax=Firmicutes TaxID=1239 RepID=A0A1H0RAG5_9BACI  ali  15  2..........NKTIKQIADELLMVNDENDSLIHEYKKDPRKGVQQLIAKWEKA------QQEIQRERTRFQEMSQYEQNLYNKGISYIAGIDEVGRGPLAGPVVAAAVILPKNFFLP-----GLDDSKKISEQKREELFQQITQAVTFGIGIIDAKKIDEVNIY-----QATKLAMKQAILKLSIKP---EHLLIDA-----------MEIQVDIPQTSIIKGDSKSYSIAAGSIIAKVTRDRLMRRVYPQYGFEKHMGYGT---GMHFNALNTFGVTEYH---RRSYSPVQQLLEGREK 259
4 2.000e-83UniRef50_Q9Z6J1 Ribonuclease HIII n=55 Tax=Bacteria TaxID=2 RepID=RNH3_CHLPN  ali  62  1MPPPFVVTLTTSAQNNLRDQLKEKNFIFSQPQNTVFQARSNTVTCTLYPSGKLVIQGKGSEEFIEFFLEPEILHTFTHARVEQDLRPRLGVDESGKGDFFGPLCIAAVYASNAEILKKLYENKVQDSKNLKDTKIASLARIIRSLCVCDVIILYPEKYNELYGKFQNLNTLLAWAHATVINNLAPKPAGDVFAISDQFAASEYTLLKALQKKETDITLIQKPRAEQDVVVAAASILARDAFVQSIQKLEEQYQVQLPKGAGFNVKAAGREIAKQRGKELLAKISKTHFKTFDEI...... 294
5 9.000e-83UniRef50_A0A2N2AJV7 Ribonuclease HII n=4 Tax=Bacteria TaxID=2 RepID=A0A2N2AJV7_9FIRM  ali  20  1........MNEMTVNEIREFIKKCGSSLREEEKTILSHDPREGVRKLYQ------QCCRLESLNKERLRLKHLRIYEDDANRQGFNHIAGVDEAGRGPLAGPVVAAAVIMPKELDI-----TGIDDSKKLSPAKREKLSREIKEALCWSVGISSVQEIDSLNILR-----ASLLAMQRAVTTLR---IVPDYILVDAVTIPGL----------GTLQLPIIKGDGKSVSIAAASIIAKVTRDKMMETIFPYYGFARHKGYGT---ADHLDALKKHGLCPLH---RKTF............ 250
6 9.000e-83UniRef50_A0A1I5WQ21 Ribonuclease HII n=24 Tax=Bacteria TaxID=2 RepID=A0A1I5WQ21_9LACT  ali  17  10.............ITEVKNILQTI-VDPHDERLKEFRLDARKGVIAAVRSW-----DKKAEKQQLAQEKLQEMLAYERRAWAHGKEFIAGVDEVGRGPLAGPVVSAAVIFPEDFNI-----VGINDSKQLSLAKRNELFDIIQEALAVGVGIKDAAVIDQVNIY-----EASKLAMLEAIEQM---PIQPDHLLVDAMTLP-----------LPISQESIIKGDAKSVSIAAASIIAKVTRDRMMEEMYPGYGFPNNAGYGTK---EHLTALEDLGVTPIH---RRSFAPVREAL..... 259
7 1.000e-82UniRef50_B0P7L0 Ribonuclease HII n=49 Tax=root TaxID=1 RepID=B0P7L0_9FIRM  ali  22  2.......................................................................NMYEFEQAARREGYAAVCGVDEAGRGPLAGDVYAAAVILPPG-----LELAGVNDSKKLSEKRREALYGVITEAAAWCVASASVEEIERLNIL-----QASLLAMRRAVEGL---GVRADFALVDGNRDPH---------FEGVPCKTIVGGDGKSASVAAASILAKVTRDRYMEQLYPQYGFERHKGYGT---QAHREALLKYGPCPAHR.................. 191
8 2.000e-82UniRef50_U2QU86 Ribonuclease HIII n=15 Tax=Bacteria TaxID=2 RepID=U2QU86_9FIRM  ali  29  1.MNTITKIMSKKQIEQLKKQIDPYVLKVSQPAYTYYQAKLESCTITAYTSGKVVFQGKDLNW-----------LSQESSSESKNMFPQAGSDEVGTGDYFGPVVVSAVIVSK-ENEDVLRNLKIQDSKQINDEKIRMLAKEIKSLCPHTILIVSSSKYNSVH-KQHNMVDIKCKLHNQAYLNLIKKGYTPEHIIIDQFVQEKSYYRYLSNEKEVVRNIHFETKAEKYLAVACASVLARNAFLEYWDMLEETFDFTFEKGAGKKVDQCGKKFVLKYGMDKLNEVAKIHFKNTEKILDLINK 288
9 6.000e-82UniRef50_D4W797 Ribonuclease HIII n=7 Tax=Turicibacter TaxID=191303 RepID=D4W797_9FIRM  ali  27  1MASTITLTVSQQILEKMYQYYEKQII--KIPNHTLFQAKTTSCTITAYLSKKVVFQGVNPEIEANKWQKASPTSTTPKKSTLNEKSTLIGCDEVGTGDYFGPIVVCCASVEKDQ-IAFLQEMGIKDSKALKDPEICQLAHQIETMIPHQCLVLPNEKYNLMVEKGMNANSIKAYLHNQALLKLTTSPSLPDFIIMDEFVNEAKYYDYLKKLPKQPTIISIQKGESVHVAVAAASILARASFVKYMQIMSKKYQFELPKGAGAPVDIAGRKFVKLHGKETLQSLTKWHFANTNKILK.... 308
10 9.000e-82UniRef50_Q6MDE6 Ribonuclease HIII n=30 Tax=root TaxID=1 RepID=RNH3_PARUW  ali  46  7....FVTTLDLKLAEKLLKDLQQQGFSITIPAYTRFSASKKGLTCTLYTSGKLVVQGKEQAHFIEFYLEPEILESFSHPTTKIDLTPHIGIDESGKGDFFGPLCIAGVYIQANQFSK-LQALGVKDSKTLSDKTIRQLASQIKNLCLYHIVKINPAKYNEIYQDFKNLNHLLAWGHATTIEQLILQ-SGCQTVIVDQFADEKVVLLALKRKKLDV-NLTQRHRAEDDLAVAAASILARQAFIDGLEQLSKEIQIPLPKGSSSATQKAGKEVLRKWGEERLRSICKQHFKTLDAILGKVGK 301
11 1.000e-81UniRef50_D6XSW0 Ribonuclease HIII n=17 Tax=Bacillales TaxID=1385 RepID=D6XSW0_BACIE  ali  27  1.MSHSVIKLSKDALQNMKRHYTDYH-KPKTPQGALFAAQVNGTSITAYNSGKVLFQGKNAEAEAAKWGSGEDKAPKKKKPDNLLNRELIGSDETGTGDFFGPMTVVACHLTKEQ-LKTVESWGIRDSKTITDKLIRTLAPRLLDTCTYSLMTLHNNKYNALQQDGMNQGQMKAMLHHQAISNVIAKGTEADGVLIDQFCPPGTYFRYLKQGKLETPLYFATKAEQLHPAVAAASILARYAFIEEMDRIEEKLGMPVPKGAGKAVDQAAQAIADRHGTDTLKAVTKWHFANATKI...... 309
12 2.000e-81UniRef50_A0A268K602 Ribonuclease HIII n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A268K602_9BACI  ali  28  1.MGNVVLNLNMSEINKMKSYY-DGNLLDKAPPGSVFAAKTSGSTITAYKSGKVLFQGSGCETEASRWKSTAPTKTSPKGNVPSGISSVIGSDEVGTGDFFGPITVVAAYV-RKEDIPLLKELGVRDSKDLNDDKIIAIAKVIKDVVPFSLMTLKNEKYNQLQQTGMSQGKMKAILHNQAILNVLEKPVKPEAILIDQFVQGSTYFQHVKNQKGVAKENVSTKAEGIHLAVAAASILARYAFVQYIDKLSDSAGFKIPKGAGAQVDEAAAKLILKKGREVLPQFVKLHFANTDKAMNLVNK 309
13 2.000e-81UniRef50_A0A2H9SWQ5 Ribonuclease HII n=14 Tax=Bacteria TaxID=2 RepID=A0A2H9SWQ5_9BACT  ali  20  44..............................................................EEIERKKLRQMATYEKEARKQGYELVAGIDEAGRGPLAGPVVAAACILPTRFSI-----LGIDDSKKLTPEKRAQLFQKITSHVIYGVGIVSVEVIDEINIL-----QATIQAMLNAVNCLKNQPH---LLLVDGLQLPHA----------SIPCQKIIGGDALSLCIAAASIIAKETRDRLMIELWPQYGFAIHKGYGTP---KHVEALTEFGPCPLH---RKSFAPVKSLLK.... 253
14 2.000e-81UniRef50_A0A2F0ASZ9 Ribonuclease n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2F0ASZ9_9DELT  ali  34  1MASSFTIKLPKEDQASTGEFFRSHGFQMTEAEHAFWLALGPAVRVTFYRSGKLLIQGKEADVWRGLLAEITASAKPFQQALSRHPKHWAGSDEAGKGDYFGPLVVAGVALERSQ-LELLLEIGVDDSKTISDERILQMDRPLRHICRSDVLMIGPAKYNELYQRIGNLNTLLAWAHAKVIETLLESNGAVEWVLIDRFA-PERTMQRALSRIDGLPQVDQWPKAESDPAVGAASILARAAFLRGMKALSKRYGLGLPLGAGEKTLTAGHEFVQRHGRQQLHHVAKIHFSNTNKL...... 297
15 3.000e-81UniRef50_A0A1G0YBD4 Ribonuclease HIII n=10 Tax=PVC group TaxID=1783257 RepID=A0A1G0YBD4_9BACT  ali  42  9.TTSYVCETTPEKAEQLRAYLEESGWKLDPPPYARWKGAKDKISIVAYNSGKLTVQGRGTGEFVTFFLEPEILKEYEKLEKTEEFTPHAGVDESGKGDFFGPLVIAAVYVDEATRPKLLK-MGVRDSKKIKDRKILQLAFQIRKTVAFATVAIGPDAYNRLYQKIGNLNRLLAWGHARAIENLLDKEPTCKWALSDKFG-NEHLIRDALLEKGRKIDLRQRTKAESDIAVAAASILARDEFVRKIAAMGRELGIAIPKGAGANVDEAAKKFLEKYGKEKLASVAKMHFKTASKALG.... 317
16 3.000e-81UniRef50_A0A2V6BYK2 Ribonuclease HII n=3 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6BYK2_9BACT  ali  18  54.........................................................................FEFERALLRRGVKFVAGVDEAGRGPLAGPVVAAAVTLPLEWIQKGLEFDGLNDSKQLTAAKREKLFAAFTNALQFAIARIDAETIDTINIL-----QATHEAMNRALARLQPAP---DHVLVDGLRVNSLRF----------PQTALVKGDARSFSIAAASILAKVTRDRLMDRRFPAYGFALHKGYGT---ARHLAALQQHGPCPIH---RRSFAPLK........ 255
17 3.000e-81UniRef50_A0A0N1K477 Ribonuclease HII n=24 Tax=Bacteria TaxID=2 RepID=A0A0N1K477_THEVU  ali  17  2..........KRTIPEIKAWLQAVDTLSPEELQELLTDDRVGVR-------KLAESYQREQRKQKERERVAKMWQYEQECWSKGLTLVAGVDEAGRGPLAGPVVAAAVILPPTFD-----ATGLNDSKQLSEEMRTVLKQRIQEALAVGVGIVDAAHIDK-----YNILQATYHAMRIALSQLTPTP---QAILADAVKIPDV----------DIPQQGIIKGDSLSHSIAAASIIAKTTRDEWMKQKYPAYGFDQHMGYGTP---EHLEALRRFGPTPLH---RRSFAPVREVIENSG. 259
18 4.000e-81UniRef50_Q9HXY9 Ribonuclease HII n=322 Tax=root TaxID=1 RepID=RNH2_PSEAE  ali  23  11....................................................................................EDLVAGVDEVGRGPLCGPVVTAAVILDPSRPI-----LGLNDSKKLSEARREALFEEIREALAWCIARAEVEEIDRLNILH-----ATMLAMQRAVEGLS---VIPRLALIDGNRCPKL----------AVPCAPVVKGDSQVPAIAAASILAKVSRDREMVELYPGYGMAGHKGYPTAV---HLEALSRLGPTPIH---RRSFAPVRELLD.... 197
19 8.000e-81UniRef50_A0A223KTV1 Ribonuclease HIII n=26 Tax=Bacilli TaxID=91061 RepID=A0A223KTV1_9BACI  ali  26  1.MSNQVLIVDKNTMKKMQAYYEPSS-TGKIPPGGVFAAKTSGCSITGYKSGKVLFQGRDASNEAGKWGSKSTTSVKKKTSLPSNFANVIGSDEVGTGDFFGPITVCAAYV-RQEDMDILKHAGVKDSKALTDEKIIEIAREIIPFVPYSLLVLHNEKYNKMQQTGMTQGKMKALLHNKALENVLNKPEKPDAILIDQFAEENVYYRHLTGQKTIVKENVQTKAEGLHLSVAAASIIARYAFLKEMDKLSEVAQLTIPKGAGAIVDQAAAKVIKKHGEGMLWQLAKVHFANSEKAKRLARK 311
20 8.000e-81UniRef50_A0A2A4YMS7 Ribonuclease HIII n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4YMS7_9BACT  ali  44  6.TKCFVTTINLSLASKLKGDLEEQGFELKKPVYTVFQAKKKGVSLTLYESGKLMVQGKNKHEFITYYLEPEILQDLAYSYPEKNVEMHIGVDEAGKGDYFGPLCIGGLYVNGEEDITKLLKMGVKDSKRINDDKILKLAKEIKKSFKYSVVRIFPKRYNEMYNTFHNLNQMLAWGHASAIEKLVED-TGCSSAIIDQFAS-EHVVEKALSRKSVEINLVQRHKGEEDPVVAGASILARASFVEGLDELKEQFALKLPKGASAQVIDAAKIAVIKHGETILQDVAKLHFKTTEQVL..... 299
21 8.000e-81UniRef50_F6ACD4 Ribonuclease HII n=58 Tax=Bacteria TaxID=2 RepID=F6ACD4_PSEF1  ali  24  11....................................................................................EELVAGVDEVGRGPLCGAVVTAAVILDPARPI-----LGLNDSKKLTEARREKLFDEIREALAWCIARAEVEEIDRLNILH-----ATMLAMQRAIEGLS---VQPKLALIDGNRCPKL----------SVPSAPVVGGDAQVPAIAAASILAKVSRDREMRELYPGYGIALHKGYPTPV---HLEALTRLGPTPIH---RRSFAPVRRLLE.... 197
22 2.000e-80UniRef50_D6TME8 Ribonuclease HII n=7 Tax=Chloroflexi TaxID=200795 RepID=D6TME8_9CHLR  ali  20  1...............................................................MQKTKKSSPTLTEEMALFEQGYCFIAGLDEAGRGCLAGPVVAAAVILPESNPTPVLRFTGVNDSKQLNEATRERLYDVIMEHAAVGVGIGSVELIDQRNIL-----QATLQSMRVALTQLTP---TAQALLLDAVRL----------RDIPLPQLSLTKGDSRCLSIAAASIIAKVTRDRLMHQLHPRYGFKQHKGYGTP---EHLEALKQFGVTPHH---RRSFSPIREML..... 214
23 2.000e-80UniRef50_K0J753 Ribonuclease HIII n=26 Tax=Bacilli TaxID=91061 RepID=K0J753_AMPXN  ali  28  1.MGHVVKIVSEQTINKMKEYYQSSL--KQTPPHALFSAKVNQTTITAYKSGKVLFQGGNSEQEASRWDGKEATKKKSNSEAAQTHHYIIGSDEAGTGDYFGPITVAAAYVRSDQ-IELLRELGVRDSKNLTDQSIEKIAQDILLEIPYSSMVLPNPKYNQLQARGWTQGKMKTMMHDAVINSLLKKPTKPDGILIDQFSEPGVYINHLKKENKQLPEYFITKAESHSIAVATASILARARFVQEMDRLSKNVGFTLPKGASAKVDQAASYIIRDKGEAFLQNIAKVHFANTNKA...... 305
24 7.000e-80UniRef50_A0A179EUS0 Ribonuclease HIII n=6 Tax=Bacilli TaxID=91061 RepID=A0A179EUS0_ENTTH  ali  24  1.MSNVIIKVSESKMNEMKAAYQANLLQ-KKIPYTNFSAKKNGTTITAYTSGKVMFQGANAEQEARRWGNAAATTTASKPKIPASLPNVLGSDEVGNGSYFGPVTVCAAYVDR-EHLKTLKNLGVRDSKELKDAQIIQLSQVLKETIPYQLLVLTPKKYNEIQPE-YNAVRMKVALHNQAIHLLLQKPTKPEAILIDQFTPEANFKKYARLEKNKIQEKFVTKGEQYHLAVAAASIISRASFLEELDKASAELGITLPSGAGTKSDTVAATILKKGGLPLLANYAKLHFANTQKA...... 300
25 1.000e-79UniRef50_A0A1I2R643 Ribonuclease HII n=3 Tax=Bacteria TaxID=2 RepID=A0A1I2R643_9BACL  ali  20  61.........................................................................WQTERTYWAKGYGAVAGLDEAGRGCLAGPVVAAAVILPEDFDVS-----GLNDSKQLSPAEREELRGRIREATAVGIGMADVEYIDAHNIL-----QATYEAMRRAVSNL---PAPPDALLVDALTVPGL----------AIPQQAIIKGDSLSHSIAAASIVAKTERDRWMEARYPEYGFDRNKGYATP---DHLAALDRWGPCPLH---RRSFAPVRERL..... 257
26 1.000e-79UniRef50_U2FLQ0 Ribonuclease HIII n=1 Tax=Haloplasma contractile SSD-17B TaxID=1033810 RepID=U2FLQ0_9BACT  ali  24  1.MASVTIIVTKQVLDKMKDFYKDYYVENK-NQYAQFIAKVDNCTVTAYTSNKVLFQGKNAKYESTIWEAFLEQESTPKTNNKKFYLPSIGSDEVGTGDYFGPVVVVAAYIDESVQ-PLLKKHQVGDSKKLDDTLIKKIAPSLFNAIPYSLSVVNNEIYNREMSKRMNLNKLKAMVHQHAIKNLIKKPVKPSNIIIDQFCSKKKFIDYTGDHDFVNYATFETKAEDKFASVACASIMARYIFLEEMEKLSKEYKVTVQKGASKLVDSQGIELVKKHGKQVLNKIAKYHFKNTDRILNTINE 311
27 1.000e-79UniRef50_D0BL55 Ribonuclease HIII n=6 Tax=Lactobacillales TaxID=186826 RepID=D0BL55_9LACT  ali  28  1.MATTVLLLDEHTIQQLGEIYQDA--IHQIPPHAHYQLKLPSLTVTAYHSGKVVLQGTNVDAFVQKASTSTKKSKVETNGLPEGFSNVIGSDEVGTGSYFGPLTVACAFVPEN-LIKELQILGVKDSKILTDSQIQEIVPKIKELVPYKLLTLWPEKYNEVQ-QTKNLNEMKALLHNQAIKRLYQQIDLLQAVLIDEFCSPSNYYRYLGDQSAPLKAITKTKGESHHIAVAAASMIARDAFLEGLKTLSKEYGYPLLSGANASVDELASKILKQEGMDGLRKVAKLHFANTQKAIDLTK. 304
28 2.000e-79UniRef50_Q9Z9S0 Ribonuclease HII n=250 Tax=Terrabacteria group TaxID=1783272 RepID=RNH2_BACHD  ali  15  7.............IKEIDALLRQGDASIDETFLAMLKADERKGVQSAYE--------RQLEKEKALWMEHEEMLAYEKDLWAKGYEHVAGLDEVGRGPLAGPVVTAAVILPKDVQLP-----GLTDSKKLAKETRESFYDRIKEALAWSVAIVPVTVIDEVNIY-----QATKQGMMSAIDQLS---VNPDALLLDAMNLP-----------LSLPQQSLIKGDQKSLSIAASSVLAKVTRDRYMADLYPEYGFERHVGYGT---EEHLAALNAHGITPEH---RRSFRPVQE....... 255
29 2.000e-79UniRef50_UPI0007815249 ribonuclease HIII n=1 Tax=Massilibacterium senegalense TaxID=1632858 RepID=UPI0007815249  ali  27  1.MTNIVKIVSEKELHTIMEYYEKQGLLAKLPPGALFSAKVNNVTITGYRSKKVMFQGQYATQEANKFQFQDAPVTKAKKQVKKQKHSVIGSDEVGTGDYFGPFIVASAFCASDK-LPYLASLGVKDSKQLSDDTIIKLARTLTKEIPYSLLVVPNEKYNALHEKGMNQVKLKAILHNQALTREKIKPQSYDAILIDQFVKKETYFSYINKETHQVKERVATKGESRHLAVACASIIARAAFLQRMDQLSKQLGITLPKGAGKNVDQVASHIIRTHGEKTLRQYAKIHFANTEKAK..... 307
30 2.000e-79UniRef50_C1DST2 Ribonuclease HII n=13 Tax=root TaxID=1 RepID=RNH2_AZOVD  ali  24  13......................................................................................LVAGVDEVGRGPLCGAVVTAAVILDPERPI-----LGLNDSKKLSEARREALSEEIREALAWCIARAEVEEIDRLNILH-----ATMLAMRRAVEGLA---VTPRLALIDGNRCPKL----------AVPCAPVIKGDAQVPAIAAASILAKVARDREMDALYPGYGLARHKGYPTAV---HLEALARLGPTPIH---RRSFAPVRELLD.... 197
31 3.000e-79UniRef50_A0A1F6RRW8 Ribonuclease HIII n=6 Tax=root TaxID=1 RepID=A0A1F6RRW8_9BACT  ali  39  9....YSSKYDINKESELKNKLSADGFIFKSIDHAFWSAQKNGITVTLYKSGKILAQGKNTEEFVEQFLENSNQRQTKLEIPKPKIDCWIGTDESGKGDYFGPLVVAGVLVDQ-ENIKKFQEINVRDCKKINDVSIEKLAWQIKANSIFSVVTINPNKYNQLYAKFNNLNNLLAWGHARAIENILEKK-ECKNAISDKFG-NESLIKNALMTHGKTINLEQRHKAEDDIAVAAASILARNEFLQRMKKMSQEYGINFQKGASEKVKEQARLFIEKYGFESLSQIAKMHFKTTLELKK.... 308
32 3.000e-79UniRef50_A7VUX2 Multifunctional fusion protein n=4 Tax=Clostridiales TaxID=186802 RepID=A7VUX2_9FIRM  ali  21  6...........................................................................YEKEAISKGYANVCGVDEAGRGPLAGPVYAAAVILPPG-----LEIEGVNDSKKLTEKKREALFPEIKEALAYCIASASEKEIDKLNIL-----NATYLAMARAVEGL---PVKADYALIDGNRMP----------RLPIPGETIVKGDGLSMSIACASILAKVTRDHVMMEWYPQYQFAKHKGYGTK---LHMDLIRRYGPCELH---RQSF--LKKILG.... 199
33 3.000e-79UniRef50_R3TL97 Ribonuclease HIII n=11 Tax=Enterococcaceae TaxID=81852 RepID=R3TL97_9ENTE  ali  24  1.MNTVVIKVSSAIMNKMKESYKN-SLINKKVPYSEFLAKKGDTTITAYTSGKVMFQGKNAQKEAALWKKKTVENTVNSSILPENFSSVLGSDEVGNGSYFGPVTVCAAYAGK-EHLSELKALGVKDSKALTDRQIRQMSEKIKELIPYQLLIVTPEKYNEIQ-PAYNAVRMKVALHNQAIALLLEKPVKPEAILIDQFTPEGNYKKYVAMEKTKVKIFFVTKGEQYHLAVAAASIISRASFLEELDKASAALGMTLPSGAGTKSDKVAAAILKKGGLPLLGKYAKLHFANTEKAKK.... 304
34 3.000e-79UniRef50_F0SUD6 Ribonuclease HII n=6 Tax=Peptococcaceae TaxID=186807 RepID=F0SUD6_SYNGF  ali  19  8..........................................................QREESKLEALFKEELLYLERKLVKEGFMFVAGVDEAGRGPLAGPVIAAACILPESFDLPYL-----NDSKKLTARRREDLFERIKDQAAYAVAGVEAEEIDRMNILH-----ASKLAMKKAIEAL---HIPPGYVLVDGRD----------EIDIVCRQKAVIGGDAKCACIAAGSILAKVTRDRIMDDLYPQYAFDKHKGYGT---RLHFELLQKYGPCPIH---RYSFAPVKAL...... 218
35 5.000e-79UniRef50_A0A1H0CFP2 Ribonuclease HIII n=6 Tax=Bacillales TaxID=1385 RepID=A0A1H0CFP2_9BACI  ali  28  1.MSQQVIKASPADIKKISDFYKK-GSVRNLPPGAVFAAKTDGCHITAYKSGKVLFQGPASTHEAAKWNTPGVDQHQYAPPKDIQNSLLIGSDETGTGDYFGPMTVVAAHLNETQ-LKETESLGLRDSKTITDPEIKQIAPKLLKLCTYSLTVLRNEKYNKLQAEGMNQGQMKALLHHEAIKNLRNENAPFSGVLIDQFVKPEGYFNYLKKWPGEIPIYFATKAEGLHPSVAAGSILARYAFLQEMDKLAASLGVPIPKGAGAHVDKIAKEIYLSHGKDALYKSVKWHFSNTQRVL..... 312
36 6.000e-79UniRef50_K1MMK2 Ribonuclease HII n=14 Tax=Firmicutes TaxID=1239 RepID=K1MMK2_9LACT  ali  20  7.............IAEIKARIGAEIFTEA--EWEAWQADSRKGVQQLIQRRKRLL-----EKRQAKLEAFEARLTYERQLHQAGYSLIAGVDEVGRGPIAGPVVAAAVILP--MDLSAKEWIEINDSKTLSFAQREQYAQFIQEALAYQIVEVSNKQIDQLNIL-----NATKLAMQQALAELTPKP---DYALIDAVTVPNL----------TIPQQAIIKGDQRSLSIAAASIIAKVHRDHWMMQLYPEFQFEQNMGYGT---AAHIEALHHYGVTPYH---RQSFAPV......... 255
37 7.000e-79UniRef50_O84032 Ribonuclease HII n=33 Tax=Bacteria TaxID=2 RepID=RNH2_CHLTR  ali  21  11.....................................................................FEEKSIFENQAIEQGYSQVAGVDEAGRGPLAGPVVAGACILPRGKVF-----LGIDDSKKLTPKQRRYLYELLLEEVDCGVGVISVERIDEINIL-----EATKEAMVQAIASLRSTP---DFLLVDGLFLPHK-----------VPSLKIIKGDARSVSIAAASIIAKEYRDELMRKLYPEYGFDKHKGYGT---AAHLQALKHFGPCVYH---RKSFSPVKESIQE... 213
38 7.000e-79UniRef50_UPI00098851C8 ribonuclease HIII n=1 Tax=Caenibacillus caldisaponilyticus TaxID=1674942 RepID=UPI00098851C8  ali  27  14MTGYAVLKLSEDLIHKMRDFYGDR-LSAAAPPGSVFRAQADGCAITAYRTGKVLFQGKRAEEEVKMWEENGKRGREDRPSPTDGPSLIIGSDEVGTGDYFGPVVVCAAY-SGPEHVERLDALGVRDSKRLTDERIRALAEEIGRIVPYSLLVLDNEKYNRMIRRGYNQTKLKAVLHNQALVNVRRKIGDVHGFLVDQFTPPAQYFKAIADEKADAPIYFQTNAESLHPAVACASIIARYRFLQEIDRLSERCGMTLPKGAGPGVDEAAARLIRQRGETFLSRVAKLHFANTEKARKLAEK 364
39 9.000e-79UniRef50_Q1G9U8 Ribonuclease HII n=82 Tax=Bacteria TaxID=2 RepID=RNH2_LACDA  ali  18  2............KINEIKDLLQADSIDPAILA-ELAKDDRKGVQ-------KLLVSYQRQEKLAKQKEEFLGRFSYEKDFWAKG-QLVGGVDEVGRGPLAGPVVAAAVILPEDFSL-----LEVNDSKKLSPQKRLALYPKIQEAVAVGVGVMDNKVIDQINIY-----EADRLAMKQAVEALSTRP---DALLVDAMNVP-----------VDLPQLELIKGDAKSNSIAAASIVAKVFRDSLMDRLYPDYAFDHNAGYGTK---DHLEALRKYGPTPIH---RLTFSPVSEMVGLKK. 254
40 1.000e-78UniRef50_A0A291GDX5 Ribonuclease HII n=61 Tax=Bacteria TaxID=2 RepID=A0A291GDX5_9RHOB  ali  18  3....................................................................KTTPDYSFEEAAARRGYTRIVGVDEVGRGPLAGPVVAAAVWLDPARIP-----LGLNDSKALTAKRREVLYDEILAVADVSIASCTVEEIDEINIL-----QASLRAMERAVAGLK---VKADYVLVDGNKLPPAFGLDAE---------AIVKGDARSLSISAASIVAKIWRDRLMVDLYPGYGWEKNAGYGTKT---HIEGLRNLGVTPHH---RRSFKPVHNIL..... 204
41 2.000e-78UniRef50_A0A1H9SZL9 Ribonuclease HIII n=1 Tax=Salipaludibacillus aurantiacus TaxID=1601833 RepID=A0A1H9SZL9_9BACI  ali  28  1.MSYEVLKVQKKDLAMLKKHYMS-SLKEKTPQGAVFAAKTGHCNITAYQSGKVLFQGKGAPSEAAKWKGKEVDNHSYYPPDKIEEKIVLGSDETGTGDYFGPVTVVCVHLTEEQ-MSTIDSWGVRDSKTIKDETIRELAPRLLKECTYSLLVLNNEKYNRMQEQGMNQGQMKALLHHQAIENVKEKGLHYEGVLVDQFVSPDGYFKYLAAKKSEKPIYFATKAEGLHPAVAAASILARYSFLQEMDKISQLLNTPVPKGAGPHVDKAAKQILLNKGKDTLYKVTKWHFSNTQRVL..... 317
42 2.000e-78UniRef50_A0A1Y1RJH8 Ribonuclease HII n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 TaxID=1971726 RepID=A0A1Y1RJH8_9BACT  ali  19  36.......................................................................QMLTYERKLWDAGVSHIAGVDEAGRGPLAGPVVAGAVILPSNCYIPEL-----NDSKKLSEKKRNRLFDQIKKTTAIGIGIIEPREIDRLNIY-----QATRQAMIDALSHLSNQ---IQHVLIDGKPF----------SSFPYPYTAVVKGDSKSLSIAAASIVAKVTRDRMMHEQYPLYNFAKHKGYPT---QAHFAALRAYGHCPIH---RRSFRGVREFFKD... 237
43 2.000e-78UniRef50_A0A078LA10 Ribonuclease HIII n=8 Tax=Chlamydiae TaxID=204428 RepID=A0A078LA10_9CHLA  ali  44  10....FVTNLDKSLETRLKKDLQDLGFVLTTPPHTYFSAKKTGCSCTFYLSGKFTVQGKDMANFIEFYLEPQILQKLVFTYSDLDLDRTIGIDESGKGDFFGPLCVAGVFA-FDEQITELKKIGVKDSKGLNDQAIAKIAQKIKKNCLHHIVKINPYKYNELYLQFKNLNYLLGWGHATVIEQLIGK-SHCHKVIIDQFANEYVVINALKRKNLEVELTQRHKGEE-DIVVAAASILARDTFVNGLLELEEKYGIKLPKGASALTKTAALNFIKKFGKEELHHVCKVHFKTY......... 295
44 3.000e-78UniRef50_A0A167NGS8 Ribonuclease n=5 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A167NGS8_PHYB8  ali  17  35..................................................................YSSPVPALLVENLPNKVNEPCVLGVDEAGRGPCLGPMVYAVSYCPVSRHQEF-KAMGFDDSKKLTEDRRTALAKIIEANVGWAVYVISPQDINMLARPPFNLNEMAHDATIKLIRSVLEQKVNLTEIYVDPVGPSQSYQVKLSRNFPGISITVEPKADALYPIVSAASICAKVTRDQIVQNWEEGLDIPKNFGSGYPSDPNTVKWLKKNGFFGYPSIIRFSWKTISTIIEEPKN 277
45 4.000e-78UniRef50_R7DL32 Ribonuclease HII n=11 Tax=Bacteria TaxID=2 RepID=R7DL32_9FIRM  ali  20  1........................................................................MLTYEKEFFEQGYHLIVGCDEAGRGPLAGPVVAAACILPSDYHNED-----INDSKKLTDKKRRALLDEIENHIAFGIGIVSAEKIDEINIY-----QASRLAMNMAIENMAHQ---FDLVLTDAMPL----------FGYDVPVIDIIKGDARAQCIAAASIIAKVTRDEMMDELYPQYGFKHHKGYGTK---EHLLALDKYG--PIPGIHRYTYGPVQRAMNE... 201
46 4.000e-78UniRef50_A0A075LM82 Ribonuclease HIII n=10 Tax=Bacillaceae TaxID=186817 RepID=A0A075LM82_9BACI  ali  25  1.MGQIVLQLPLDTIQQMKATYSRA--EKPAPPGAIFSAKTPGCSITAYKSGKVLFQGKAPESEAGKWLKPSVNDHRYAPNPALFTSSHIGSDEAGTGDFFGPITVASVYVDQSQ-FALLKELGVKDSKLLKDDAIQRIAKDLMHVLPYSLLVMRNERYNQLQQRGWSQGKMKTMLHHHAIQKLLAKPTKPDGILIDQFQLPSTYIKHLATEGEKLQQNVMTKAESHSLAVAAASIISRASFVKEMDKLSKQAGFTIPKGASAAVDQAAGRLIRTHGRQALPVFTKMHFANSAKA...... 319
47 5.000e-78UniRef50_A0A1F8JR53 Ribonuclease HII n=4 Tax=Bacteria TaxID=2 RepID=A0A1F8JR53_9BACT  ali  17  7................................................................AEILRLNFMSVCEKRLKSEGFQKIAGIDEAGRGPLAGPVVAAACILPDDALFEHL-----NDSKQLTPEEREILFAQITNNVVYGIGIIDEKTVDRVNIL-----QATFLAMHKAVAAL---PIKPDYLLIDGSQLP----------IFDIPTEALVRGDSLSVSVAAASVLAKVTRDRLLEKLYPQYGFKQHKGYAT---QQHLDAILRHGPCPIH---RKSFDPVKSYFSSRE. 217
48 5.000e-78UniRef50_A0A2R4N057 Ribonuclease HII n=2 Tax=Carboxydocella TaxID=178898 RepID=A0A2R4N057_9FIRM  ali  16  2...........KTIKDIQQYLKELLSRNQEIPLELLKADHRPAV------KKLLLRYKNREKNYLLQKRWHDFRALEKRYRQQGL-LVAGVDEAGRGPLAGPVVAAAVILPEDCYYPVL-----DDSKKLTESKRNQLYEQIKDAIAWAVGISDVAEIEQLNIL-----NATKLAMLRAVKGLK---VEPKVLLIDA----------LTLADWPGHQERIIDGDALHACIAAASVIAKVTRDQMMAKLFPEYGFEQHKGYGT---AAHIAALKKYGPCPQH---RWSF--VRKFL..... 255
49 6.000e-78UniRef50_K2GP14 Ribonuclease HIII n=22 Tax=Bacillales TaxID=1385 RepID=K2GP14_9BACI  ali  26  1.MPTYVLKATPERIEEMKNYYSRNL--MKTPPHAVFQAHTPLASITAYQSGKVVFQGKTPEQEAGQWEKKERNSKKETHAYDLFHSPHIGSDEAGTGDYFGPITVCALYADEEQ-IRTLKEIGVKDSKHLTDDKITVIAKRIVENVSYRLMRLSNSRYNEWREKGWSQGKMKALLHHQAVTKLGEDPIRPEGILIDEFARPEIYKKHLRSEGKTMETYFMTKAESYSIPVAAASILTRSLFVKEMNKLSRHFGRTIPKGASSKVDRAAAAILKSHGEDTLKDVVKWHFANTEKAKKIAQE 310
50 6.000e-78UniRef50_A0A031IJ67 Ribonuclease HIII n=2 Tax=Exiguobacterium TaxID=33986 RepID=A0A031IJ67_9BACL  ali  24  1.MGTTVLRLSKEKQDLVIQNFKQN--EMKSPPYARFAAKIPGCVITIYNSGKVMFQGPQAEAIATRFGTASPTKSKEPSTLPNGFSSVVGSDEVGKGDFFGPLVVAASFVDRKQ-IALLHELGVRDSKHLNDIEIRRIARDLHAVIPYTYRILHNPEYNQ-MQRSMTQGKMTALMHNDVIERLLDQLTKPEAILIDQFAEKSVYYKHLSGVVNPVRENVSTKAEQLHVAVAASSIIARAIFLKEMDKLSESTGVVIPKGAGAKVDQVAASLILRYGSDKLRDWTKAHFANTKKA...... 296
51 7.000e-78UniRef50_A0A1B9F6Y7 Ribonuclease HII n=3 Tax=Bacteria TaxID=2 RepID=A0A1B9F6Y7_9DELT  ali  23  13.........................................................................LRFERLFWDQGLELVAGVDEVGRGCLAGPVVACAVVLPKGEIIE-----GIDDSKALSAKAREHLSVEIKKAVAWSVKEIGPDDIDSLNIL-----QASLKAMSLAVEALKPTPH---AVLVDGNQPFP----------CQLPLRTIPKGDSLSQSVSAASIIAKVHRDQIMHNLYPHYNFFKNKGYPTK---EHREALRRFGPCPIH---RRSFRGV......... 205
52 8.000e-78UniRef50_A0A2S8SVK4 Ribonuclease HII n=2 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SVK4_9BACT  ali  15  6............................................................NQSALFQFSMLPTFDREQELHKRGFKCVAGVDEAGRGPLAGPVVAGATVLPREFAWKYFGQL--NDSKQLSAKKREELCEIIKAQAAWGLGVVSHLEIDEMNIRR-----ASWEAMRRAIVDLVARFPTPAYILVDGLPVREM--------EWPWPYEALVKGDTRSTSIAAASIVAKVSRDAFMAQMFPGYGFAAHKGYPT---RAHYAALRELGACAIH---RRTFAPVR........ 221
53 1.000e-77UniRef50_B5YK98 Ribonuclease HII n=10 Tax=Bacteria TaxID=2 RepID=B5YK98_THEYD  ali  19  3........................................................................LFAFDESFRLQGYNLIAGIDEAGRGCLAGPVVAACVSFRDSVFIE-----GIKDSKELSHEQRESLFQEIIKHAFVGIGIVDVDLIDRVNIL-----EATRLAMMEAFENL---GREIELLLIDAVELPAL----------KVDQKALIKGDRKSASIASASIVAKVTRDRIMRQYYPMYGFDKHKGYGTK---EHLNALKKFGPCPIH---RKSFSPVRELM..... 199
54 1.000e-77UniRef50_A0A2V2GPF7 Ribonuclease HII n=1 Tax=Ruminococcaceae bacterium TaxID=1898205 RepID=A0A2V2GPF7_9FIRM  ali  19  12...............................................................AKKKEYIPLTYELEEELCPLGT--VAGCDEAGRGPLCGPVVAAAVILPRG-----LVLEGLGDSKKLSEKQRERLYTEITDAIAYSIAEASPEEIDRLNIR-----EASMLAMNRAVEGL---PVQPDGVLVDGNY----------ARGFSMPAMTVVHGDALSPSIAAASILAKVTRDRILDRQYPQYGIAVHKGYPT---AAHYKALSEHGPCPCH---RRSFR-----LEKQEK 216
55 1.000e-77UniRef50_Q5WFP1 Ribonuclease HII n=25 Tax=Bacilli TaxID=91061 RepID=RNH2_BACSK  ali  14  4.............IAAIRRKLMDGSISHNELD-ELKKDQRKGVQELLKR-----YQAQQ-EKQQTLIQMHKQMWRYEQELKQRGYVAVCGVDEVGRGPLAGPVTACACILPDDFQL-----LGLTDSKKLSKAKREEYAKMISEAVAYSIASVSAAEIDEINIL-----QATKKAMTKAINGLSQK---TDHLLLDAVRL-----------DVPIAQTSLIKGDAKSLSIAASSVLAKVWRDRYMEELYPGYGFDTHAGYGTAS---HLQALRTYGMTPEH---RKSFRPV......... 248
56 1.000e-77UniRef50_Q12A45 Ribonuclease HII n=28 Tax=Bacteria TaxID=2 RepID=RNH2_POLSJ  ali  20  1........................................................................MKAEQTPLSWDTPGLLAGVDEAGRGPLMGPVVAAAVILDELNPIK-----GLADSKKLTPQRREALYDEIRKALCCSIALATAEEIDRLNIL-----QATMLAMRRAVESLRLKPNK---VLVDGNRLPTL----------AIVSEAVIGGDAIVPAISAASILAKVYRDRWCAEFYPQYGFASHKGYST---AEHLAALREHGACPQH---RRSFAPVAEVL..... 198
57 2.000e-77UniRef50_D5ALB1 Ribonuclease HII n=12 Tax=Bacteria TaxID=2 RepID=D5ALB1_RHOCB  ali  20  5.......................................................................PDTRFEQAALARGFTRIAGVDEVGRGPLCGPVTAAAVVLDLSCLPE-----GLNDSKKLSAKRRAALVAQITATADVSVAHASVAEIDALNIL-----QASHLAMIRAIEGLK---TPPDHVLIDGNRLPKAL---------TISAEAIVKGDARSVSIAAASILAKEIRDALMVDLYPGYGWERNAGYPT---RDHLQALLDLGVTPVH---RRSFKPVHNIL..... 203
58 2.000e-77UniRef50_A0A248TCN9 Ribonuclease HII n=4 Tax=Firmicutes TaxID=1239 RepID=A0A248TCN9_9BACI  ali  15  4.............IKEIEQLLKNSDREDDYIKTLRL-DERKGVQKALGRWEK------QIEKREALLEKYELMQKYEKLFNKEGYRMIAGIDEVGRGPLAGPVVAAAVILPEN-----IQLLGIDDSKKLSEERRLYYYERIMEEAAVSTCMIDHHEIDTMNIL-----EASKKAMIHAVNSLHTQP---DFLLIDAVKLPTPY-----------PSESIIKGDSKSISIAAASVVAKVERDRLMDKQFPDYGFAKNMGYGTK---EHLRAIEEKGISPIH---RRSFAPVKDYLNDNR. 256
59 2.000e-77UniRef50_A0A2G3E1W2 Ribonuclease HIII n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A2G3E1W2_9FIRM  ali  25  6...TVVLKADEKLKEKLTKFYCD-DFCEKTPQYAIFQAKTEDCTITLYQSGKLMFQGKGAERESSIWNAWMQKQTSEPQAKAVVAPAVIGSDEVGTGDFFGPIVVTAAFVREEQ-FALLRQLGVRDSKKLTDEKICRIVPQIMEVVPHVTRVLGNEEYNRMRANGINMNQVKALIHNDCLFRLKKQLDDSVLVVVDQFEPPAAYYRHLSGEANVIKDICFTKAEDQCMAVACASMISRARFLKEMDLLAESIGEGIPLGAGNGVDAFAAALLEEQGPDILQKIAKMNFANVEKV...... 304
60 3.000e-77UniRef50_A0A1G6CC20 Ribonuclease HII n=1 Tax=Streptococcus henryi TaxID=439219 RepID=A0A1G6CC20_9STRE  ali  19  2...........ATIKEVKEALATIT-QLSDPAWADFEADSRAGVQTAIRQRK-----KAIQADIDEDLRLEEMLRYEKAAYQKGYQVIAGIDEVGRGPLAGPVVTACVILPNGCKIK-----GLNDSKKIPKSKHEEIYNQVMEAAAVGIGMQDNTVIDQVNIY-----QATKLAMLQAIDNLEGQVTKPDYLLIDAMTLE-----------VDIAQESIIKGDANSLSIAAASIVAKVTRDRIMADYYPGYDFAHNAGYGTK---AHLQGLDKFGPTPIH---RKTFEPIKSML..... 256
61 3.000e-77UniRef50_A0A1F5YEC2 Ribonuclease HII n=2 Tax=Candidatus Glassbacteria TaxID=1817805 RepID=A0A1F5YEC2_9BACT  ali  18  47..........................................................RLERERQARAEQDKMLELERAYHARGLFKVAGVDEVGRGPLAGPVVAAAVIFSPETDYPKA-----RDSKKLPPEKREELYVEILQKAAVGLGRAEHGEIDKLNIY-----NASLLAMYRAVENL---GEKPDAALVDGP----------MVLRMELPQEALIKGDSRCLSIAAASIVAKVTRDRLMDRLYPAYGFARHKGYPT---ADHFQALKTLGPCPIH---RRSFS........... 252
62 3.000e-77UniRef50_A0A0S8IT18 Ribonuclease HII n=1 Tax=candidate division Zixibacteria bacterium SM23_73_2 TaxID=1703426 RepID=A0A0S8IT18_9BACT  ali  20  1........................................................................MLDYERIIWNQGIGLVCGVDEAGRGPLAGPVVSAAVVFPRDFYLE-----GVNDSKKLSASQREKLFDLITENADFGVGVVGHELIDRINIL-----NASLLSMQKAIRKLK---IVPEMVLVDG---------RIKIPHLKIPQIVLVKGDNLSVSVASASILAKVTRDRLMHREYPQFSFDKNKGYST---EAHRKALENYGPCKIH---RRSFK-ISNLLKKK.. 201
63 3.000e-77UniRef50_A0A1J4RF72 Ribonuclease HII n=3 Tax=root TaxID=1 RepID=A0A1J4RF72_9PROT  ali  20  4.......................................................................PNFDIEDQFEC---HHIFGVDEVGRGPLAGPVVSACVYIPQKNRLHPVWSQ-VRDSKKLSATKRDILFSSIKAQCIFGIGMASVEEIDQINIL-----QATFLAMYRALESCSPSP---QMVLIDGNRSPKN---------WPWDHQTVVKGDSKSVSIAAASILAKVTRDSLMEELFPQYGWDTNAGYGTST---HMNALSSFGVTPYH---RKTFAPVRDAL..... 203
64 3.000e-77UniRef50_UPI0008F8B3EF ribonuclease HIII n=1 Tax=Traorella massiliensis TaxID=1903263 RepID=UPI0008F8B3EF  ali  26  1.METYTEKLNDNQIQLLKKKYYNY-ISDKKIPYALFQIKLEDCTITVYTSKKAVYQGEKASLYLTQPLEEDE----------------AGSDEVGTGDYFGPVTVCAVLV-KKEDIAFLKELKVNDSKQINDDQIRQKAPLLIKRLTHSLLILDNIKYNQIH-TTNNMNQIKAKLHNQAYLHLQKKGSLPERCIVDQFAPKDLYYRYLQNEPHIINNLTFEKAESKYLSVACASMIARYAFLCAWDKMEEHYQCTIPKGAGAEVDRFAAAFVNKYGYEELSKIAKMHFKNTAKLK..... 277
65 6.000e-77UniRef50_M7PI78 Ribonuclease HII n=18 Tax=Bacteria TaxID=2 RepID=M7PI78_9GAMM  ali  21  4.....................................................................................PLIAGVDEVGRGPLAGPVVTAAVILPDDFAIA-----GLTDSKKLSAKQREALVPQIKQQLAWALGRAEVHEIDQLNIL-----QATLLAMQRAVMALSIAPH---HVLVDGNHAPTL----------NCPVTTVIKGDLTEPAIAAASILAKVARDQEMDRLYPGYGLATHKGYPT---AQHRQALQQLGPSEVH---RRSFRPVQLAL..... 188
66 6.000e-77UniRef50_Q3J6H3 Ribonuclease HII n=321 Tax=root TaxID=1 RepID=RNH2_RHOS4  ali  21  6.......................................................................PDWTHETAALAEGFTCVVGVDEVGRGPLAGPVTAAAVRLFPGRIPE-----GLNDSKKLTAPRREMLAAEIHTVAEVSIAHASVEEIDRLNIL-----QASHLAMGRALAGL---PSRPDFALIDGHMVPKGL---------GHRCRAIVKGDALCLSIAAASIVAKVARDRIMEQQHPGYGWRTNAGYGTK---DHLQALLNLGPTPHH---RRSFKPVHNIL..... 204
67 7.000e-77UniRef50_UPI000A1CB9B2 ribonuclease HIII n=1 Tax=Tuberibacillus sp. Marseille-P3662 TaxID=1965358 RepID=UPI000A1CB9B2  ali  25  1.MGQQVIKCGHNQLKKIQYFYQ-RSAVHNNNPHTLFVAKVQGCTVTAYKSGKVLFQGKLADEEASQWQGSEALNVSKPSAQKTSVNHVIGSDEVGTGDYFGPMTVVAAFVQPA-DIEWLQKMGVKDSKKLTDEQMLLIGKTLAETIPHSLLILNNEKYNQLRSAGQTQGQMKSILHNQALLNVTEKVDKIDGYLVDQFTKPEHYFKAIQDQPHIIKNQIYFKGESVHMSVACASIIARYAFLKRMDQLSEQTGLDLPKGAGSGVDDVAATIIRQKGDAFLNKIAKTHFQNTTKARQK... 311
68 8.000e-77UniRef50_B9Y840 Ribonuclease HIII n=15 Tax=Firmicutes TaxID=1239 RepID=B9Y840_9FIRM  ali  27  1.MNTITLLLTSSQIERLYAAWSE--FEVKAPAYARYQLKPENCTITAYQSNKVVFQGKDAMIYAAPFQAEDQLENTNLSQGKSDFRRHAGSDEVGTGDYFGSVCVCACAV-EQQDLAWLQELKVNDSKQINDEVILQTAPLLMERLAYSLLILPPVKYNQIH-SQCNMNQIKAILHNQAYVHLKKRGSLPQAAIVDQFTPEVNYYRYCQGQKEVVRGLHFEKAESHYPAVACASMIARCAFLKAWDAMEKQWDMSFTKGAGSVVDQDGAAFVKKHGEQHLKEVAKLHFKNTEKV...... 296
69 8.000e-77UniRef50_A0A2E6TSG6 Ribonuclease HIII n=18 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2E6TSG6_9BACT  ali  40  7..TSYTCSLDETQGTLMEGILRERGYEMGVPPYARFAGKREGVNVVLYESGKLVVQGKGTREFVEFLLEPEVLKEYEAELEPELGLARIGVDESGKGDFFGPLVVAGVYVNE-KVCRGLVEAGVRDSKRVSDKRIGALAKVIREACVWSVVPVGPEAYNRLHGKMGSVNRLLAWGHARVIENLLEQGPAPVRAVSDQFASTKATVEKALLAKGRELELVQRHKAESDLAVAAASILARDEFVRRLGELGEGLGVELPRGAGKPVDVVARDLAEQHGEGRLAGGAKMHFRNAPRALG.... 311
70 9.000e-77UniRef50_A0A1M7PG14 Ribonuclease HII n=1 Tax=Gracilibacillus kekensis TaxID=1027249 RepID=A0A1M7PG14_9BACI  ali  16  3.........DKWTINQIKDYLFSDEKPSEDLLKKLYCDQRIGV-------KKMLNQYNRLAAKQAEEDHFLKISRFEQELWKNGLTHIAGVDEVGRGPLAGPVVAAAVILPSDF-----KLLGINDSKKLSKKKRELYYHYITTHADYSVGVVDAAEIDRINIL-----QASKKAMYHAINGLM----KIDYVLIDAVKLEKL----------SVPSNAIIKGDQKSMSIAAASIVAKVTRDKMMHEKYPSYDFHKNSGYGTKV---HLKAIEENGLTRYH---RRSF............ 249
71 1.000e-76UniRef50_A0A1X1D8V1 Ribonuclease HII n=10 Tax=root TaxID=1 RepID=A0A1X1D8V1_9GAMM  ali  23  10.....................................................................................RLIAGVDEVGRGPLVGAVVTAAVILDPARPI-----VGLADSKKLSEKRRLALYDEIKEALAWSLGRAEPEEIDRLNILH-----ATMLAMQRAVAGLAIAP---DFVLIDGNRCPAL----------PMPSLAVVKGDSLVREISAASIIAKVTRDREMAELFPQYGFARHKGYPT---ALHMEKLTQFGVTPHH---RRSFAPVRNAL..... 194
72 1.000e-76UniRef50_N9VP61 Ribonuclease HII n=14 Tax=Bacteria TaxID=2 RepID=N9VP61_9CLOT  ali  17  7............................................................EKLAAERERLELMKSYERQYEDS--VLVCGIDEAGRGPLAGPVVAGAVILPRDCEILFL-----NDSKKLSEKRREELFLEIQEAVSFAVGVVGPERIDEINIL-----QATYEAMRLAVSQLTS---VPQVLLNDAVTIPGL----------DIPQVPIIKGDAKSVSIAAGSIMAKVTRDHMMDKLFPEYGFAKHKGYGT---AAHIAALKEIGPCAIH---RRSF............ 207
73 1.000e-76UniRef50_Q03FJ5 Ribonuclease HII n=143 Tax=Lactobacillales TaxID=186826 RepID=RNH2_PEDPA  ali  16  2...........ATIKEIKTQLLSVYTLDDPLLVELSEDPRTGVQRLIKHKQK------EINQLRLKEEAFQARFTLERELWSNGIDLVAGIDEVGRGCLAGPVVTASVVLDETFDL-----IDVNDSKQLSSELREELYAKITEAVSVGIGVCSNQKIDEVNIL-----NATKLAMREAVGNL---NVTPQHLLIDAVNAP-----------IEIPKTVMFKGDSKSISIAAASIVAKVYRDHLMRALYPGYGFDKNVGYGTK---QHIEGLKTYGVTPIH---RQTFEPVPEFL..... 253
74 1.000e-76UniRef50_A0A202DIU1 Ribonuclease HIII n=13 Tax=Bacteria TaxID=2 RepID=A0A202DIU1_9BACT  ali  40  4.KNSFTYKLSPDQQQALIKVLKYGNYRPILREHTIFAAETEKCNIALYTSGKCLVQGKGASEFVTFVLEPEVLKSYEDLLDPDALNPHMGIDESGKGDFFGPIVIASVYTDE-QLTKKMRDMDVKDSKNISDKKALALGRDLRKLLGFSIVKIGPEAYNRLYTKMRNVNTLLSWGHARAIENMLDIVPDCPQAISDQFGRKDQVEKALMKKGSKIE-LIQRHKAESDMAVAAASILAREAFLRALKDMESKLDIEFPKGASTKVKEAAAELIKKHGPEILTKTSKCHFKTTDEVLAKAG. 306
75 2.000e-76UniRef50_O31744 Ribonuclease HII n=498 Tax=root TaxID=1 RepID=RNH2_BACSU  ali  15  1........MNTLTVKDIKDRLQEVKDAQDPFIAQCENDPRKSVQ-------TLVEQLKKQAKEKALKEQWVNMTSYERLARNKGFRLIAGVDEVGRGPLAGPVVASAVILPEECEI-----LGLTDSKKLSEKKREEYYELIKEALAVGIGIVEATVIDEINIY-----EASKMAMVKAIQDLS---DTPDYLLVDAMTLP-----------LDTAQASIIKGDAKSVSIAAGACIAKVTRDRMMSAYYPMYGFEKNKGYGTK---EHLEALAAYGPTELH---RKTFAPVQSF...... 254
76 2.000e-76UniRef50_A0A1M7JSK2 Ribonuclease HII n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1M7JSK2_9BURK  ali  23  21......................................................................................LVAGVDEAGRGPLAGPVVAAAVILDDLRPIK-----GLDDSKKLTAAVRARLYDEIRANACCAVAEATVEEIDTLNIL-----QATMLAMRRAVEGLRLKPAK---VLVDGNRLP----------VLKIAAEAIVQGDALVQSISAASILAKVHRDRLLHDQHPQYGFDEHKGYGTP---MHLAALKQHGACVHH---RRSFAPVREVMESL.. 207
77 2.000e-76UniRef50_N4WCU1 Ribonuclease HIII n=2 Tax=Bacillaceae TaxID=186817 RepID=N4WCU1_9BACI  ali  25  1.MSNIVLTFPKTKLHELETYYRDD--VKGKPAHSIFQAKKDGVTITAYQSGKVMFQGNGAEQEASIWQKKTVNDHAYQPDKRLFQMSHIGTDEAGTGDYFGPITVASAYVSE-ENLSILQSLGITDSKQLTDENILALSKEIVQNIPYSLLTLPNQKYNQMQQKGWNQGKMKAMLHHHAIQKLLAKLDTPPSILIDQFCPPATYSKYLRQEGQKMQQYFMTKAESYSTSVAVASIIARAKFVKDMDQLTKSIGVEIPKGASQRVDEMGAYIVKKFGKERLQHIAKTHFANTKKLETYLRQ 314
78 3.000e-76UniRef50_Q8R9X9 Ribonuclease HII n=234 Tax=root TaxID=1 RepID=RNH2_CALS4  ali  20  34..............................................................LEREIKRIEEMKFYEKKLYEEGLNFIAGVDEAGRGPLVGPVVAACVILPKEIFIPE-----INDSKKLPEEKREKLAEVIKEAISYGIGIVDCREIDEINIL-----NATLKAMKKAIFEVKEK---IEYLLVDAISIPDM----------PIKQLPIVKGDSKSISIAAASILAKVERDRIMHKLYPQYNFAKNKGYGTK---EHIEALKKYGPCPIH---RRTY--VEKILK.... 240
79 3.000e-76UniRef50_K1MGV5 Ribonuclease HIII n=4 Tax=Facklamia TaxID=66831 RepID=K1MGV5_9LACT  ali  28  1.MSSITLKMTAEAIQSLADHYPQAKIE--KVPHAYYRLRINGTIITAYHSGKVLFQGSRAEEEAHKWQSSDQIESSHPTNHYQGLNLI-GSDEVGNGSYFGALTVCAVYLNQTQ-IQTLKDLGIQDSKNLTDAKIQSLSRQIQDQVCFHLTIINPNKYNQLT-QNYNANAIKAIAHNACYQKLSTKQADLDGALIDQFTPERNYYQHLEKQGQSIKTFFAKKAESLHLSVACASIIARDYFLQSLEKLGAPYNCVLPSGASQSVDQMAAQLIRDYGPEALEKTAKLHFANTQKALRLAGQ 312
80 3.000e-76UniRef50_UPI0004860FA9 ribonuclease HIII n=1 Tax=Tuberibacillus calidus TaxID=340097 RepID=UPI0004860FA9  ali  25  1.MSQAVLTVHHDVIEKMKAFYTDH-LVNECPTGAIFRAKVNDCAITAYRSGKVLFQGKRALDEATIWEEWSKSLPTKPNQKNNGELAIIGSDEVGTGDYFGPIVVCAAFVD--QEIKRNLPTGIRDSKTLTDAKIKELAAPLSKLVPNTILTLSNEKYNQLVEKGYTQTQMKAILHHQALSNVIKKGKTFDGCLIDQFTAPKQFFERKRPDPLPKPIFFKTKAESLHLSVATASVLARYVFLKALSQLSTEAGLDLPKGAGAVVDDAGAEIIRTKGESFLKKIAKVHFANTEKAK..... 308
81 4.000e-76UniRef50_Q4KHG2 Ribonuclease HII n=227 Tax=Bacteria TaxID=2 RepID=RNH2_PSEF5  ali  20  7...............................................................................LVADAEDLVAGVDEVGRGPLCGAVVTAAVILDPTRPI-----LGLNDSKKLTEARREKLFDEICEALSWCIARAEVEEIDELNILH-----ATMLAMQRAVEGLS---VTPKLAMIDGNRCPKL----------AMPAEAVVKGDSKVPAIAAASILAKVSRDREMAAIYPGYGIGGHKGYPTPV---HLEALARLGPTPIH---RRSFAPVRQAYEARE. 201
82 4.000e-76UniRef50_D8JUP3 Ribonuclease HII n=64 Tax=Bacteria TaxID=2 RepID=D8JUP3_HYPDA  ali  17  6...................................................................SRIKPTFELEAAEHQLGSRPIAGVDEAGRGPWAGPVVAAAVILDPDKIPA-----NIDDSKTLDEDSRAFLYRRIMKVAIVGVGIADVDRIDRENILG-----ATLWAMAEAVSQL---GETPKLVLVDGDKTP----------RIPMSVRAIVKGDSKCLSIAAASIVAKVTRDRLMARAYPGYGFERHKGYGTP---EHQAAIAKLGVSALH---RRSFRPVQLALGLVDE 212
83 5.000e-76UniRef50_A4W6S8 Ribonuclease HII n=420 Tax=Bacteria TaxID=2 RepID=RNH2_ENT38  ali  22  10.....................................................................................HLVAGVDEVGRGPLVGAVVTAAVILDPARPI-----VGLNDSKKLSEKRRLALFDEIKEALAWSLGRAEPEEIDELNILH-----ATMLAMQRAVAGLK---IVPEYVLIDGNRCPAL----------PMRSLAVVKGDSRVAEISAASIIAKVTRDAEMAALYPQYGFAQHKGYPT---AFHLEKLSEHGPTEHH---RRSFGPVKRALG.... 195
84 5.000e-76UniRef50_F3B1X9 Ribonuclease HII n=20 Tax=Bacteria TaxID=2 RepID=F3B1X9_9FIRM  ali  18  7............................................................EKLALERVRLEGMREFENKY--SDLAYIAGLDEAGRGPLAGPVVAAAVILPKDIFLPFL-----NDSKKVTEKRRDVLFDEIKQNIAYGIGIASNTLIDEINIL-----QATYEAMREAINALSTRP---DILLVDAIHIP----------GIDIRQVGIVKGDAKSVNIAAASILAKVTRDRLMDKIYPEYGFASNKGYGT---AAHIAALKEYGPCEIH---RKSF............ 207
85 5.000e-76UniRef50_A0A1F8J2H0 Ribonuclease HII n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8J2H0_9BACT  ali  15  6...............................................................ASEISRIDQMSLLERDLASRGFSCIAGVDEAGRGPLAGPVVAAACILPRGVYFQYL-----NDSKQLTTGIRNLLYAQLLAYPGYGISIIDVETIDRINIL-----QATLMAMQRAVGSL---PVSPDYILIDGSRTPSL----------GVPCECVIRGDARSVSIAAASVLAKVTRDRIMHEQYPEYGFFSHKGYAT---NQHLRAIEKHGSCPIH---RTSFNPIRSCKE.... 214
86 6.000e-76UniRef50_R7EUQ4 Ribonuclease HII n=2 Tax=Clostridiales TaxID=186802 RepID=R7EUQ4_9FIRM  ali  17  1...............................................................MSEQKRKDLDFSLEKKLASEGFCRICGIDEAGRGPLCGPVVAAACVLPPDAHIE-----GLNDSKKLTPHRRDELFEIIKEALDWAVAEASVEEIDELNIL-----EATLLAMRRAVASLHKKP---DRLLVDGNVF----------RGFDIPGEAVIGGDGISPSIAAASILAKVTRDRILDRMYPQYGIAKHKGYCT---AAHREALFRYGPAPIKQFIRF.............. 203
87 8.000e-76UniRef50_F4NV99 Ribonuclease n=5 Tax=Fungi incertae sedis TaxID=112252 RepID=F4NV99_BATDJ  ali  17  43...................................................................NSLVPIKVSSQLPISDRPPCILGVDEAGRGPVLGPMVYAVCY-TLISHQDKLKDIGFADSKVLNETQRDKLFATIEKQIGWAATVCSPQDISESMLRKYNLNALAHDTTINLIQSVLDQGVNIQEVYVDTVGSPESYQAKLAKRFPKIKIVVSKKADSLFPIVSAASICAKVTRDAILCNWEFEPGIDRAFGSGYPADPKTVAWLKKHPVFGFPRIVRFSWSTTAKLLE.... 282
88 9.000e-76UniRef50_B9XFP6 Ribonuclease HIII n=2 Tax=Verrucomicrobia TaxID=74201 RepID=B9XFP6_PEDPL  ali  43  5..TSHTCKLTDAQAKALEVYLKSHDFELREVPYARFAGAKKDLNVVFYESGKLVLQGKGTQDFIEFVLEPEILQEYEEVLNPELLAPRLGVDESGKGDFFGPLCVAGVYVNESVVRAW-KEAGIRDSKNISDKKIRELAELIRETPGCVTTVVPNEAYNRLYAKMRSVNTLLAWGHARVIENLMGRKPPPIRAISDQFAASKDTVAKALMNLGRQVELVQRHKAEEDIAVAAASILARDEFVSRLGTLEKQYGMGFPKGASVLVDKAAKEFVSRYGSEELTKVAKMHFRTA......... 303
89 1.000e-75UniRef50_A0A127ARP7 Ribonuclease HII n=19 Tax=Bacteria TaxID=2 RepID=A0A127ARP7_9DELT  ali  22  3.......................................................................PTLEHEEILWQNGYNYLAGVDEAGRGCLAGPVVAATVILP-----PRVKLNGVNDSKKLSPQAREKCLIEIKKAVAISIGICMPEEIDSLNIL-----QASLEAMRRAILSLKTRP---DYLLIDG----------LYKVNVSLPQICLKHGDSQSISIAAASIVAKVYRDQVMHDLFPQYNLKKNKGYPT---AEHKQAIKNYGLCYLH---RRSFRPC......... 197
90 1.000e-75UniRef50_B3DVQ5 Ribonuclease HIII n=5 Tax=Methylacidiphilum TaxID=511745 RepID=B3DVQ5_METI4  ali  37  24....YTFSFDEKQTEKLKEILLQRGFDISPLNHGLFRATTRGVVIQAYKTGKILVQGKEALEFAQGVIEPEILGKYEEVLHPEYFEAHAGIDECGKGDLFGPLVVAAVFVDK-QSARFLVDAGIKDSKRISDSRLFQLAMEVKKKAPYGFFSLSPLQYNDLYEKKKNLNLLLAWAHAKAYQRLLQVQSDCHRVVCDRFAHP-WVLKQSFEKIGMQDALEQMTKAESDPAVAAASILARAVFLEELSKLGKEIGFSLLRGASSKTVEQAREIYLNKGKEALRKVAKMHFKTIQKILPE... 320
91 1.000e-75UniRef50_C1MH44 Ribonuclease n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1MH44_MICPC  ali  18  46.......................................................................PSRAHEQMYWDQGKKIVCGVDEAGRGPLAGPVVAAACVFPEDLVIDA-----INDSKQMTEEDREEVYEQLMENPEVSVCVIDHKEIDDINIL-----EATMKAMRKSVEGL---PTKADWVLVDGNRVPEPLKGRAE---------AIVKGDAKSVCIAAASVLAKVTRDRMMVEIHPEYGFAEHKGYGVKS---HMAAIHEHGPCPYH---RMTFAPMK........ 243
92 1.000e-75UniRef50_A0A2N6HK48 Ribonuclease HII n=6 Tax=Bacteria TaxID=2 RepID=A0A2N6HK48_9BACT  ali  19  36.......................................................................PTDEFELEARRRGYRLIAGLDEAGRGPLAGPVVAAAVILPTRCRLA-----GVDDSKQVSESARVQLYEIIRRARAVGVGVATEQEIDCLNIL-----EATRLAMRRALASLTP---PADCLLIDAV----------ILSNLAIPSRPIIKGDTLSISIAAASIVAKVTRDRMMHQTYPDYNFLSHKGYGT---EEHLQRLAQYGPCAIH---RRTFAPVAQLLD.... 235
93 1.000e-75UniRef50_A0A2D8PCQ2 Ribonuclease HII n=6 Tax=Bacteria TaxID=2 RepID=A0A2D8PCQ2_9RHOB  ali  18  4.......................................................................PDYSFEAAALARGFTRVAGVDEVGRGPLAGPVMAAAVVLDPADIPE-----GLNDSKKLTAKRRDALFAEIMARAAVGIGHASVEEIDSHNILR-----AAHIAMLRAVAVLDP---LPDHLLIDGN---------LLPRGTTVSAEPVIKGDGKSLSIAAASIVAKVTRDRIMVDLHPGYGWESNAGYPSKS---HISALKDLGVTPHH---RRSFKPVHNILCPEKQ 207
94 1.000e-75UniRef50_A0A1G9GGP2 Multifunctional fusion protein n=1 Tax=Sarcina sp. DSM 11001 TaxID=1798184 RepID=A0A1G9GGP2_9CLOT  ali  19  14.........................................................KRESRMRAEMERVEKMRSFERDAVRAGSGPVCGIDEAGRGPLAGPVAAAAVILPEDFALPWL-----NDSKKVTEKRREVLYRQITEAVSWAVVMVPPERIDEINIL-----QATYEAMRSAVSRLSVHPG----VLVDAVTIPDV----------DILQVPVIKGDARCISVAAASILAKVTRDAYMKEMYPVYGFAGHKGYGTKT---HCAAILEHGPCPIH---RRSF............ 221
95 1.000e-75UniRef50_G8QPC9 Ribonuclease HII n=4 Tax=Bacteria TaxID=2 RepID=G8QPC9_DECSP  ali  21  8.....................................................................................DLVCGIDEAGRGPLAGSVVAAAVILDPARPIA-----GLNDSKKLSAAKREALAPEIREALAWCVAEASVAEIDRLNILH-----ATMLAMQRAVAGLA---VAPLRALVDGNRCPKL----------AVPAEAVVKGDGKVACIAAASILAKTFRDGAMHRQYPEYGFDRHMGYPT---ADHLERLRQHGPSPIH---RRSFGPVKLLLAQAE. 196
96 2.000e-75UniRef50_A0A2D7BC33 Ribonuclease HIII n=12 Tax=Bacteria TaxID=2 RepID=A0A2D7BC33_9BACT  ali  40  9....YTCKLQSGQADKLQDVLEKQGFESREVPYALFAGKKEKLNVVFYTSGKLVIQGKGTQEFVQFVLEPDILGEYENVLDPSRIDPRIGIDESGKGDYFGALCIAGVYINKDMVEPW-EQAGLMDSKRVSDKRIAALADVIRKGCIYSVVPIGPEAYNRLNTKMKSVNTMLAWGHARVIENLMQRKDPPVRAISDQFARSKSTISNALMASGREIELVQRHKAESDLAVAAASILARDAFVQGIDQLSQRFHVEIPKGASQRVIDVGKCLVEAHGKSILNETSKIHFKTTRKIMGE... 311
97 2.000e-75UniRef50_A0A1F9KT75 Ribonuclease HII n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KT75_9DELT  ali  18  2.............................................................KRALTWLSPEPHGLLEEEAYARGFRCVAGLDEVGRGPLAGPVVAGAVVLPRGVSHPQ-----INDSKLLSAKAREALVPWIKEALAWGLGIVGPGEIDRMNIL-----SASLLAMAQALRQMSP---VPDYLLIDGNQKIPQEFLEDVQAVQDVQQRAIKKGDRLSISIAAASILAKVARDEIMDRRYPEYGFGQHKGYASSS---HLAALSRYGPSPIH---RRSFSPVREWLK.... 241
98 2.000e-75UniRef50_Q87MF1 Ribonuclease HII n=597 Tax=Bacteria TaxID=2 RepID=RNH2_VIBPA  ali  23  5...............................................................AKTTKAKVELPPFE---YPQGYQLIAGVDEVGRGPLVGDVVTAAVILDPNNPIE-----GLNDSKKLSEKKRLALLPEIKEALAWAVGRCSPEEIDELNIL-----QATMVAMQRAITGLKVQP---DLALIDGNRCPEL----------PMDSQAVVKGDLRVAEISAASIIAKVVRDQEMEELYPQFGFAKHKGYPTK---AHFEAIEQHGVISEH---RKSFKPVKKALG.... 209
99 2.000e-75UniRef50_Q886M9 Ribonuclease HII n=290 Tax=Bacteria TaxID=2 RepID=RNH2_PSESM  ali  22  11....................................................................................EDLVAGVDEVGRGPLCGAVVTAAVILDPAKPI-----LGLNDSKKLTEAKREKLFVEIQEALCWFIARAEVEEIDQLNILH-----ATMLAMKRAVEGLS---ITPKLALIDGNRCPQL----------SVPSAPVVKGDSKVPAIAAASILAKVSRDREMAALYPGYGIAGHKGYPTPV---HLEALARLGPTPIH---RRSFGPVRTA...... 195
100 2.000e-75UniRef50_D8RCY3 Ribonuclease (Fragment) n=4 Tax=Embryophyta TaxID=3193 RepID=D8RCY3_SELML  ali  19  1.....................................................................................HRVIGVDEAGRGPLAGPVVAAACIIPEDVDIQ-----GIDDSKKLTAEKREQLYSQITSTVRFSICVVDAPRIDEINIL-----QATMEAMETCVEELTGNGDHPPYILIDGNRIPGGLSGKHAR--------SVVKGDAESHVIAAASILAKVTRDRLMEDYWPLYGFKDHKGYGTAS---HTAALLKHGPCDIH---RRSFAPLRNLI..... 192
101 2.000e-75UniRef50_UPI000DD56C49 ribonuclease HII n=1 Tax=Thermogemmatispora tikiterensis TaxID=1825093 RepID=UPI000DD56C49  ali  17  14................................................................QQRGDMEPTLEEELALLAQGYRFIAGLDEAGRGCLAGPVVAAAVILPVEQSAALFLRTKLRDSKQMTPAQRERMYAVIQQALAVGVGIAPVELIDARNIL-----EATRWAMREALAQLEVRP---EALLLDALTLP----------GVPLPQRPLIKGDARCLSIAAASVIAKVTRDHLMERLHEEYGFDRHKGYGT---EAHLAALRRYGVSPHH---RRSFAPVRELVA.... 243
102 3.000e-75UniRef50_A7MY01 Ribonuclease HII n=253 Tax=root TaxID=1 RepID=RNH2_VIBCB  ali  24  18...............................................................................EYPQGYQLVAGVDEVGRGPLVGDVVTAAVILDPNNPIE-----GLNDSKKLSEKKRLALLPEIKEALAWAVGRCSPEEIDELNIL-----QATMVAMQRAIAGLKVQP---DLALIDGNRCPEL----------PMDSQAVVKGDLRVAEISAASIIAKVVRDQEMEELYPQFGFAKHKGYPTK---AHFEAIEQHGVISEH---RKSFKPVKKALGIEE. 212
103 3.000e-75UniRef50_A0A285M926 Ribonuclease HII n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A285M926_9RHIZ  ali  21  20.......................................................................PDFALEESAIKRFGGPVAGVDEVGRGPLAGPVVTAAVILDPAAIPE-----GLNDSKKLSEARREALFDIICETAHVCVASAAPDRIDALNIRG-----ATLWAMVKALEGLS---LPPAYALFDGRDVPP---------GAPCPGEHVIKGDGRSVSIAAASIVAKVARDRMMKRIFPGYGFEVHMGYGT---RRHQEAIEQLGVCVHH---RRSFRPIAERLA.... 219
104 3.000e-75UniRef50_Q8UHG2 Ribonuclease HII n=318 Tax=Bacteria TaxID=2 RepID=RNH2_AGRFC  ali  16  20.......................................................................PDFAFELEAKKKGFWPVAGTDEAGRGPLAGPVVAAAVILDPDNIPK-----GMDDSKKLTRQKRESLFVQIMETSIVSVASSGPGLIDSVNILR-----ASLDAMRRAVLGLE---IPPALVLADGRDRPP---------GIPCEAKAVIKGDSRSLSIAAASIIAKVTRDRMMERVHTSYGFEGHAGYGTP---AHLRAIESHGPCALH---RMSFRPLKR....... 216
105 3.000e-75UniRef50_Q8EQZ4 Ribonuclease HII n=90 Tax=Terrabacteria group TaxID=1783272 RepID=RNH2_OCEIH  ali  16  1........MKPASIASIKSQLTNGELTQKQIE-ELYKDSRKGVQAILKR------HEKQQEKQALLKQAFIKMNTYEKEAYRNGNHYIAGVDEVGRGPLAGPVVAAAVILPKDFQL-----LGINDSKKLSEVQRNEFSHYIKQHIAYQISFIDNTIIDKINIY-----EASKQAMKEAISGLQP---YPDHALIDAVPLEGLNCTYE----------AIIKGDAESVHIAAASVLAKVARDDWMKELYPLYGFNSNMGYGTK---EHLQAIETYGVTPYH---RYSFAPLHKY...... 254
106 3.000e-75UniRef50_Q5E3F3 Ribonuclease HII n=45 Tax=Bacteria TaxID=2 RepID=RNH2_ALIF1  ali  22  3....................................................................KKAESKELPPFEYPEGYQLFAGVDEVGRGPLVGAVVTAAVILDPNNPIE-----GLTDSKKLTDKKRELLFPEIQEALAWSLGRCEAHEIDELNIL-----QATMVAMQRAIAGL---NITPDFALIDGNKVPELPMAGL----------AVVKGDLRVQEISAASIIAKVTRDREMEELYPQYGFAKHKGYPTK---AHFEAIEEHGVISEH---RRSFKPVKRVLG.... 205
107 4.000e-75UniRef50_R7U7R0 Ribonuclease n=29 Tax=Protostomia TaxID=33317 RepID=R7U7R0_CAPTE  ali  18  38..................................................................................KTEPCCLGIDEAGRGPVLGPMVYGTCFCPIA-DKERLKEMGFADSKTLTEEKRENLFQKIQAAIGWAVHILSPNQISNSMLRKYNLNELSHDTAIGLIQKALDSGVNVDEVFVDTVGMPEKYQAKLERIFPELKITVAKKADATYPIVSAASICAKVSRDHAVKSWNFIEGRDKSYGSGYPGDSETKNFLSEDPVFGFPQFVRFSWSTASNILDAK.. 263
108 4.000e-75UniRef50_B9MQX2 Ribonuclease HII n=29 Tax=Bacteria TaxID=2 RepID=RNH2_CALBD  ali  22  2.................................................................RLSEDENYFEIEEKLLNEGYRFICGVDEAGRGPLAGPVFAAAVVMDRKRIIE-----GVRDSKKLTPKKREKLFEEIKESIAYSVAMVDSKVIDEINI-----NNATFLAMKNAIENLK---IEPDIVLVDGYKIPNLGFN----------QRAIIKGDRKSYSIACASILAKVSRDRYIVEIYPLYKFEKHKGYGTK---EHIEILQKYGPCEIH---RISF--LKNIL..... 204
109 4.000e-75UniRef50_F6IFS7 Ribonuclease HII n=55 Tax=Bacteria TaxID=2 RepID=F6IFS7_9SPHN  ali  20  18......................................................................................IVIGVDEAGRGPLAGPVVAGAVLLCKP------RPSGLDDSKKLSKARRLQLEEVIKRRCQWAVGVVDVEEIDRLNIFG-----ATMLAMTRAVAALCDNGTEPDEVLVDGNMTP-----HGRREEWRWKARAIVGGDALEPCISAASIIAKEHRDAIMRGLHPQYGWERNAGYGT---AEHLEALRRHGPTAHH---RRSFAPVAQL...... 207
110 4.000e-75UniRef50_F5WTS5 Ribonuclease HIII n=5 Tax=Erysipelotrichaceae TaxID=128827 RepID=F5WTS5_ERYRF  ali  27  1.MTTITIKLTDKQINELKSRYSKYPIRY-DIQYTHFQIKGSDVTITAYTSGKVVFSGEGAEFHASSY-TNEPLKPKSSVAPTQKIESMAGSDEVGTGDYFGPITVCACIVNES-DLKRIPVAEIVDSKQMTDDKIRKIAPILKQELQYSLLILDNKKYNRVH-DTMNMNVIKAKLHNQAFLNLKKRYEMPPYAIIDQFMAEKPYYNALKGEPEIFRGLIFETKAEKFIAVACGAIIARFGFLDYLDKLSTKYDCIFPKGAGAHVDTFGKEFVERYGKEELENVAKVHFANTARILNDA.. 295
111 4.000e-75UniRef50_A0A0R2XDZ0 Ribonuclease HIII n=4 Tax=Verrucomicrobiales TaxID=48461 RepID=A0A0R2XDZ0_9BACT  ali  39  1MADTFTYKLTEAQVLRLRETVTEKGFKLGPLEYGHFSARKGKCVLQMYLSGKLVVAGKEAREFIEFVLEPEILGEYEKVRNPEMYQPHFGIDESGKGDLFGPLVVAGVYVDEDTA-DRLVEIGVRDSKTITDKKIGELADEIRQTVGMELVAIGPARYSELYKKFGNLNRMLAWAHGKVIANLHAKVPSCPRALSDQFGNPRLIEGELRKQEVEI-QLEQRTKAESDIAVAAASILARAEFVQALGRLSMEAGVELAKGAGAGVKKQASEIYEKQGRNGLAKLCKTHFRTFAEAVGD... 303
112 5.000e-75UniRef50_A0A2E6DK78 Ribonuclease HII n=48 Tax=Bacteria TaxID=2 RepID=A0A2E6DK78_9DELT  ali  18  45..........................................................RAEKTKALQAKAERMLVFERELWLKGIELVAGVDEVGRGPLAGPVLAAAVILKPGHSI-----LSLDDSKKLSEKKRQALLEKIKDALCFAYGSASPKEIDELNIF-----QASFLAMRRAVDALAQSP---EHLLIDG---------GYQIKDVPIAQQAIVGGDGKSQSIAAASVLAKVERDALMENYFPEYGFGTHAGYPT---AAHLDALQKHGPSPIH---RRSFGPVKR....... 255
113 6.000e-75UniRef50_UPI0002E820C0 ribonuclease HIII n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI0002E820C0  ali  26  1.MGQTVIKVDQQTLGRIEKHYANNKLN-KQPPHTEFIAKQNGCTITAYTSGKIMFQGATHAEEASRWDVNPETQKKQHTISSASKEVHIGSDEAGTGDYFGPITVGAVYATEKQQ-ALLRELGVKDSKSMNDKTITSIVKDILKTIVYSTVTLHNERYNQLKQKNWSQVRMKAWMHHHAIQHVINKLDKPSGIVIDQFCEPGVYYNKIKASNPHSNITFLTKAESQSTCVAAASMLARYRFVQEMDKLSKKVGFELQKGASNKVDQQIKRIIQTKGEPFLDQIGKVHFGNTQKAKK.... 302
114 6.000e-75UniRef50_D2MQ83 Ribonuclease HIII n=1 Tax=Bulleidia extructa W1219 TaxID=679192 RepID=D2MQ83_9FIRM  ali  26  2........LNSEQADRLYHTFQDK--ETKKPPYAHWQLKLENCVITYYQSGKCLFQGNEAEVYASAFIERPNQPSY--KLYPQ-----AGSDEVGTGDYFGPVVVCASYVCENQ-LDLLRSYGITDSKAMSDKDIQKAAKSLQNQFTHVIFSLSPKAYNDLH-RRYNMNATKALLHNQAYLALSKRVDLPEICMVDQFTAEKNYFSYLAYEPEIFHRLQFEKAESRYASVALASVFARNRFLEEWSYMEEKYNFHFQKGAGALVDRCAKEFVKQFGYDSLEQVAKIHFKNTDKLKE.... 279
115 6.000e-75UniRef50_A0A1G7KY49 Ribonuclease HII n=99 Tax=Bacteria TaxID=2 RepID=A0A1G7KY49_9RHOB  ali  21  6.......................................................................PDYTFEEAAGLRGYMRVVGVDEVGRGPLAGPVVAAAVWLDPARIP-----TGLNDSKVLSAKRREALYDEILSVADVSIASCSVEEIDEINIL-----QASLRAMERAVAGLKIR---ADYVLVDGNKIPAAFGLDAE---------AIIKGDARSVSISAASIVAKTWRDKLMVDLHPGYAWEKNAGYGTK---AHLEGLQNLGVTPHH---RRSFKPIHNIL..... 204
116 6.000e-75UniRef50_A0A0J9DY41 Ribonuclease HII n=23 Tax=Proteobacteria TaxID=1224 RepID=A0A0J9DY41_9RALS  ali  18  28....................................................................................HRILCGVDEAGRGPLAGPVTAAAVILDPRKPIA-----GLADSKILTAKKREALYDEIIEALAWHVAEATVDEIDRINILH-----ATMLAMQRAVHGVAAKGTLPDLVQVDGNRCPQVPFA----------VEAIVKGDALVQEISAASILAKVTRDRQLVALHPEYGFDVHAGYGTP---QHLAAIEAHGVTLHH---RRSFAPVRRALE.... 217
117 6.000e-75UniRef50_A0A2A2Y9T6 Ribonuclease n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2A2Y9T6_9BACT  ali  38  1.MKSYTAPLTTLQCKKLRDLLKAQDFEFVEKPYTQFSARKGKLSVSVYEKGKVLIQGKDTRDFIEFHLEPEVLMGYEEIHDPQMFSPHFGIDESGKGDYFGPLVIAGVFTDHEVT-KQLMKAGIMDSKKVSAAKIRQLAEVIRSTVEFYIMTLAPQRYNETYQQFGNLNKMLAWGHASVIEKLLQLVPDCPRTLSDQFAKPFVLQKALAAKKLKI-TLDQRTGGESDIAVAAASILARERFVEWMDKTSVAGGVTLPLGASASVISAAKQVIQKHGNEALGKVVKLHFKTTQQVIGDL.. 303
118 6.000e-75UniRef50_A0A0L0QR49 Ribonuclease HIII n=19 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0L0QR49_VIRPA  ali  29  1................MKDYYANSSVT--PPPGAIFRAKTSEAVITAYKSGKVLFQGSSPEKAASIWKSRKHKSHAYAPDPKLFSSNHAGTDEAGTGDYFGPITVAAVYLTKTQ-IDLLKSHGVTDSKALTDTKIRQLAQEITNNIPYSLIVLRNEKYNKLQSQGWTQGKMKTMLHHHAIQRLLKKVDQMDGIIIDQFCEPSVYKKHLASEKLTSSTFFITKAESYSTSVAAASILARTSFLKQMDQLSEQTGIILPKGASQKVDQTAATIMKKYGTDVLSKIAKIHFANTTKA...... 292
119 7.000e-75UniRef50_O75792 Ribonuclease H2 subunit A n=131 Tax=Eutheria TaxID=9347 RepID=RNH2A_HUMAN  ali  19  21..............................................................................PAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLP-RLADLEALKVADSKTLLESERERLFAKMEDTVGWALDVLSPNLISMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWEKLQDLDTDYGSGYPNDPKTKAWLKEHPVFGFPQFVRFSWRTAQTILEKEAE 250
120 8.000e-75UniRef50_A0A1Y1I4C1 Ribonuclease n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Y1I4C1_KLENI  ali  19  40.......................................................................PTRDAEALQWAAGFKRVAGVDEAGRGPLAGPVVAAACILPPNFEIP-----GVDDSKKVSEANRDRLYDIITNAVEFAVSVVDVETIDQINIL-----EAAMLAMANAV-----KLVRADFALVDGNRIPKQLAASVSK--------AIVGGDALSTSIAAASIIAKVTRDRLMHEQWPEYGFKAHKGYGT---AAHMEVLKRLGPVVIH---RRTFQPLKGWLEQRK. 243
121 8.000e-75UniRef50_A0A250X5S7 Ribonuclease n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250X5S7_9CHLO  ali  20  374.......................................................................PTTELEDELRLEGFTHVVGVDEAGRGPLAGPVVAAACYVPPGVVLP-----GVNDSKQMTEAAREELYRFICERIKWKVSVIDNTRIDDLNIL-----QATLAAMTDAVHGLKAEG-SADFALVDGNRLPKGLL---------CPAKAVVKGDAQCVSIAAASVLAKVTRDRIMHDMYPQYGFHQHKGYGVPS---HLAAIREHGWCSIH---RLSFEPVK........ 573
122 8.000e-75UniRef50_Q13XD0 Ribonuclease HII n=189 Tax=Proteobacteria TaxID=1224 RepID=RNH2_PARXL  ali  18  29.....................................................................................DIVCGVDEAGRGPLAGPVVAAAVIFDPAKPM----IRGLDDSKVLTAKKRDELYDKIVDALAYCIASASVEEIDSLNILH-----ATMLAMKRAVEGLS---VVPTLVKIDGNRCPTL----------SVRSEAVIGGDALVKSISAASILAKVTRDRMLLELHPVYGFNAHAGYGTP---QHLAALREHGPCEHH---RRSFAPVREA...... 213
123 8.000e-75UniRef50_A0A176W8S4 Ribonuclease n=2 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A176W8S4_MARPO  ali  17  92.................................................................KLKKKMPSREMEAQLWDMGFQHVAGVDEAGRGPLAGPVVAAACIIPSSVNIE-----GIDDSKKLTEAKREELYEKITSTISYAIHVVDAAIIDEVNIL-----QATMQAMSACVQVLSQENPRPDFILVDGNRLPD---------GFPENSRSVVKGDAVCQVIAAASILAKVTRDRLMLSYWPNYGFKAHKGYGT---ATHMAALLKYGPCDIH---RRSFAPLK........ 315
124 9.000e-75UniRef50_A0A1H4WP56 Ribonuclease HII n=2 Tax=Beijerinckia sp. 28-YEA-48 TaxID=1882748 RepID=A0A1H4WP56_9RHIZ  ali  17  25.......................................................................PHFNHERALLARGLRFVAGVDEVGRGPLCGPVVAAAVILDPNHLP-----GGVTDSKQLDAAERQEAFDLVMQAIAVGIGMASAAEIDTINIR-----QATHMAMRRALAALS---VAPAFALIDGNDCPK---------DLRCEASTLIKGDAISLSIAAASVIAKVTRDRLMQEWHPQYGFAAHVGYPTK---QHREAIATHGPCVFH---RFSF............ 217
125 9.000e-75UniRef50_A0A1H4UWZ0 Ribonuclease HII n=6 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1H4UWZ0_9RHOB  ali  20  5.......................................................................PDFSFETEALAAGATFVAGVDEVGRGPIAGPVTAAAVRLDPGNIPE-----GLRDSKAMSQAARERLSEWLLTHAAVSVAHASVEEIDEINILR-----ASHLAMERAVAGL---GQGPDFALIDGN---------LLPRGLTIPARALVKGDARCQSIAAASIVAKVARDRIMVDLFPGYGWERNAGYPTK---AHLQALLDFGVTPVH---RRSFKPIHNIL..... 203
126 1.000e-74UniRef50_A0A1Z9IB00 Ribonuclease HII n=1 Tax=Rhodobacteraceae bacterium TMED160 TaxID=1986860 RepID=A0A1Z9IB00_9RHOB  ali  21  4.......................................................................PDFEVESELIKKGYRAIAGVDEVGRGCIAGPVTAAAVILDPENIPK-----GLNDSKKLSLKNREKIFHSIQNKCTFYVAHSSVSEIDEINIL-----QASLLAMKRAIDGLSISP---DFVLIDGNKSPEGL---------DSEFETIIKGDSKSLSIAAASIVAKITRDRIMDKQFPGYDWSQNAGYPTK---FHKSALLNIGITPHH---RHSFKPIHNIL..... 202
127 1.000e-74UniRef50_D2HG10 Ribonuclease (Fragment) n=6 Tax=Boreoeutheria TaxID=1437010 RepID=D2HG10_AILME  ali  18  21..............................................................................PAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLS-RLADLEALKVADSKTLSESERDRLFVKMEEDVGWALDVLSPNLISMLGRVKYNLNSLSHDTATGLVQYALDQGVKVAQVFVDTVGPPETYQERLQERFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKNWHFVEDLDADYGSGYPNDPKTKVWLRKHPVFGFPQFVRFSWRTAQSILEKEAE 251
128 1.000e-74UniRef50_A0A2G2D910 Ribonuclease HII n=9 Tax=root TaxID=1 RepID=A0A2G2D910_9SPHN  ali  19  2.......................................................................................IAGVDEAGRGPLAGPVVAAVVILPDNHPIA-----GLDDSKKLTAKARARLEEEIIACARFSVAQCCEAEIDDINIL-----QATMLAMTRAVEGLDLAPR---HVLVDGNRLPRWRYSAE----------AVIGGDALHPCISAASILAKEHRDRLMAEHYPQYGWERNKGYGT---AEHLAALRQYGPTPLH---RRSFAPVAQL...... 182
129 1.000e-74UniRef50_A0A238J961 Ribonuclease HII n=7 Tax=Bacteria TaxID=2 RepID=A0A238J961_9RHOB  ali  19  10....................................................................SMTHTENMDAPYHARGLRL-AGVDEVGRGPLAGPVVACAVILDPDNIPE-----GLTDSKKLSAKKRNALDLLIRKTAHVSIAEATVEEIDQLNIL-----QASMLAMRRAVEGL---PIRPDHLLVDGNRLPEGL---------PCPASAIVKGDSLSQTIGAASIVAKKWRDDVMIKIYPGYGWEKNAGYPTK---CHKSALRDLGVTPHH---RRSFKPVRDIL..... 210
130 2.000e-74UniRef50_A0A1H9A2F9 Ribonuclease HIII n=1 Tax=Ignavigranum ruoffiae TaxID=89093 RepID=A0A1H9A2F9_9LACT  ali  26  1.MNTVTLTLTAQQIQTLKALYPQAKI--SAVPYAHYRLQIPQLTITAYHSGKVVFQGKLAQDHANPWQSKSSTWQSPSKEKNKSTSVLMGSDEVGNGSYFGALTVAAVFLTADQ-IKYAQTLGIKDSKHLNDQQIIKLSQIIRSEFKHSLRVCNPSEYNRL-IGPYNAVSLKVHLHNQVLLDLLNKLNPKEKILIDQFTSPANYYKYLNKEETPLKQHFKVRSESIHLSVASASILARAAFLQSLQDLGQAYHTKLPSGAGLQVDNFGRQLVAQWGPEVLKNTAKLHFKNTQKILNLN.. 307
131 2.000e-74UniRef50_Q7VMF2 Ribonuclease HII n=239 Tax=Bacteria TaxID=2 RepID=RNH2_HAEDU  ali  22  4..............................................................................NFIYHNANLIAGVDEVGRGPLVGAVVTAAVILDPQQPI-----LGLADSKKLSEKKRILLATEIKKALCWSLGRAEAEEIDQLNILH-----ATMLAMQRAINALTIQP---DFVLVDGNRIPSL----------NMPAQAIVKGDSLVAEISAASILAKVARDHEMDQQFPEYGFAQHKGYPTK---LHIEKLAQFGATPFH---RKSFAPVRKILG.... 196
132 2.000e-74UniRef50_UPI000D1CE387 uncharacterized protein LOC112347630 isoform X1 n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1CE387  ali  17  112...................................................................LKRVPSRDLEIELWKTGFHRVIGVDEAGRGPLAGPVVAAACIIPEDVDIQ-----GIDDSKKLTAEKREQLYSQITSTVRFSICVVDAPRIDEINILQVSTTQATMEAMETCVEELTGNGDHPPYILIDGNRIPGGLSGKHAR--------SVVKGDAESHVIAAASILAKVTRDRLMEDYWPLYGFKDHKGYGTAS---HTAALLKHGPCDIH---RRSFAPLRNILD.... 343
133 2.000e-74UniRef50_Q2TBT5 Ribonuclease H2 subunit A n=55 Tax=Metazoa TaxID=33208 RepID=RNH2A_BOVIN  ali  18  21..............................................................................PPVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLS-RLEDLEALKVADSKTLSESERDRLFAKMEEDVGWALDVLSPNLISMLGRVKYNLNALSHDTATGLVQFALDQGVNVAQVFVDTVGLPETYQERLQQRFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKNWKFVEDLDTDYGSGYPNDPKTKAWLRKHPVFGFPQFVRFSWRTAQSILESEAE 251
134 3.000e-74UniRef50_A0A257DJT4 Ribonuclease HII n=7 Tax=Sphingomonadales TaxID=204457 RepID=A0A257DJT4_9SPHN  ali  19  2.......................................................................................IFGVDEAGRGPLAGPVVAAAVLLCKP------RPSGLDDSKKLSAARRAALEETIKRRCQWAVGIVDVDDIDRLNIFG-----ATMLAMTRAVEGLCAKGSDPTEVLVDGNMTPSGR-----RPEWRWNARVIVGGDALEPCISAASIIAKEHRDRVMAQQHQHYGWERNKGYGTP---DHLAALRLHGPTPLH---RKSFAPVSQML..... 191
135 3.000e-74UniRef50_A0A1S3K0B7 Ribonuclease n=5 Tax=Eumetazoa TaxID=6072 RepID=A0A1S3K0B7_LINUN  ali  16  21..............................................................................PEIAKRESCWLGIDEAGRGPVLGPMVYGTCYSPISLK-DQLKEMGFADSKVLNEEQREKLFEKIKEVLGWMIEVLSPNFISNSMLRKYNLNALSHDCAIGLIKKALDKGANIKEVYVDTVGDPAKYQAKLKGIFPDLDITVAKKADSIYPIVSAASICAKVARDNAVKNWTFKEGITVNFGSGYPGDPATKKFLTDYPVFGFPQFVRFSWSTADLLLQKN.. 247
136 3.000e-74UniRef50_K9EBC5 Ribonuclease HII n=6 Tax=Bacteria TaxID=2 RepID=K9EBC5_9LACT  ali  16  1........MEKLTIKDIKAKLRQ--LDHENNFTESLRQDPRKGVQKALKSW-----GQSRLREKELIQAYQEKNALESELRSQGFQTIAGFDEVGRGPLAGPVVAAAVILDPDQVI-----LGLDDSKKLSQKKRQELDQAIKAKSDWAIGSASVQEIDR-----YNIYQATRLAMKRALDALLLKP---DYLLVD-----------DMVIETSLPQKSMVKGDKLSNAIAAASIVAKQYRDQQMIDYYPDYGFDHHVGYGT---QIHLEALRKYGPTPIH---RQSFQPVRDA...... 253
137 4.000e-74UniRef50_Q8DL36 Ribonuclease HII n=119 Tax=root TaxID=1 RepID=RNH2_THEEB  ali  18  8...........................................................................YEQAYWQQGYSRVVGVDEVGRGCLAGPVVAAAVILPVDCVP----LPEVRDSKQLTARQRSRLFAQIHQAIAIGIGSASVAEIDQVNIL-----QATYRAMARALGRVAP----WDHALIDG---------KLTKTAPFERVTAIIGGDRHSYSIACASIIAKVRRDRFMARLYPQYGWERNVGYGTP---EHRQALDQYGLTPWH---RRSF............ 196
138 4.000e-74UniRef50_A0A0X8KN48 Ribonuclease HII n=3 Tax=Gemella TaxID=1378 RepID=A0A0X8KN48_9BACL  ali  19  2............KINEIKEIFSQEIVEKEIIE-TLQKDERIGV-------KKILLSYKKQEKKNFLKKEYEKKSFYENKCYNSGYKYICGVDEVGRGPLAGPVVAAAVILKPDNYFE-----GLNDSKKLSKTKREELYDKIKEALAYAVCEVDNREI-----EKYNIYNASRIAMQKAVEKLSQTP---DFLLIDAMPF----------GNYPISNFSMVKGDEKSVSIAAASVIAKVYRDRLMEKKYPYYDFENNAGYGTK---RHLEALDKYGICPIH---RRDFEPIKTIIGKNEQ 259
139 4.000e-74UniRef50_A0A1F9ZMX9 Ribonuclease HIII n=1 Tax=Firmicutes bacterium GWF2_51_9 TaxID=1798011 RepID=A0A1F9ZMX9_9FIRM  ali  27  1MKTTISLTLNDEQLVFLDKLYSEEKKTTGLP-YTKFRIDTDGCVITVYDSKKVVFAGKNAEEHARVFQ--------VQEEKKDDLFPMAGSDEVGTGDYFGPVVVCACYTTESQY-EALKSYQITDSKVMDDVQVRKVAPILMETIPYSVLVVQNSKYNEVQ-KKHNLNAIKAILHNAAYVHLRGKIKKLPPCVVDQFAPESLYYRYLAKEKEIVKGLTFEKAESKYFAVACASVIARYHFLQTFDAMKVEYKMDFPKGASSLVDAAAKRFVETFGRERLNEVAKLHFKNTKNL...... 285
140 7.000e-74UniRef50_H0X6F0 Ribonuclease n=10 Tax=Chordata TaxID=7711 RepID=H0X6F0_OTOGA  ali  18  21..............................................................................PLVCLKEACVLGVDEAGRGPVLGPMVYAICYCPLS-HLADLEALKVADSKTLSESERNRLFAKMRDFVGWALDVLSPNLISMLGRVKYNLNSLSHDTATALIQYALDQGVKVSQVFVDTVGMPETYQKRLQQCFPGIKVTVKAKADSLYSVVSAASICAKVARDQAVRNWRFVEDFDADYGSGYPNDPKTKAWLKKHPVFGFPQFVRFSWRTAMAILEKEAE 251
141 7.000e-74UniRef50_A0A1Y1WII0 Ribonuclease n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WII0_9FUNG  ali  16  59......................................................................................YVLGVDEAGRGPVLGPMVYAVCFCKESHYNE-LSSVGFADSKQLTEEKRTSLFAKLQQYSGWAIRCLAPAEISNSMLQKYNLNALAHDATIGLIQEVIARGIKVTKVFVDTVGPPASYQRKLQQVFPDIEITVAKKADALYPIVSAASICAKVPRDEHLARWVFEEGLERNYGSGYPGDPNTVAWLKDNAVFGYPDIIRFSWATCTKLLAD... 276
142 8.000e-74UniRef50_A0A0Q5D8F3 Ribonuclease HII n=17 Tax=Rhizobiales TaxID=356 RepID=A0A0Q5D8F3_9RHIZ  ali  16  20.......................................................................PDFSLELMARDAGHWPVAGTDEAGRGPLAGPVVAAAVILDPDNIPP-----GLDDSKKLSLKQREALFAMIMATAHVSIASSGPRLIDERNILR-----ASLDAMRRAVIGLNIKPA---YLLTDGRDMPPGL---------ACPGKAVIKGDSRSVSIAAASIVAKVTRDRMMGRVFPAYGFAKHVGYATK---QHRDGITSHGPCPLH---RMSFRPMRK....... 216
143 8.000e-74UniRef50_A5G7Z2 Ribonuclease HII n=28 Tax=root TaxID=1 RepID=RNH2_GEOUR  ali  18  10...................................................................EERPSLLEFESLVRRQGYACIAGIDEAGRGPLAGPVVAAAVILPNGVELP-----GVNDSKKLSPVKRNELFDLIMSASAVGVGSSDAGLIDEINIL-----QATLAAMKQAVSMLC---IPPDYLLIDG----------ISKVPLSIPQKTIKKGDSLSLSIAAASIIAKVSRDRLMMDYFPGYGFAAHKGYGCVS---HMAAIAELGPCAIH---RKTFRGVKEYVRSEE. 216
144 8.000e-74UniRef50_A7H722 Ribonuclease HII n=23 Tax=Bacteria TaxID=2 RepID=RNH2_ANADF  ali  21  50.........................................................KRRHANRAEGQRLRHLLRYEGELWDGGVTLVAGVDEAGMAPLAGPVVAGACILPRDYRPR-----GIDDSKQLDRRERERLAEDIKNAVCWAVARAEVEEIDRLNIYRAGLLALT-----RAVQALTPAPG---HVLVDARKLPELRL----------PQTPIIHGDALSLTIAAASILAKTTRDELMDALYPGYGFCNHKGYPT---AEHFQALERLGACPIH---RRSFQPVREALGLA.. 265
145 8.000e-74UniRef50_R5QLC4 Ribonuclease HII n=8 Tax=Bacteria TaxID=2 RepID=R5QLC4_9PROT  ali  16  3.............................................................DFSFERRSLRFPADLFSPKPQNTSVLIAGIDEAGRGPWAGPVVAGAVIFPNLEISDSLAT-NLNDSKQLSRRKREALFEELHSNALIGTGTASVEEIDSLNIL-----KATFLAMRRAVEAL---PLPPAFALVDGNKVPPL----------PCPAEAVVKGDALSLSIAAASVIAKVTRDRLMAKEFPYYGWEENAGYGTKT---HQNGLKLHGICAHH---RKSYAPIQRIIAESQK 220
146 8.000e-74UniRef50_A0A2N2P2C7 Ribonuclease HII n=9 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2P2C7_9CHLR  ali  18  14.......................................................................PDLSFERDLWSPELQYIAGLDEAGRGAWAGPVAAGVVILPMNENI--LKQLGVRDSKQMTPRQREYWAEQIKQHVAWGTGFASHAEIDQYGILP-----ATRLAMTRALEQLTIQP---QHLLIDALRLP----------LINLPQTAIIKGDRRSLSIAAASVLAKTARDHWMRQIYSDYGFAIHKGYGTK---QHHSALCSFGPCAIH---RFSFKPLQ........ 213
147 9.000e-74UniRef50_UPI0009E8D0C0 ribonuclease HII n=1 Tax=Tepidimonas taiwanensis TaxID=307486 RepID=UPI0009E8D0C0  ali  19  287......................................................................................LVAGVDEAGRGPLAGPVVAAAVILDDAQPID-----GVADSKALSAARRERLYDAIRRALCVGVGMASVEEIDRLNIL-----QATLTAMQRAVAALRLRP---SLVLVDGNRLP----------VLPVRAEAVVRGDATVDAIAAASIVAKVTRDRLMDEAYPTYGFDRHRGYGT---AQHLAAIRQYGPTPWH---RRSFAPVAQAL..... 470
148 9.000e-74UniRef50_A0A2G2PYA9 Ribonuclease HII n=229 Tax=cellular organisms TaxID=131567 RepID=A0A2G2PYA9_9RHOB  ali  20  11..........................................................................EIEASLCQQGIPY-CGVDEAGAGPLCGDVMAAAVILDPENPIE-----GLNDSKKLTEKKREKLFDEIREALDYCIARATVEEIDQLNIL-----NARMLAMSRAIDGLK---LPCQHALVDGNKAPQTTLD----------VTTIIKGDSLVTAISAASVLAKVQRDREMDKQYPGYGFAKHKGYGTAV---HMEALQALGPCEIH---RRSYAPVKALLKD... 207
149 9.000e-74UniRef50_A5UX01 Ribonuclease HII n=9 Tax=Bacteria TaxID=2 RepID=RNH2_ROSS1  ali  18  1..................................................................MIRICPTVEEERALRAAGYRAIAGLDEAGRGCLAGPVVAAAVILPDAVIDTPDVLDGVADSKMLSPAQRADLFERITSAVAWAVGATPAHIIDSHGILP-----ATRLAMQVALLRL---PRPADALLIDAVTL----------DNWPLPQRALIKGDARCLSIAAASIIAKVTRDRLMDALWPQYGFASHKGYGT---VQHQQALRRYGPTPHH---RRTFRPLCDWLA.... 210
150 1.000e-73UniRef50_A0A1G5AFJ2 Ribonuclease HII n=4 Tax=Pseudobutyrivibrio TaxID=46205 RepID=A0A1G5AFJ2_9FIRM  ali  16  1........MSEKKISEIQKEYKDASIDFLPDFIEEYINDGRPGV-----SKIXXXXXXXXXXXXXXXXXXXXXKEFEKKYWEK-YDYIGGIDEVGRGPLAGPVVTACVVLPKDCDI-----LYINDSKKLTAAKREELYDEIMEAVSVSIGVVSENRIDEINIL-----QATYEAMRQAI---KESKVQPQLLLNDAVTIPEV----------DIPQVAIIKGDAKSISIGAASIIAKVTRDRMMDKIYPEYNFASNKGYGS---AEHIAALKENGPCPIH---RKSF............ 249
151 1.000e-73UniRef50_A0A0F9QD14 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9QD14_9ZZZZ  ali  19  1...................................................................MKTKPTYDLELGLKNKGCKYIIGVDEAGRGPLMGPVVAAAVHIPEGFD-----TTGINDSKRLSSKKRELFYNKIRKECDFAFYTVDNATIDSINIR-----EATKMCMRYAIMG----ITKADYVLIDGNFIPD---------FLDIPAECVVGGDSKSVSIAAASIVAKVTRDRMMHEQYPIYGWNRNKGYGT---QEHRDAIKLYGATPYH---RKSFSGVKEY...... 201
152 1.000e-73UniRef50_H3NK41 Ribonuclease HIII n=11 Tax=Aerococcaceae TaxID=186827 RepID=H3NK41_9LACT  ali  24  1.MHSITLKLDQATIQKMANHYQKYLQP--LIPHSQLRVKINQTTITAYHTGKVLFQGPQAESEAKLWQDQSDVQPRLHQAASSLPSEIIGSDEVGNGSYFGPLTVCAVYLDKDQQ-KAVRKLGVQDSKKLSDQQIHQIAQQLIQTVPYHLTIVNPHKYNQLTQSYH-ANAIKVKLHDFTLQKLRAKKDDLQGILIDQFTPKKNYYQLLGETMPDYQPITAQKAESIHLAVACASIIARDAFVQGLIKLGADYQVRLPSGANPPVDQFAARLVAEHGQEVLNQTAKLHFANTQKALKIAQE 307
153 1.000e-73UniRef50_B1HW99 Ribonuclease HIII n=23 Tax=Bacillales TaxID=1385 RepID=RNH3_LYSSC  ali  28  1.MSNIVLSISTNIQKEVMAYYAANYIE-RKAAGVIFAAKLPDTSITMYKSGKLMFQGGGAEREAARWGTIEKTPNSKSAIIGAKGDSVLGSDETGTGDYFGPMTVAAVYVPSSK-IELINELGVKDSKMLSDDYMRKIAPDLRAACVHSVLILRNEKYNSLQAKGYSQGKMKAMMHNKALHNTLAKPETPEYILIDQFAERGVYYNYLKNEREIVQESVSTKAEQLHVAVATASILARAAFLKEMDRLSDIAGLELMKGASNKVDVQAARIWRKQGEEFLRSITKWHFANTEKA...... 304
154 1.000e-73UniRef50_A0A1I6MYF5 Ribonuclease HII n=37 Tax=Bacteria TaxID=2 RepID=A0A1I6MYF5_9BACT  ali  18  14..........................................................KATAKQQMLKQLVCSNAPEEALRYQGFTLIAGVDEVGRGALFGPVVAAAVILPRA--VAALANAGLKDSKQMTAEDREALDTRIRKAVALSIAAVDAETIDRINIY-----QASKLAMLEAVRGL---PIAPDHLIIDA-----------MRIDHPCAQTKLFYGDALCLSIAAASVIAKVHRDAMMHELHPEYGLASHKGYGTP---EHHRALETHGPTPLH---RRSFAPIRAFFPEA.. 230
155 2.000e-73UniRef50_A0A241WL36 Ribonuclease HII n=13 Tax=Proteobacteria TaxID=1224 RepID=A0A241WL36_9GAMM  ali  20  2......................................................................................LIAGVDEAGRGPLVGSVVAAAVILDPNNPIE-----GLNDSKKLTEKKREKLFKEIQEALAWSIAEASHIEIDDINIL-----QASLLAMRRAVEGL---NIPPEHVLVDGNKVP---------QGLVVSCDAIVGGDALHAEISAASILAKVTRDHQMHELYPQYGFAKHKGYPTK---AHFEAIAAHGVIDLH---RRSYAPVKRALGIA.. 189
156 2.000e-73UniRef50_Q38WY6 Ribonuclease HII n=28 Tax=Bacilli TaxID=91061 RepID=RNH2_LACSS  ali  15  1........MTKAQIAEIKQLLQA---PVTEEQLATFAADSRAGVQ------KLVVQYHKRAAKLAAQKAAFEERRQTEKALWPDYPLVAGIDEVGRGPLAGPVVTAAVILPHDFDL-----WQVNDSKQLSFKLKQELYREIMQAVSVSIGIASPERIDTENIYH-----ATELAMGEAVAGLDKQP---DYLLVDAMTVP-----------TDIPQEKLIKGDARSISIASASIVAKVIRDQLMDQQYPGYDLANNMGYGT---AKHLAGLAELGVTPIH---RRSFSPVQNAL..... 253
157 2.000e-73UniRef50_A3DDG7 Ribonuclease HII n=145 Tax=Bacteria TaxID=2 RepID=RNH2_CLOTH  ali  17  63...........................................................................YEKEAYQRGYKLIAGIDEAGRGPLAGPVVAAAVILPQDVFIE-----GLNDSKKLTENQREKLFDVINKAIGVGIGIVDEKQIDEINIL-----NATKKAMKLAVGNLKP---VPDILFID----------SLKLDDINIEQNSIVKGDAKSVSIAAASIIAKVTRDRIMDKKYPMYGFARHKGYGT---GEHIEAIKKYGICPIH---RVSF--TKNFI..... 255
158 2.000e-73UniRef50_R5MVJ7 Ribonuclease HIII n=23 Tax=root TaxID=1 RepID=R5MVJ7_9FIRM  ali  25  3.QKTITLKVSENTRKEMEEFFQDLK-REKTPPYAVFQADDCDTVVTLYESGKAVFQGHDADLSSQFWIEREKHLTKEKKEIIKNPKLYIGSDEVGTGDYFGPIIVTATYV-EKENVPFLEELGIRDSKKMTDEKILEVVPLIIKKIPYNSIMLTNKEYNS-NHDKYNMNKVKAILHNKMLYKTKMEHPNYEYIVVDQFAEKYVYFNYLKESSNVVRDITFTKAEDQVLSVACASVISRYLFLKEYDKLSGELGFILPKGAGPIVDEIGKKIVQKFGKEKLNEVAKLSFKNTEKILNK... 314
159 2.000e-73UniRef50_R6XRC8 Ribonuclease HIII n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R6XRC8_9FIRM  ali  23  1MNNTHKIKATTSQMNEMLEYYQGY-LTYNSSNYIIARAKLANATITFYRTNVVLFQGLNEVKEYNYWAKK---YNLEEDLDSHQFTSAIGSDEVGTGDYFGPVVVCATYVDSSM-IEKLRNLGVKDSKLLTDNQMIPMAITISKLIPYSIVYLDPLRFNLLTNKKDNLNFIKAYLHNKVINSILKKIPDVDAILIDEFTPKEKYFEYLKSEQNVIKNVSLIKGEKAHLAVAAASILARVTFLRELGKLSKTYDMEILKGAGPEVDRNAIAFVKAFGWNELSKVAKLKFANTERIKK.... 303
160 2.000e-73UniRef50_A0A1T4YE14 Ribonuclease HII n=1 Tax=Sporosarcina newyorkensis TaxID=759851 RepID=A0A1T4YE14_9BACL  ali  17  73.MDGQVKKLT--TIQQIKNQLQDLEEPNEWLDELR-TDERKGVQLAIKQWKK------RYEKRQQLINDFLQKKAFDDAYKTTRISLIAGIDEAGRGPLAGPVVTAAVILPEESSV----LLGVDDSKKISKVERQRFAQLIKEAVAYSIHVQSATVIDELNIY-----QATKQSMEAAVNQLSVKPHTV--------------IADAMNLMLDCPAYSIVKGDEKSLSIAAASILAKTTRDDLMTELHEQYGFDENAGYGT---AKHLQGLETHGFTAQH---RKSFEPIKTMW..... 332
161 2.000e-73UniRef50_A0A1V5Z1T8 Ribonuclease HII n=5 Tax=Bacteria TaxID=2 RepID=A0A1V5Z1T8_9BACT  ali  17  21................................................................SERERLTAMLSIEDALWQQGFSHIAGVDEAGRGPLAGPIVAAAVILKSPV-------CGLNDSKRLTERKRAQLYEEIMR----GGHIVSVSTIPSKQIDLFGIQAANQSAMRQAVTALS---VSPDFVLVDGY----------KLSGFQQPAMQVIKGDARSLSIAAASIVAKVTRDRFMDECYPGYGFARHKGYGT---RQHLEAIKRLGACPEH---RQSFAPFTD....... 222
162 2.000e-73UniRef50_A0A1Y4US23 Ribonuclease HII n=13 Tax=Bacteria TaxID=2 RepID=A0A1Y4US23_9FIRM  ali  18  62...........................................................................YEKELYNEGFEFIAGVDEVGRGPLAGPVVTASVILPKDCRI-----MGINDSKKLSEKKRNELYDIIKEAVAYSFGVITAKEIDDINIL-----QATYKAMKNSLESLSVKP---DFVLADAVTIPNIEF----------KQKGIIKGDAKSLSIGAASIIAKVTRDRMMEKLYPEYHFEKNKGYGS---AEHIEAIKKYGICPIH---RKSF--LKNLIK.... 255
163 2.000e-73UniRef50_UPI0002EDA38D lipid-A-disaccharide synthase n=1 Tax=Comamonas testosteroni TaxID=285 RepID=UPI0002EDA38D  ali  16  382...........................................................AELAAHAIQKIIATPLLEQGLPWHPPGLVAGVDEAGRGPLAGPVVAAAVILDDMKPIA-----GLNDSKKLTANRREVLYDEIRKALCFCIAQASVQEIDEINIL-----KATLLAMRRAVMGLRLKPV---LVLVDGNQLP----------QIDVQAEAIVKGDSLVQAISAASILAKVTRDRWCERLYPQYGFAGHKGYGT---AAHLQALRAHGATAEH---RRSFAPVAQVL..... 593
164 3.000e-73UniRef50_Q5FKE4 Ribonuclease HII n=227 Tax=Bacteria TaxID=2 RepID=RNH2_LACAC  ali  17  2............TIKEIKELLKGDVSEEEIANLE--KDSRSGVQ-------KLLISYRKKQKKLFEKQAFLERFLYEKQFWQKG-QLVAGVDEVGRGPLAGPVVTAAVIIDQDFDL-----LDVNDSKKLSPEKRLKLYPKIEEAVSVAVGVKNAQVIDQINIY-----EADRQAMAQAVNALDIKP---DALLVDAMNVP-----------VDLPQIELIKGDAKSNSIAAASIVAKVFRDKLMDKIYPHYGFSRNAGYGTK---EHIDALKQYGPTHIH---RKTFAPVSDFFK.... 250
165 3.000e-73UniRef50_A0A2D7B3L8 Ribonuclease HII n=3 Tax=Pedosphaera sp. TaxID=2024890 RepID=A0A2D7B3L8_9BACT  ali  19  9..................................................................IDHSDDLFFWEKSLGSRGFHFLLGIDEAGRGPLAGPVVAAAVILPAEWYRVGLDLSGIHDSKKCSPKKRYDLFERMTHHIKFGIAKIDAEEIDRI-----NVLKATHKAMNKA--ALLVRNPVADHALVDG----------LPVNGLSIPHTAIIKGDSKSYSIAAASILAKEYRDRLMDAIYPEYDFAKHKGYGT---RAHREAILAHGPCPLH---RDSF............ 214
166 3.000e-73UniRef50_C3ZGG4 Ribonuclease n=13 Tax=Bilateria TaxID=33213 RepID=C3ZGG4_BRAFL  ali  17  19............................................................................EVPDVTKGEPCCLGIDEAGRGPVLGPMVYGICYCPLS-GQDRLKDMGFADSKTLTEEQREKLFEAIAEFMGWTIHILAPNAISNLRRSKYNLNTLSHDTAIGLIQRTLDSGVNLQEVYVDTVGDATKYQDKLKGIFPDLDITVTPKADAKFPIVSAASICAKVARDRAVKGWEEKDGISRKFGSGYPSDPETKKWLASEPVFGFPQFVRFSWSTASKILDDK.. 251
167 4.000e-73UniRef50_F6VBY6 Ribonuclease n=16 Tax=Eumetazoa TaxID=6072 RepID=F6VBY6_XENTR  ali  17  6.............................................................EEFERDNSQNRLLSSPVPEICRTEDCCLGIDEAGRGPVLGPMVYGICYCPVA-RKKDLQDLKVADSKTLSEAERERLFEKLNDYIGWALHILSPNIISTSMRAKYNLNALSHDTAIGLIQFALDAGVQLKEVFLDTVGPAEKYQDKLKKIFPELDVTVRPKADSLFPVVSAASICAKVARDRVVKDWKFVEDLGDPYGSGYPNDPKTKDWLSRHPVFGYPQFVRFSWSTTQTILGNK.. 251
168 4.000e-73UniRef50_A0A1F6C4K5 Ribonuclease (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1F6C4K5_HANXR  ali  18  51..........................................................RLSRAQQERARLDGMLEVERRLRAQGAGHIAGVDEVGRGPLAGPVLAGAVVLPPAPDLP-----GLDDSKRMTPARREALFERIRQAVAVGVGVVDSAEIDRLNIL-----QATLKAMREAIAALA---VTPDRVLIDGTQRP----------GSGLPELAFVDGDARSLSIAAASVIAKVTRDRMMDRLYPGYGFAEHKGYGS---ARHLRALRDLGPCPIH---RRSFAPV......... 258
169 4.000e-73UniRef50_A0A1H2QAZ3 Ribonuclease HII n=4 Tax=Bacteria TaxID=2 RepID=A0A1H2QAZ3_9BACI  ali  20  1........MEKWTITAVKEYLQ----THEEPDAALLEAWKEDSRAGV---------QKELQRYAKRQKQKEEKYEFEQDYWGRGFQAVAGVDEVGRGPLAGPVTTAAVVLPKDISL-----VEVNDSKMLSARKREELETKIKEAVAWSVVHIEADEIDRLNIY-----QATKKAMRTAVADLEPAP---DALLVDAMTLP-----------LHIEQQSLVQGDSRSVSIAAASILAKVERDRYMHTLYPDYDFASNKGYGT---QNHLDGLKRLGGCAIH---RYSFQPV......... 251
170 4.000e-73UniRef50_UPI00088FBE67 ribonuclease HII n=1 Tax=Bacillus lonarensis TaxID=1464122 RepID=UPI00088FBE67  ali  16  43...........................................................LEKQARAEAIHERMWKFERALQQEGYELIAGVDEVGRGPLAGPVVAAACILPQQF-----KLVGLTDSKQLTKSAREQFAPYIKKALSWHIASVSAEEIDRTNILV-----ATKEAMLQAIQGLTK---TVDHLLLDAIKLP-----------HGAPQTSLIKGDTKSISIAASSVLAKVWRDEYMVDLYPQYGFEYHAGYGT---RAHLHALKKYGPTQAH---RQSFRPVRECLE.... 253
171 4.000e-73UniRef50_W7YZZ2 Ribonuclease HII n=3 Tax=Bacillus TaxID=55087 RepID=W7YZZ2_9BACI  ali  15  4.............IHALREQLVQHKFDQKELEELR-KDDRKGVQALLYE--------RQLEKERALVTMHDDMLQFEQDLREKGYQFICGVDEVGRGPLAGPVTACACILPLDF-----KLLGLTDSKKLAKAKREEFANSIKEALAYHISSVSALEIDQINIL-----EATKKAMQAAIKGLE---LPVDYLLLDAITLP-----------VPVAQMSLIKGDSKSLSIAASSVLAKVWRDDYMERLYPEYGFNDHAGYGT---MKHLTAIEQHGVTKEH---RRSFKPV......... 248
172 5.000e-73UniRef50_A0A2A2RP56 Ribonuclease HII n=14 Tax=Bacteria TaxID=2 RepID=A0A2A2RP56_9BACT  ali  15  17.........................................................................LAHERELVASGRVLIAGVDEAGRGPLAGPVVAAAVMFPLAWLQGEFELADLNDSKQLTETQREHYFTWLRAEVSFAIAEADAALIDRINIL-----QATHHAMNEALARLRPAPV---HALVDGRPVRTLRF----------PQTALVKGDARSYSIAAASVLAKVTRDRAMDRQFPGYGFAEHKGYGTP---AHLAALTRLGPCPIH---RRSFAPLK........ 218
173 5.000e-73UniRef50_A0A1G2ISL1 Ribonuclease HII n=5 Tax=root TaxID=1 RepID=A0A1G2ISL1_9BACT  ali  15  4.......................................................................PNFSEEKKLWKKGYKLVAGLDEAGRGPLAGPVVAAAVIFNFKFPNKFLIKQMIKDSKKMTVKQREATYEFLTNHIKWGVGIVSEKVIDKINIL-----EATKLAMKKAVGGVSDTP--PDFLLLDGNF---------KLENINLPQKSIIKGDSKVFSISAASIIAKVTRDRIMHKKYPEYNFLKHKGYGTK---AHFASLQKFGPCKIH---RKSFYPVK........ 209
174 6.000e-73UniRef50_A0A1J5TVP3 Ribonuclease HII n=9 Tax=Bacteria TaxID=2 RepID=A0A1J5TVP3_9GAMM  ali  18  2......................................................................................IIVGVDEVGRGCLVGNVVAGAVILPDDFDLPEL-----TDSKKLSEKKREVLYTLITNQCQWAVGESSANEIDDINIL-----QATMLAMRRAVESLNMQY---DRVLVDGNRCPKL-----------ENCTAIIKGDLSEPAISAASIIAKVTRDRQMIELHPEYGFAQHKGYGTK---QHLIALERFG--ALKGQHRYSFSPVK........ 181
175 6.000e-73UniRef50_A0A1V4M797 Ribonuclease HII n=11 Tax=Bacteria TaxID=2 RepID=A0A1V4M797_9FIRM  ali  22  62..............................................................................QLWHQGYESVAGIDEAGRGPLAGPVFAAAVILKPDLLIE-----GLNDSKQLSACTREKLFERIIDAEAYAIGSASREEIDRINI-----HAASMLAMMRAVNALARKP---DYLLVDGFSI----------LKCPYRQKALKSGDRLSLSIAAASILAKVARDRVMHRQYPVYGFDRNMGYGT---AEHRSALKRYGPCLVH---RRSFR........... 247
176 7.000e-73UniRef50_UPI0009846668 ribonuclease HII n=2 Tax=Bacteria TaxID=2 RepID=UPI0009846668  ali  18  55.....................................................................YKRMCWFEQKNYAKSHRFIAGMDEAGRGPLAGPVVAAAVILPEDF-----KLLGLNDSKQLNEATRNSFFSIIKEAVSYGISIVDCKEIDRVNIY-----KATKLAMYRAIGELDP---VPDHILIDAVNL----------DQLPCSSESITKGDQKSVSIAAASVLAKVTRDTYMRKLYPEYDFASNMGYGTKH---HLEMIREHGVTPYH---RKSFGPVRQA...... 254
177 7.000e-73UniRef50_A0A197K0I5 Ribonuclease n=2 Tax=Eukaryota TaxID=2759 RepID=A0A197K0I5_9FUNG  ali  19  46................................................................................LEQDQECILGVDEAGRGPVLGPMVYGICYCPLSKK-DELADLGFADSKTLKESERDNLLDVIMDLIGWSVRVLSPMDISNSMLRKYNLNALAHDTTIQLIRETIASGVNLKEVYVDTVGPPESYQRKLEGLFPSVKIVVAKKADSKYPIVSAASICAKVTRDDVLRHWEKELDISREFGSGYPGDPKTKSWLKANPIFGYPNIVRFSWATCKTSLDESAK 277
178 8.000e-73UniRef50_D4Z4P5 Ribonuclease HII n=43 Tax=Proteobacteria TaxID=1224 RepID=D4Z4P5_SPHJU  ali  20  14......................................................................................LVAGVDEAGRGPLAGPVVAAAVILRQEDCPE-----GLNDSKQLSAARRAVLEGEIKRALCWGLGVASVEEIDSINIL-----WATMLAMTRAVEALA---HDCAHVLVDGNRCPQWRWA----------STAIVEGDAKCLSIAAASILAKEARDRMMVETHPHYGWESNKGYGS---ARHLAALREHGPTPLH---RRSFAPVAQL...... 196
179 8.000e-73UniRef50_A0A2V3JBW6 Ribonuclease HIII n=1 Tax=ANME-1 cluster archaeon TaxID=2056316 RepID=A0A2V3JBW6_9EURY  ali  34  2.....TLQLTQEQKDKLREYLEKKCFSFETRPYQEFLARGDNVVVNLYNSGKVVFGGSNKERIREIEAFLLSIGAVEVKKKEKKYPPIIGTDEAGKGDYFGPLVIAGVLITEDE-EKELSKIGVRDSKTLSETSISNMAFKIRSILKYEVVWISPIKYNLLYKKLGNQNRILGWGHARAIENLLSNGRDCKVAIADQFGD-QSYIENALMRKGREIELIQVPGAERDLAVATASILARDKFIYKLREMGESYGLVFPKGSSN-VVEFGKQFVKDYGVDALLNVAKVHFSITREI...... 296
180 8.000e-73UniRef50_A0A0R2AZ99 Ribonuclease HII n=3 Tax=Lactobacillales TaxID=186826 RepID=A0A0R2AZ99_9LACO  ali  16  59...........................................................................YERQLWPQ-YPHIAGIDEVGRGPLAGPVVTAAVILPHDFSAP------VNDSKQLSAKTRQQLYTVIMEAVSVSLGVSDAKRIDQENIYH-----ATELAMGEAVSHLSVRP---DYLLVDAMTVPTAL-----------PQQKLIKGDANSISIAAASIVAKVVRDELMAQVYPGYDFGHNMGYGTK---KHLAGLDEYGVTPIH---RHSFEPVQRHLQDSR. 254
181 9.000e-73UniRef50_Q7N8N3 Ribonuclease HII n=351 Tax=Bacteria TaxID=2 RepID=RNH2_PHOLL  ali  19  9.....................................................................................SLIAGVDEVGRGPLVGAVVTAAVILDPLQPI-----VGLADSKKLSEKRREALYLEITEALCWSLGRAEPAEIDQLNILH-----ATMLAMQRAVANL---PISPEYVLIDGNRCPKL----------PMPAQAVIKGDGLVAEISAASIVAKVTRDREMDQLFPEYGFAKHKGYPT---AFHLEKLVQLGATEHH---RKSFAPVKRAIGLK.. 196
182 1.000e-72UniRef50_A0A2N2KL80 Ribonuclease HII n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2KL80_9DELT  ali  22  1........................................................................MDTFEKLAYQKGYKFIAGVDEAGRGPLAGPVVAAAVIFP-----PFYSNSQINDSKQISARKREELYEIIRDSLAVGIGTVDAETIDRINILR-----ASLQSMREAVLELS---LPPDFLLIDG----------LHKIPLKTPQSPLVKGDALSVSIAAASIIAKVSRDRIMHRQFPQYNFLRNKGYGTK---EHRAAILEFGMCKIH---RRSF............ 191
183 1.000e-72UniRef50_A0A1W9RWY3 Ribonuclease HIII n=2 Tax=unclassified candidate division KSB1 TaxID=1046950 RepID=A0A1W9RWY3_9BACT  ali  36  3.KSVFTAKFAPEQEEQLRSILEQDEFELKPVDHAFWQAQRERVFITFYRSGKVVIRGKNIEEAIEKYLAPLKSDSAIHGLEAENLTKWTGTDESGKGDIFGPLVVAAVFVDKN-SEHFLWQKGIQDSKKIDDRKIREFASFIRKHFKHSVITLMPAKYNELYSNFKNLNKLLAYGHALAIEHLLEK-VECPVVLSDQFGDESLIREALSSK--HKIHLVQKVRAEENLAVAAASILARDKFLGALEKMAIKYQMSFPVGASQQAQIVLEKFITRHGKKELKNVSKLHFKPIKNLLDD... 295
184 1.000e-72UniRef50_A0A0T7ZPZ5 Ribonuclease HII n=4 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A0T7ZPZ5_STREE  ali  18  279.......KTSMATIKEIKELLVTVKELESPIFLELEKDNRSGVQKEISKRK------RAIQAELDENLRLESMLSYEKELYKQGLTLIAGIDEVGRGPLAGPVVAAAVILPKNCKIK-----GLNDSKKIPKKKHLEIFQAVQDALSIGIGIIDNQVIDQVNIY-----EATKLAMQEAISQLSPQP---EHLLIDA-----------MKLDLPISQTSIIKGDANSLSIAAASIVAKVTRDELMKEYFPDYDFATNAGYGT---AKHLEGLTKLGVTPIH---RTSFEPVKSLLGKKE. 539
185 2.000e-72UniRef50_C0GHM4 Ribonuclease HII n=9 Tax=Bacteria TaxID=2 RepID=C0GHM4_9FIRM  ali  16  68.............................................................................RAAREKGFTYIAGVDEAGRGPLAGPVVAGAVILPDNFFLA-----GLNDSKKLTPQKREELYEAITEAVAWSVGIGEVWEIDDINIL-----QASKLAMYRALLTLSVKPDY-------------ALLDALELEELPFAQQGVVGGDGLSLSIAAASVVAKVTRDRLMEKMYPGYGFSLHKGYPT---AEHRSAIAKLGPCPIH---RKSF............ 253
186 2.000e-72UniRef50_A0A165NB59 Ribonuclease HII n=12 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A165NB59_9RHOB  ali  18  17.......................................................................PDLRFERSVEQDLQGRFAGIDEAGRGPWAGPVVVAAASLDYDNLPE-----GLNDSKKLTEAKREELFEQILEMADVSVCVQSAQTVDRINIR-----EATLQGMRTCARSLS---VPVKRFFIDGKDVPHHL---------PQEGQALIKGDGRCLAISAASIVAKVTRDRLMDRYLPEYGFAKHKGYGTK---QHQEALAAHGVTPLH---RCSFRPIREMIE.... 216
187 2.000e-72UniRef50_UPI000B4A6F1C ribonuclease HII n=1 Tax=Novosphingobium sp. B 225 TaxID=1961849 RepID=UPI000B4A6F1C  ali  16  18.....................................................................................PVVIGVDEAGRGPLAGPVVAAACLLGSDFPA------GLDDSKKLSAKRRALLEPQIHASCHWALGVVEADEIDRINIF-----AATMLAMTRAVSGLIAAGVEPDQVLIDGNKTPAGRVP-----EWRWAARAIVGGDALEPCISAASILAKEHRDRVMRECWPHYGWDRNMGYGT---AEHLAALQCHGPSPIH---RRSFAPVAQL...... 208
188 2.000e-72UniRef50_UPI000C837B86 ribonuclease HII n=1 Tax=Clostridiales bacterium Marseille-P2846 TaxID=1852363 RepID=UPI000C837B86  ali  21  17..................................................................KERLQEITQIDAQLWQAGRAF-AGIDEAGRGPLAGPVATACVVMPGA-----PLLLGVDDSKKLSEKKREALFESIRETALFGVGIATAEEIDEMNILR-----ATKRAMQRA-----AQGAPCDLFLIDAVD----------QIDLSGEVRGIVHGDALCYSIAAASIVAKVTRDRMMRELYPQYGFQKHKGYGTK---AHIEALKAFGPCPEH---RRSF............ 210
189 2.000e-72UniRef50_A0A2H6AMN9 Ribonuclease HII n=56 Tax=Bacteria TaxID=2 RepID=A0A2H6AMN9_9BACT  ali  21  5....................................................................RKTLDYALEKEIWNKGKIPV-GVDEAGRGPLAGPVVAAAVILPRGCKIE-----GLKDSKQLPPKRRENLFRHIQNAIAISTGIVEAEEIDELNIL-----KATIIAMERAIKSLEIQPL---FVLIDGN----------IKTSIKIPQKAVIKGDSIYPSIAAASIVAKVTRDSLMDYYYPQYNFIKNKGYPTK---EHIDALRRFGPCPIH---RKTFK........... 199
190 2.000e-72UniRef50_A0A1G0WJC5 Ribonuclease HIII n=2 Tax=Bacteria TaxID=2 RepID=A0A1G0WJC5_9BACT  ali  42  1.MISYSNTLSLQQSSELKLLLQEKGFEFSEKQHAKWHSFGPGLSITLYNSGKLLIQGKGTEDFVLFALEPQIIKKAEKPIQEEPYVPHIGIDESGKGDFFGPLVISAAFVSMETR-DAIIKLGVKDSKEISDSKLLSIAQNLRKTLGYSTVTIGNTAYNNLYSKIGNLNKLLAWGHARALENMLEKNIEVSFAISDQFG-NKSLIENALMKKGKSIKLLQRTKAESDIAVASASILAREEFLKRLSTLSSKLGIRLPKGASQAVKTAAKEIIEKHGIEKLSEISKLHFKTYRDV...... 301
191 2.000e-72UniRef50_UPI00085CBAB2 ribonuclease HII n=1 Tax=Massilioclostridium coli TaxID=1870991 RepID=UPI00085CBAB2  ali  22  8................................................................................REQQISCLCGVDEAGRGPLAGPVVAAAVILPLNEEIE-----GINDSKKLTEKKREALCEQIKKAIAYSIGSASVEEID-----TYNILQATFLAMKRAVEGLNRKP---DFVLIDGNKNPDV----------GIPSRFVVKGDATSANIAAASILAKVTRDHYMDQQYPEYQLAKHKGYGTK---LHHQMILEYGMAPIH---RRSF............ 190
192 2.000e-72UniRef50_A0A2E2YKS4 Ribonuclease HII n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E2YKS4_9CHLR  ali  19  4...................................................................KKNKPSWTYEKTYWESGLYNIAGIDEVGRGPLAGPVVAAAVIIHSNSRDXDNWISEXRDSKLLTXDXREQLAHIISQSCSYGLGIVSAQIIDQINIR-----NATLLAMKNAVTELD---VQVDALLIDGRDGIES----------KLPQKKIIKGDNNSYSIAAASILAKVTRDRMMKKLFPGYELAKNKGYPT---AQHRTALYDLGYTNIH---RLSFGPVRDVL..... 210
193 2.000e-72UniRef50_UPI0004631F8B ribonuclease HIII n=2 Tax=Verrucomicrobia TaxID=74201 RepID=UPI0004631F8B  ali  41  33.PSTFSFSLLPTQIEELRERLREKGFEMRVLEHGFFDGRGPSVIVRAYRSGKVLIQGRGAGDFVEMFLEPEILREYEEVREPEADAPHAGSDECGKGDFFGPLVVAAAYVD-SETAPVLRRLGVRDSKEISDARAILLGEEIGKAVRCAVVVLGPAKYNELYGRFGNLNWLLAWAHATALAEIVHKVPSCPRALVDQFARSP-VLDQAIGRQGLSLRVEQRPRAESDIAVAAASLLARAEFLRRLALLGKEAGRTLPKGASAPVLAAAREIVRLEGADRLRGLAKVHFRTFAQAVAS... 333
194 2.000e-72UniRef50_UPI000C9F3C47 ribonuclease H2 subunit A isoform X1 n=2 Tax=Octodon degus TaxID=10160 RepID=UPI000C9F3C47  ali  19  106..............................................................................PAVCREEPCVLGVDEAGRGPVLGPMVYAICYCPQS-RLTDLEALKVADSKTLSENERDRLFLKMRDFVGWALDVLSPNLISMLGRVKYNLNSLSHDTASGLIQYALDQGVNVTQVFVDTVGLAETYQERLQKRFPDITVTVKAKADALYPVVSAASICAKVARDQAVKSWEKVQDLDADYGSGYPNDPKTKAWLRKHPVFGFPQLVRFSWRTAQAILEKEAE 336
195 2.000e-72UniRef50_Q8NX59 Ribonuclease HIII n=193 Tax=Bacillales TaxID=1385 RepID=RNH3_STAAW  ali  23  1.MANIVFKLSDKDITTLMSRI--TFDTENLPQGMKARAKYQNTTVNIYQSGKVMFQGNHAEAVSKELKKNMANSFLEQTLMYDQFNCI-GSDEAGSGDYFGPLTVCAAFVTK-EHVPILKTLGVDDSKKLTDTKIVELAEQLVTFIPHSLLTLHNEKYNIQQAKGWTQVKMKAVLHNEAIKNVLEKIDQLDYIVIDQFAKREVYNHYALSDIPPKKTKFETKGESKSLAIAVASIISRYAFVTYMDQISKNINMTIPKGAGAKVDVIAAKIIKKYGLSHLDTISKKHFKNAQKILK.... 310
196 3.000e-72UniRef50_A0A2N7X098 Ribonuclease HII n=2 Tax=Paraburkholderia symbiotica TaxID=863227 RepID=A0A2N7X098_9BURK  ali  20  52........................................................GKAATVRAAKLAQAA--LNFESPL-----DIVCGVDEAGRGPLAGPVVAAAVILDPKRRIR-----GLDDSKVLNAKTREALYKKIVESIAYCVASASVEEIDTLNILH-----ATMLAMKRAVEGLA---VTPTLAKIDGNRCPTL----------SVRSEAIIGGDALVPAISAASILAKVTRDRMLAELHPVYGFDSHVGYSTP---QHLAALLAHGPCEHH---RRSFAPVREAYERLG. 262
197 3.000e-72UniRef50_UPI0003B41916 ribonuclease HII n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI0003B41916  ali  19  2.......................................................................PDYSFETEFGARDNRQIVGLDEAGRGPWAGPVVAAAVCITPA-DLTEPTFQHLNDSKKLTAQRRASLCTAIQERCHFGIGQASVSEIDQFNIL-----QASLLAMQRAVAALD---FVPDGAIVDGLHAPEL----------PCPHRAMARGDSLSVSVAAASILAKVTRDRLMEQLCPGYHWNRNRGYGT---ADHRKALEQLGPSRYH---RRSFRPIQELVSRLEN 208
198 3.000e-72UniRef50_R7F8W9 Ribonuclease HII n=16 Tax=root TaxID=1 RepID=R7F8W9_9CLOT  ali  20  15...........................................................................IELEYHKNGIKYIAGIDEAGRGPLAGPVVIGCVIMPEDSMIE-----GINDSKKVSEKKREKLYDEIIENISWSVAIIDKQDIDELNIL-----NATKKGVTEAIQGLKTKP---ELILVDALNGIDT---------CNIKYDSIIKGDAKCYSISAASILAKVTRDRIMREWYPQYGFAKHKGYGTK---AHIEALKEYGPCPIH---RKTF............ 203
199 3.000e-72UniRef50_UPI000C1C0369 ribonuclease HII n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI000C1C0369  ali  17  1........MEKSTIKAIKERFHTGNINEEWLSHLRQDGRKGXXXXXX-------XXXXXXXXXXXXXXXFLHMTRYEQHGYANGKRLIAGVDEVGRGPLAGPVVAAAVILPEDINL-----LGLDDSKQLSEVARNKFYSLIKQAVCYGIAVVGNEKIDQVNIY-----EAAKLAMHEALGQLDPRP---DHVLADAVPL----------TGLPCSSEAIIKGDAKSISIAAASVLAKVYRDELMKEIYPAFDFASNMGYGT---RNHMEALKRQGASPFH---RRSFAPVREVL..... 255
200 3.000e-72UniRef50_A0A2E6D4B1 Ribonuclease HIII n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2E6D4B1_9BACT  ali  33  1MSQTIVLKVPVADQQRLRSRLDSLNLEWRTVPHATFSARGEGAVVTLYKSGKLVVQGANPEAFVTEQGEATPAAPQMGDPFAHATGPFVGSDETGKGDYFGPLVVAAVRM-ESHQAKKLTEWGVADSKKLTDKRALKLAALLREEVEHTIECLPPPEYNAEYARFRTLNPLLAAQHAKAIRAVAQPG---DAVLVDQFAKASVMEAALE---GSDVRLFQAHRAERHVAVAAASILARAEFLLGLAELESKEGVSLHKGAGQPTDEAGLIFARANGMDALIRVAKLHFKNTGKI...... 300
201 3.000e-72UniRef50_A0A0G0E4E3 Ribonuclease HII n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0E4E3_9BACT  ali  22  29.......................................................................PTWSEEKKLWEQGYKLICGVDEVGRGPLAGPVVAGAVVFRSDIQFEVT----ICDSKMLTRKKREELFPQIQSLVSYGVGLVEADEVDSLGI-----VNATHKAMREAIKKLKVKPN---FVLVDG--------REKISRFNKNSQKSIIKGDQKSYSIAAASILAKVYRDRLMHEEFPVYGFDTHVGYGTK---KHLENILKYGLCRLH---RRSF............ 223
202 4.000e-72UniRef50_A0A0A7RXC9 Ribonuclease HII n=9 Tax=cellular organisms TaxID=131567 RepID=A0A0A7RXC9_9GAMM  ali  20  8.....................................................................................SFIAGVDEVGRGPLCGDVVTAAVILDPNNPIE-----GLADSKKLSEKKREYLFEVIKEALAWNIARASVSEIDQLNILH-----ATMLAMQRAVAGLSIKPN---LVLVDGNRAPD----------FGIAAQAVVKGDSLVQEIGAASILAKVTRDREMDKIYPQYGLSKHKGYPT---QAHLAAIIEHGVNDI---YRKSFAPVKRLL..... 192
203 4.000e-72UniRef50_A0A2D5BKR9 Ribonuclease HIII n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5BKR9_9BACT  ali  35  5..NMFVDRIDDATGAQLEEMLRSAGYEFREVEYARFGAKGESVSVVLYTSGKLVVQGKGASDFRLHRLQELTGLPEPRLKVAT-----IGCDEAGKGDYFGPIVVAAVAMTPEE-EQFLDEIPLCDSKTLSDRQIAGAAEHLRNVVPHEVIVIGPRRYNELYAKFQNVNHLLAWAHGKAMLAVKDK-TGIDHVLLDKFCD-ESVVKRALGARSSEIDLHSRPRAEDDPAVAAASLLARDAFVRGIDRLRHVAGRPLPKGAGSPVLKAGRELVKERGRDILAEVAKVHFRTTGQL...... 288
204 4.000e-72UniRef50_F5T579 Ribonuclease HII n=5 Tax=Firmicutes TaxID=1239 RepID=F5T579_9FIRM  ali  19  27.....................................................................................SPIAGVDEAGRGPLAGPVVAACAVIPLDYPFYYL-----NDSKKMSEKRRESLFEDLKEAIAFGIGIVSPERIDEINIL-----QATYEAMREALKDMEKHFSSPKILLNDAVTIP----------GISIPQKAIVHGDAKSLSIAAASVLAKVTRDHIMDEQYPEYGFKQHKGYGTKV---HREAILTHGPCPIH---RRSF............ 208
205 4.000e-72UniRef50_R6B2D3 Ribonuclease HII n=7 Tax=Firmicutes TaxID=1239 RepID=R6B2D3_9CLOT  ali  17  2.............................................................KKINEAERLEQMTQYERPFWERGIA-VAGMDEVGRGPLAGPVVAACVILPPGFVTE-----GVNDSKKLTKKRMEKLYPLITGATAFGTGWVFQKEIDEINIL-----QATKKAFAEAYRNALAHCPVCSDVFVDAV----------KELDIPAVQHSLIHGDALCYSIAAASIVAKVERDRYMAEKFPQYGFEKNVGYGTK---QHMDALREFGPCELH---RRSF--IKKILAERGE 218
206 4.000e-72UniRef50_A9KLL7 Ribonuclease HII n=357 Tax=Bacteria TaxID=2 RepID=RNH2_LACP7  ali  17  36..................................................KKLLFKYNRYEKLNAERARVRFLQEYELSYP--DYRYICGIDEVGRGPLAGPVIACAVILPKDCEI-----LYINDSKQLSEKKREALYDEIMEAISVGIGSASHARIEEINIL-----QATYEAMRGAINKL---GVVPELLLNDAVTIPKVV----------IPQVPIIKGDAKSISIAAASIVAKVTRDRLMVEYFPGYGFASNKGYGS---ADHIKALKELGPSPIH---RASF--IKNL...... 251
207 5.000e-72UniRef50_A8AUW5 Ribonuclease HIII n=78 Tax=Terrabacteria group TaxID=1783272 RepID=RNH3_STRGC  ali  26  1.MGQFTLTPSEQEIQAFLKQYKKY-LSSSKNPYIRYFFRLEQATASVYTSGKLLLQGEEADKYALFFKE---TADLTRPPQKITYQAMIGTDEVGNGSYFGGLAVVASFVTKEQ-EDFLRKLGVGDSKTLTDQKIRQLAPILKEKITHQALLLSPKKYNQVIASGYNAVSVKVALHNQAIYLLLEKGIKPDQIVIDAFTSSTNYQRYVKQERNQVSQAIEEKAEGKYLAVAVSSIIARDLFLENLEILSQELGYQLPSGAGAKSDQVASQILKAYGMAGLETSAKLHFKNTQKAKQLLE. 295
208 6.000e-72UniRef50_A0A2E4BVE7 Ribonuclease HII n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2E4BVE7_9PROT  ali  19  4...................................................TIILLGKRIQK---KKFQKVPDFSVENSARSKGHFFIAGVDEAGRGSWAGPVVAGAVILEDDNLIPPLRSE-LDDSKKLTVRKRQMLFEMLPTCALIGVGIADVNEIDRLNIL-----EASFLAMARAISDL---PQKPGYVIVDGNKVPDL----------PYPGEYVVKGDSRSLSIAAASIVAKVTRDNIMVNLAKGYGWERNAGYGT---QEHKMALERLGVTEHH---RKSYAPIIKILSK... 224
209 6.000e-72UniRef50_A0A1Q9YBX6 Ribonuclease n=3 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A1Q9YBX6_9FIRM  ali  24  1........MSKEQIDDLYQRTQKFIQKESQPANTLWQIKTKGIIISAYKSGKVVFAGNDLDFLDEPDDEQFKVQKAEKMEKISSYPQ-AGSDEVGTGDFFGPIVVCAAVVPDEKTAEELRKLKVTDSKAMTDSRIKLIAPILEEMLPHSVLVTTNRKYNQIHEQTKNIKVIVSMLHNQAYLNLIKNGVKPEQVIIDQFCSPATYFRYLSNVHVNDVVKNIHKAESKYPAVAAASVIARARFLKVMDDMSDKYGVTFNKGGGRQADQSGIEFLKKHSPEQLRDVAKIHFANMNKI...... 290
210 6.000e-72UniRef50_A0A1Y3Q0Z7 Ribonuclease HII n=1 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3Q0Z7_9FIRM  ali  19  9.................................................................................ADGWDLTAGVDEAGRGPWAGPVVAAAVILGDHVPP------GVTDSKLLTPARREQLYEEILAAIAVAYWAVSPRRIDA-----ANVLRASLVAMRQAVLAL---PVAPGRVLVDGP---------WLVPNLPVPQQPLVKGDREHPAISAASIIAKVTRDRMMDRVYPEYGFAAHKGYGTP---QHRNALSRLGPCPLH---RRSFAPV......... 193
211 6.000e-72UniRef50_A4MVU9 Multifunctional fusion protein n=4 Tax=Haemophilus influenzae TaxID=727 RepID=A4MVU9_HAEIF  ali  22  374.........................................................KQAAQAVIDLLEGKKMFEY-----PQGYKLIAGVDEVGRGPLVGAVVTAAVILDPHNPIE-----GLADSKKLSEKKRLALAEEIKEALAWALGRAEADEIDEINIL-----QASLLAMTRAVKSLKIQPH---FVLVDGNKIPK---------DLDIPAQAVVKGDSLVAEISAASILAKVARDQEMEELYPEYAFAQHKGYPTK---LHLEKLAEFGALPQH---RRSFAPVKKALEQL.. 585
212 6.000e-72UniRef50_A0A088TNQ4 Ribonuclease HIII n=3 Tax=Candidatus Izimaplasma TaxID=1912503 RepID=A0A088TNQ4_9BACT  ali  26  2...NFVLKLDEPDVLRVIAFYQDYK-KSSNNEHIRFFAKTDFISVSVYKSGKVMFQGEDSEPEYDMWKIMLNISEEPKPLYNDYFYPSIGSDEVGTGDFFGPVTVCAAYL-RKEDIEFVKGLGIDDSKKISDDKILIIGEQLKDRVPFSLLTLHNEKFNELTKRGFNMNKIKAYLHNKAILNLLGKINGTPEVIIDQFAEEKLYFRYLNDETKVYRNVTLTKAESKYASVAIGSIIARYAFLKHFDNLSKEAGYHLLKGANAEVDKVAARMIKDKGINYLYSYAKLNFKNLEKAKAICE. 303
213 7.000e-72UniRef50_A0A2V6BIM3 Ribonuclease HII n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2V6BIM3_9BACT  ali  16  7.........................................................................FRYEKKLRITGVARIAGIDEAGRGALAGPVVAAAVILPAKFRHRRL-----NDSKQLAPDLREEIYSDLVSNVRWTVGIIDSIEIDRINILR-----ASHQAMRMAIGAL---IDPPDHVLIDG----------LPVIPFPFPQTAIVDGDCISLSIAAASVIAKVTRDRMMRDQFPQYCFDRHKGYGT---ELHLLRLHEFGPCPIH---RRSFEPVAQALEDITQ 212
214 7.000e-72UniRef50_A0A1I1WVU9 Ribonuclease HII n=8 Tax=root TaxID=1 RepID=A0A1I1WVU9_9PROT  ali  19  40.....................................................................................ELTCGVDEAGRGPLAGPVYAACVVLNADYKID-----GLADSKVLSEKRRNELAMTIKKYAKWAIASASVQEIDQLNIL-----QASLLAMKRAVESL---PLIPDIVLIDGNQSPHL----------KCSVRTIIRGDSLIPEISAASILAKTARDAEMQRWHPQYGFDQHKGYATP---QHLTALQTHGACEIH---RQSFAPVRALK..... 224
215 7.000e-72UniRef50_A0A2E8S0S4 Ribonuclease HIII n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E8S0S4_9DELT  ali  33  24.QKTITLTISTLEAARIRSLLEHGDFEFGEAPYALWRARGTDCTATFYTKGKVVLQGAGAQEWAEQIDAGQTLSIVFADPFQDAMDLHIGIDETGKGDYFGPLVVTAAAVNRDQ-VDLLRELGIADSKKIADAKIKKMAADLKACCSYEQIVIGVARYNDLYAKIGNLNRLLGWAHARVLENLLEKEPDCTFALSDQFARDERVVGRYLGERGRSIRYHQRTKGESDPAVAVASIIARAEFLWQMKRLGEKAGFTVPKGAGAGVITAGRRIIEEHGRDALKDFAKLHFSTTDKL...... 323
216 8.000e-72UniRef50_Q6TNR0 Ribonuclease n=54 Tax=Eumetazoa TaxID=6072 RepID=Q6TNR0_DANRE  ali  16  21..............................................................................PDLCKTEDCCLGIDEAGRGPVLGPMVYGICFCPVS-RKEDLKNLKVADSKTLTEAERENLFVKLKSFVGWALQILSPNMISMLQRAKYNLNALSHDAAIGLVQYALDSGVQLKEVFVDTVGPAEKYQDKLSQRFPGVEVTVRPKADSLFPIVSAASICAKVARDHAVKSWKFAEDLDTDYGSGYPNDPKTKSWLLKYPVFGYPQFVRFSWSTAQTLLDSK.. 249
217 8.000e-72UniRef50_UPI000CE9D70F ribonuclease HIII n=1 Tax=Candidatus Gastranaerophilus sp. (ex Termes propinquus) TaxID=2029980 RepID=UPI000CE9D70F  ali  38  1.MNTYSAKFNLIEIEKYKNIFKTLEATFSKPAYMIFQARGEGFTASFYESGKFVIQGVKTQELLEKYLPQVPQMPLAPCALEAVPLPHIGIDESGKGDFFGPLVIAGALLDESSA-KICLELGVCDSKKLNDKKILQLAVEIRKLCVHDIIAISPKKYNELYGSFKNLNKLLAWGHATVLENILSKKP-CELAISDKFAD-ENVILRALKERGKSIKLIQRTKAEEDIAVACASVLARAGFVNGTAKLSGQFELDFPKGASPKVVEAGQKFVQKYGEAELKNVAKLHFKT.......... 288
218 9.000e-72UniRef50_I4EGJ7 Ribonuclease HII n=2 Tax=Bacteria TaxID=2 RepID=I4EGJ7_9CHLR  ali  18  5...................................................................QAPNPSPAIEQRLWERGLRLVAGVDEAGRGCLAGPVVAAACILPAG----LTEIPGVRDSKLLTPAQRRELYLTIHEAIAIGVGAASRREIDRYNIRV-----ASVLAMQRALARAGI----WDHALCDGPMPPELDPRRHSG---------IVDGDAICLSIAAASIVAKVTRDALMARLHPEFGWERNAGYGT---AAHLDALQRFGPTPHH---RRTFAPVRAVL..... 208
219 9.000e-72UniRef50_A0A2A4ZWW7 Multifunctional fusion protein n=5 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A4ZWW7_9BACT  ali  20  5.....................................................................................KLTAGVDEAGRGPLAGPVXAAAVILPEXHSIE-----GLRDSKKLTEKRREELFEEIKEAVSIGVGIIHEDEIDRTNIL-----AATHKAMRIAISQLNPQP---KLALIDGYALPDQI----------VPNRGIIGGDDKMPSISAASIVAKVTRDRIMRNYYPEYGFDRNKGYGT---REHINALLNHMACPIH---RKSFRPVRDHL..... 189
220 1.000e-71UniRef50_Q21HI6 Ribonuclease HII n=1171 Tax=root TaxID=1 RepID=RNH2_SACD2  ali  20  9.....................................................................................QFVAGVDEVGRGPLAGDVVAAAVILGEDHGIE-----GLADSKKITEKKRDALFDVIQEAVSFCIARASVEEIDELNILH-----ASLLAMKRAVEGLNIQP---QYIYVDGNKLPKWTYSAE----------AVVKGDSLVEEISAASILAKVTRDREMDEKYPGYGLAGHKGYPTKV---HMDALKRLGPTIIH---RKSFAPVRAAIEQMN. 197
221 1.000e-71UniRef50_Q8A293 Ribonuclease HII n=1791 Tax=root TaxID=1 RepID=RNH2_BACTN  ali  21  13........................................................................................AGCDEAGRGCLAGSVYAAAVILPKDFKNELL-----NDSKQLTEKQRYALREVIKEALAWAVGVVSPEEIDEINILR-----ASFLAMHRAVDQLSVRP---QHLLIDGNRFNK---------YPDIPHTTVIKGDGKYLSIAAASILAKTYRDDYMNRLYPFYDWNKNKGYPTK---KHRAAIAEHGTTPYH---RMTF............ 188
222 1.000e-71UniRef50_S2K054 Ribonuclease n=10 Tax=Mucorales TaxID=4827 RepID=S2K054_MUCC1  ali  17  26....................................................................SNVPSALVENRPDKVNEPCVLGVDEAGRGPCLGPMVYAVSYCPLSRHQEF-KKLGFDDSKKLTEEKRTQLAQTIKDWVGWAVYVISPQDISTNMHKRYNLNEMAHDATIKLIRQVIDSRVNLEEIYVDPVGPSSSYKSKLQSHFPGIAITVEPKADSLYPIVSAASICAKVTRDQFVQNWEADLALSKNFGSGYPSDPNTVKWMNENEVFGFPSIMRFSWKTIQRMMQSRN. 266
223 1.000e-71UniRef50_W7CKK5 Ribonuclease HIII n=3 Tax=Listeria weihenstephanensis TaxID=1006155 RepID=W7CKK5_9LIST  ali  27  10..........................SANIPAGAIFAAKKPGLSITAYKSGKVMFQGTAGEREAAKWGTATTPKAKTAKVLPVGFKNVAGSDEVGTGDYFGPMIVSACYVDQAM-MPLLKQLGVKDSKAMTDPEICSIAKKIIPVVPHSTLVLPNPKYNELQANGMNQGQMKAILHNRALENVLTKPIKPDAILIDQFAEKNTYYRYLAKEPTVVRENVFTKAEGLHLAVAAASIIARSRFVEAFREMELELGLSIPKGAGARVDQVAADILDSKGEVTLQKYTKWHFANTTKAKNLSR. 291
224 1.000e-71UniRef50_E2SR53 Ribonuclease HIII n=11 Tax=Firmicutes TaxID=1239 RepID=E2SR53_9FIRM  ali  28  27............................KTPPYALYQIKTSDCVITAYESGKVVFQGNGAEECAALLSPSAKPQEKKRPAYSKEIYPQAGSDEVGTGDYFGPVTVCATYVT-AQDVEFLREQGIQDSKAIDDTAIRRMAPKLIERLPHSLLILDNATYNRIHGE-NNMVAIKSRMHNQAYVHLRKKGALPEFCIIDQFVQKSSYYRYLQKERDVVYDIHFETKAEKYLSVAAGSIIARYAFLKSFDAMCERYDFTFLKGAGSKVDANIRDFVAIHGKEALFQVAKLHFANTKKALG.... 299
225 1.000e-71UniRef50_A0A1Z9FMZ1 Ribonuclease n=1 Tax=Verrucomicrobiaceae bacterium TMED137 TaxID=1986879 RepID=A0A1Z9FMZ1_9BACT  ali  36  5...TYTLALSDEQVTILKACLLRDGFEFKEKEHVLYSAKKGKLNVTVYRKGKVLVQGKETEDFVKFVLEPEVVGEYEEHWQAEMFEPHFGIDESGKGDYFGPLIVAGVY-TNCEITRALMNAGIMDSKRISGNRVRELAGEIRAEVGYKVIRWAPSRYNLLYEEYNNVNLMLARGHATVIKDLSVRVPSCGRALSDQFTKAPL-IARELKNRGVRLNLEERTKAENDIAVAAASILARESFLDWMDKVSGKIGLELPFGAGSAVKEVAREFIQKFGKEKLGEVVKLHFKTTDEI...... 301
226 1.000e-71UniRef50_C6D2Z0 Ribonuclease HII n=25 Tax=Bacteria TaxID=2 RepID=C6D2Z0_PAESJ  ali  20  1........................................................................MLEYEERLWAEGYSAIAGVDEVGRGCLFGDVVAAAVILP-----PHLVLEGVNDSKKLSEKKRNELYDIIVDQIAWAAARVDAETIDRINIK-----QAARLAMKIALESLK---TEPDYFLVDA-----------EKVDLPKPQLAIIKGDATSQSIAAASIIAKVTRDRLWEQLYPEYGIAIHKGYATK---LHRERLLEYGASPLH---RKSF............ 191
227 2.000e-71UniRef50_Q3IIW9 Ribonuclease HII n=213 Tax=root TaxID=1 RepID=RNH2_PSEHT  ali  21  2..............................................................................QIERPNVALIAGVDEVGRGPLVGDVVTAAVILDPSKPIA-----GLADSKKLTDKKRQALAIEIQEALCYAYGRCSPTEIDELNILH-----ATMLAMTRAVEGLSTQP---EFVFIDGNRLPKL----------TMPAQAIVKGDSLVAEISAASILAKVARDNEMDKRHPEYGFAGHKGYPTK---AHFAALEQYGAIKEH---RKSFKPVQRVLAQAK. 197
228 2.000e-71UniRef50_A0A1Q7NCW6 Ribonuclease HII n=13 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7NCW6_9BACT  ali  17  6.............LKEIQDKYASGGVSVSS---AILRGLQRDPRAGARRLYKVL--AKRYEEQKKERNRLDAMLHFERLLWKAGIQHIAGVDEVGMGPLAGPVVAAAVIFPRGVEID-----GIDDSKALDEETRNRLQREIHRASAVAIGVVEVEEIDRINIYRAGI-----RAMQLALENL---PLTPQHILVDSRTIPGFIQ----------PQNSFDKGDGINFSIAAASIVAKVYRDGLMTELYPGYGFAGHKGYATP---EHQRAIRELGPCPIH---RRSFDYIREI...... 256
229 2.000e-71UniRef50_A0A1J6WLD4 Ribonuclease HII n=3 Tax=Bacilli TaxID=91061 RepID=A0A1J6WLD4_9BACI  ali  16  57..........................................................................FFEKKLYKEGFSLVAGIDEVGRGPLAGPVVAAAVILHPDFYLA-----GLNDSKKLSEAKRDEYFKVIQEKASIGIGMIEAGEIDIINIY-----EATKKAMLLAISNLD---CNPDFLLIDA-----------MKLQTPYPQESIIKGDSKSISIAAASVIAKVTRDNLMKEYYPGYGFDQNAGYGT---REHLEGLNLRGITPIH---RRSFAPVKDY...... 250
230 2.000e-71UniRef50_Q0AWX1 Ribonuclease HII n=11 Tax=root TaxID=1 RepID=RNH2_SYNWW  ali  21  31..........................................................KQKYLLDEVKRIEDLKRYEYEAYNNGFRYIAGIDEAGRGPIAGPVMAAAVILSRDFFCP-----GINDSKKLTALKRSKLAAEIKKAISWSVAAVFPSYLDKVNIL-----NATREAMLLAVKNLSPRP---EFLLIDAVQLPD----------IDIKQYPLIKGDSLSVSIAAASILAKVERDRVMDSLYPGYGFSRHKGYAT---REHLQSLLRLGTCALH---RVSFEPVKSM...... 241
231 2.000e-71UniRef50_A0A2D5W786 Ribonuclease HIII n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5W786_9BACT  ali  31  128.QKTIVIKLPPGQHGQLQQRLAEAGLSFQPVPHAKFSARGQGVVATLYKSGKLVVQGAEPELFTGRFLEEAPRAKKEAEAIPRRACATLGSDECGKGDYFGPLVVVAVLL-EEEDVAELTASGLAESKRISDERALAMGAALRERYPYAVRRLDPPEYNRAHGELRNLNPLLARLHGEAIRELARPGL---HVLVDQFGKEELVAGEVSDLDIDLEQRP---RAEEHPAVAAASVIARQEFLEALAELSREAAVDLRKGAGTPVDRAGREYVSIHGEEALGRVAKLHFKNTTRVLA.... 420
232 2.000e-71UniRef50_A0A1S1BQ84 Ribonuclease HII n=25 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1S1BQ84_9LACT  ali  21  58.....................................................................IQELRAYEDQLRAQGYAYIAGVDEVGRGPLAGPVVTCAVILPPDMP-----AVYFNDSKQLSHKKRQGLVADIDKALACEIAFSPADRIDHINIL-----QATKEAMAASVNQLQPQ---ASYVLVDAVTIP----------GISQPQEAIIKGDARIYSIAAASIYAKEYRDRLMADLYPEYGFDQHAGYGTKV---HLEALAKYGPCPIH---RKSFAPVKDFI..... 258
233 2.000e-71UniRef50_A0A0G1I1R1 Ribonuclease HII n=3 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1I1R1_9BACT  ali  14  4...................................................................KRESPTTKHETALIDAGHELIIGIDEVGAGCLAGPVVACAVGLGAEFFEKWPEISGLRDSKMLSAKRREHFSELLLNNVTFAIGSASPEEIDKINILR-----ATHLAMRRAIEELRIKNKELEIVLVDGSRHISEL---------SIPQQAIVGGDRRVFVIAAASVIAKVYRDKLMTEQFPEYGLTIHKGYGTK---AHCAAIREYGPCSIH---RISFKPIR........ 217
234 2.000e-71UniRef50_Q024M2 Ribonuclease HII n=45 Tax=Bacteria TaxID=2 RepID=RNH2_SOLUE  ali  21  15..........................................................................TLERELRARGFRAVAGVDEVGRGALFGAVFAGAVILSEERPIR-----GLNDSKQLDPERREVLAGRIREAVAWSIAAVDASTIDSINIY-----QASRMAMRIAVSRLSPAP---DFLLVDAV-----------PLEFAVPQRALIKGDERCHAIAAASILAKVARDECMDKVFPEYGLASHKGYSTP---EHYRAIEQYGPTPLH---RLSFEPVR........ 206
235 2.000e-71UniRef50_A0A2A8CTJ6 Ribonuclease HII n=2 Tax=Rhodothermaceae TaxID=563843 RepID=A0A2A8CTJ6_9BACT  ali  21  1........................................................................MLEHERRLWTSGYQYVAGLDEAGRGCLAGPVVAAAVILPRDIEIPA-----IQDSKSLSETKRDQAREQIEEALAVEVGICSPQEIDELNILH-----ASLEAMRRATNNLSP---GAEYLLVDGNRWIEN---------SAWPYETVVKGDATSQSIAAASIIAKTERDRMMRTLHPEYGWESNVGYPTK---QHYKAIAQHGITSFH---RQSFK........... 193
236 3.000e-71UniRef50_P43808 Ribonuclease HII n=304 Tax=Bacteria TaxID=2 RepID=RNH2_HAEIN  ali  22  3...............................................................................EYPQGYKLIAGVDEVGRGPLVGAVVTAAVILDPHNPIE-----GLADSKKLSEKKRLALAEEIKEKAAWALGRAEADEIDEINIL-----QASLLAMTRAVKSLKIQPH---FVLIDGNKIPK---------DLAIPAQAVVKGDSLVAEISAASILAKVARDQEMEELYPEYAFAQHKGYPTK---LHLEKLAELGALPQH---RRSFAPVKKALEQ... 196
237 3.000e-71UniRef50_A0A239H1N6 Ribonuclease HII n=4 Tax=Acidobacteria TaxID=57723 RepID=A0A239H1N6_9BACT  ali  19  17................................................RTPKVVPSPVGKQTAKQKMLRQLVCSDPEQALRYRGAQSIAGVDEVGRGSLFGPVVAAAVILPECMD--SLAGAGLRDSKQLTREQREELDIEIRRIA----LCISVAEIDAATIDRVNIYQATRLAMLAAVEGLS---LAPDHLLIDA-----------MRLDHPCAQTKLIYGDSLSLSIAAASVVAKVHRDAMMDALHPAYGIASHKGYGTP---AHRRALVEFGPTPLH---RMTFAPVRAA...... 240
238 3.000e-71UniRef50_A0A1J4X9N8 Multifunctional fusion protein n=2 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A1J4X9N8_9BACT  ali  19  1..................................................................MSNPTILNNYENDFWHQGIA-VIGVDEAGRGPLAGPVVAAAV-----QFIPEKVPPGIRDSKKLSENQREKLAPLIKQAIQFGIGIIHEQEIDKKNIL-----QATFLAMRQAMGQMD---LNSQRILVDGKFVIPNQAGN---------QTAIVDGDDKSISIAGASILAKTTRDDMMHLLFPEYGFDKHKGYGA---AQHMEALREFGRCPIH---RRSFRPISD....... 202
239 3.000e-71UniRef50_T0D9C1 Ribonuclease HII n=6 Tax=Alicyclobacillus TaxID=29330 RepID=T0D9C1_ALIAG  ali  21  24...................................................................................GASLYAGVDEVGRGCLAGPVVAAAVIPPTDVHRWEL----VDDSKRLTERKREELAKLIREAIAVGIGVAEVGEIDQLNILR-----ATQLAMGRAVSNLA---HHVEILLVDG----------IYGANSPVPSLPVVRGDHRSLAIGAASIVAKVFRDTYMKQLYPQYGFAANVGYGTK---QHRAALEAYGPTEHH---RMSFAPVREA...... 210
240 3.000e-71UniRef50_Q2JW45 Ribonuclease HII n=60 Tax=Bacteria TaxID=2 RepID=RNH2_SYNJA  ali  18  14......................................................................QPSLKWEGSLWQQGMRRVAGVDEVGRGALAGPVVAAAVILPAHLDPEAL--SGVRDCKQLRPPQRAHWAERIAQALAVGIGSASAAEIDQLNIR-----QATLLAMQRALAQV----GEVEHILLDGLPLAEL----------GSRQTALVKGDQLSLSIAAASIVAKVWRDTLMQSWYPGYGWRTNVGYGT---QEHRLALQRLGPSPQH---RRSFAPLRDL...... 214
241 3.000e-71UniRef50_A0A017RY31 Ribonuclease HII n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A017RY31_9CLOT  ali  17  1........MENYTAKEIQDYLSRCNYEEFIKLKEQLKNETRKSVLNL-----XXXXXXXXXXXXXXXXXXXXXSYYEKQLLSKGIQYIAGVDEVGRGPLAGPVYAAAVILNPDVEI-----LGIKDSKKLTQHQREILSDEIKKKCAYSIGYATPDEIDRFNIL-----NATKLAMKRAIYGLT---VCPEHLLIDA-----------LKLDISISQTSIIKGDDKSNSIGAASIVAKVARDKFMDEMYPEYQFNKNKGYGTK---EHINAIKEYGICEIH---RKTF--LKNIL..... 254
242 4.000e-71UniRef50_A0A2T6DM13 Ribonuclease HII n=1 Tax=Verrucomicrobia bacterium LW23 TaxID=2161867 RepID=A0A2T6DM13_9BACT  ali  22  40.....................................................................PRPDWRFEYQAWAHGLFPVAGVDEAGRGPLAGPVVAAAVILPEGFAHPQLH-----DSKQVKPAVRAELAHVLRTTVEIGLGVATVEEIDAINILR-----ATFLAMRRAVQAL---GPSPAALLIDGNQLP----------GGGLPQIALVEGDARSLSIAAASIIAKEWRDAHMHALHPHYDFPRHKGYAT---AAHRDAIRRHGPCPLH---RRSF............ 234
243 4.000e-71UniRef50_Q1D980 Ribonuclease HII n=82 Tax=Bacteria TaxID=2 RepID=RNH2_MYXXD  ali  21  54..........................................................RQEKNRAEGQRMRKLLRFETELWEQGHTHIAGVDEAGMAPLAGPVVAAAAVLPKGFRLK-----GLDDSKKLDAEKRESLAEAIKDAVAWAVGRAEVEEIDRINIYHAGL-----LAMRRAVEGLSVKP---DHLLVDARTVPE----------CSVPQKGIIKGDALSLSIAAASILAKTTRDRWMAELYPGYGLAAHKGYPTPH---HLQVLREKGVLPIH---RRSFAPVREALG.... 267
244 4.000e-71UniRef50_A0A1Q9JZH9 Ribonuclease HII n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1Q9JZH9_9FIRM  ali  20  44...........................................................................YERKYEACGY--ICGIDEVGRGPLAGPVVAGAVILPKDCDI-----LYINDSKKLSEKKREELYDIIMEAVATGIGMAAPGRIDEINIL-----QATYEAMRQAIQNLA---VTPDILLNDAVTIPKV----------SIRQVPIIKGDAKSISIGAASIIAKVTRDRLMDKVMPEYGFASNKGYGSK---EHIEALKKYGPSPIH---RQSFKNFR........ 234
245 4.000e-71UniRef50_O07874 Ribonuclease HIII n=963 Tax=Bacteria TaxID=2 RepID=RNH3_STRPN  ali  23  1.MASITLTPSEKDIQAFLEHYQT-SLAPSKNPYIRYFLKLPQATVSIYTSGKILLQGEGAEKYASFFGYQAVEQTSGQNL------PLIGTDEVGNGSYFGGLAVVAAFVTPDQH-DFLRKLGVGDSKTLTDQKIRQITPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVKVALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQERFSNPISLEEKAEGKYLSVAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLSFCAKLHFKNTEKAKKRLE. 292
246 4.000e-71UniRef50_UPI0009FA1A12 ribonuclease HII n=1 Tax=Syntrophomonas palmitatica TaxID=402877 RepID=UPI0009FA1A12  ali  18  6..............................................................LERERQRIEDMKGYEHDACRSGARYIAGIDEAGRGPIAGPVVAAAVILPPDFFLPR-----VDDSKKVAAQHRSQLAAAIKEAVAWSIVSVNPPCLDRINIL-----NATREAMRIAVLHLTP---PADFLLIDAVKLSD----------INIRQRSIIKGDSLSVSIACASILAKVERDNKMEDIYPGYGFARHKGYAT---REHLEAIAKIGICPIH---RASFEPVKSIL..... 213
247 4.000e-71UniRef50_A0A0A5GAN1 Ribonuclease HIII n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A0A5GAN1_9BACI  ali  26  1.MSQSVLQLSTSDMNQMKSYYASYM-KEKTPQGAIFAAKLPRCSITAYRSGKVLFQGANHSQEANKWGKVNKTQTTAKQATPTRYTPHAGSDEAGTGDYFGPITVACAYIQESQ-IDTLKRIGVRDSKHLKDPEIQQIARKIVEMIPYSLVVLRNEKYNVLQKRGWSQGKMKTMLHHYAYKKLCTKLAVPEGWIIDQFAQPDVYKRHLASEKASLPTYFLTKAESYSIAVATGSIIARSAFVKQMNNLSKEAGMELPKGASKYVDQAAATLIQTHGDDALKRYAKVHFANTDKAYK.... 308
248 4.000e-71UniRef50_A0A1W6N602 Ribonuclease HII n=1 Tax=Candidatus Nucleicultrix amoebiphila FS5 TaxID=1414854 RepID=A0A1W6N602_9PROT  ali  18  2.......................................................................PSFDLEEQY----PGIVVGVDEAGRGPWAGPVVAAAMIIERNKFPKSL-LHHINDSKALSQQKREKLFEALIKACFFGIGQASVEEIDQ-----YNILQATYLSMDRAVKAL---PTLPDVVLIDGRGQPK----------WSYKTLSVIKGDSLSYSIAAASIIAKVTRDHIMHDLHPEYGWKTNAGYGT---ELHQKALMAHGLTSHH---RRSFRPIKDI...... 202
249 5.000e-71UniRef50_A0A2V2FRJ8 Ribonuclease HII n=1 Tax=Clostridia bacterium TaxID=2044939 RepID=A0A2V2FRJ8_9FIRM  ali  17  16......................................................FRRKRKMARQSERERLQELTCMERKFWEKEIFP-AGMDEVGRGPLAGPVVAACVILPPAPLIEY-----VNDSKKVSERRREMLAPIIREALAVGIGWADEQEIDQRNIL-----EATKTAFARAYEAMNS---PCAHVLVDAVS----------GLAIPAEQHALIHGDALSYLIAAASIVAKVERDRRMDEAYPHYGFAKNKGYGT---AEHIAAIRRYGPCPLH---RRSF--LKNILE.... 229
250 6.000e-71UniRef50_A0A061NCF0 Ribonuclease HII n=2 Tax=Bacillales TaxID=1385 RepID=A0A061NCF0_9BACL  ali  17  20.......................................................................................IAGLDEVGRGPLAGPVTTAAVMIPEDVFLP-----GLTDSKKLSKRDRAYFYDEIMSRCTVSIGEASVEEIDEFNIY-----EATKLAMVRAVTGLK---TIPDHLLVDAMTLP-----------VTIRQTSLIKGDSRSMSIAAASVIAKETRDEYMHEQYPQYGFDQHVGYGT---SAHLQAMDEYGVLPVH---RRSFRPVADRLN.... 201
251 6.000e-71UniRef50_Q8CPL8 Ribonuclease HIII n=155 Tax=Bacteria TaxID=2 RepID=RNH3_STAES  ali  25  1.MGNVVYKLTSKEIQSLMA--QTTFETTKLPQGMKARTRYQNTVINIYSSGKVMFQGKNADQLASQLLPDKKHTSSNTTSIQYNRFHCIGSDEAGSGDYFGPLTVCAAYVSQS-HIKILKELGVDDSKKLNDTKIVDLAEQLITFIPHSLLTLDNVKYNERQSIGWSQVKMKAVLHNEAIKNVLQKIDQLDYIVIDQFAKREVYQHYALSALPPDKTKFETKGESKSLAIAVASIISRYAFVKHMDHISKKLHMEIPKGASNKVDLIAAKVIQKYDIQQLDTISKKHFKNRDKAIHLMNQ 304
252 6.000e-71UniRef50_A0A1Y3CK20 Ribonuclease HII n=34 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y3CK20_9GAMM  ali  19  2......................................................................................LVAGVDEAGRGPLVGSVVAAAVILDPNNPIE-----GLNDSKKLTEKKREKLFKEIQEAIAWAIAEASHLEIDEINIL-----QASLLAMRRAVEALK---VPAEHVLVDGNKVP---------QGLVVSCDAVVGGDAIHAEISAASILAKVTRDHDMDKLYPQYGFAQHKGYPTK---AHFEAIAIHGVIDQH---RRSYAPVKRALG.... 187
253 6.000e-71UniRef50_B2UMR6 Ribonuclease n=27 Tax=Verrucomicrobiales TaxID=48461 RepID=B2UMR6_AKKM8  ali  42  2........LTDAQAGRLESILEEKGFERREIPYARFSFAGPSLLATVYEKKKLLLQGKGTDDFIEFTLEPQVLAQPEEMEKGCGFVPHFGIDESGKGDYFGPLVVAGVYVDGGIG-AALRKLGVCDSKLVSSSRIRCLAEGIRRVIRFHLVSIGPERYNQLYPEFGNLNRFLAWGHATVIEGLAAKVPDCPMALSDQFANP-FVLKRALAAKKVCVRLEQRVRAESDIAVAAASILARERFVNWMDAAGEGAGMKLPLGASGQVVKAARQLVALHGEEMLPKVAKMHFKTTRNVLK.... 294
254 7.000e-71UniRef50_A0A1I5MD52 Ribonuclease HII n=22 Tax=Bacteria TaxID=2 RepID=A0A1I5MD52_9BACI  ali  16  43.........................................................KHREAEKVREAAFLDSLFFENQYREQGFTAAAGVDEVGRGPLAGPVTAAAAILPRNCFLP-----GLTDSKKLKKEERNYFYEKLTAEAVYHIVHVPADVIDDINIY-----QASRKAMKQAVEGLRE---EADILLVDAVT-----------ISTSLPQLPLTKGDERSASIAAASVLAKVERDRYMSELYPEYGFDTNAGYGT---AEHLEALNRLGPTPEH---RRSFAPVRD....... 251
255 7.000e-71UniRef50_A0A0A2DSQ1 Ribonuclease HII n=4 Tax=Porphyromonadaceae TaxID=171551 RepID=A0A0A2DSQ1_9PORP  ali  19  12................................................................................WLEKDRIEAGCDEAGRGALAGPVVAASVIWLPDNPHLLDLLPSLNDSKKLTGKRRETLFDRICSCSAFSIVEIDPATIDRINIY-----QASCLAMSRAAENLKLSP---DHLLIDGNRFTPSTF---------IPYTCLVKGDARFASIASASILAKVHRDRVMHELYPEYGFDKHVGYPTPS---HKAIIRKIGLSPIH---RKSYKPCMQML..... 207
256 7.000e-71UniRef50_A0A2D6E4W6 Ribonuclease HII n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6E4W6_9BACT  ali  19  2.....................................................................QTPNLQLERSLYRRGHKTIAGADEAGRGAWAGPLVAAAVILPTTIKLPTLRKVGLNDSKLLNPKSRVLAWEWITNNCWWGVGQVPEQEIDK-----HGLSWANQKAIELALAGLSS---NFDWVLIDG-----------RVKIPSRKHSCIIAGDSKSYSIAAASIVAKVTRDRLMQKLSKKHKFETHKGYGT---RAHQQALQKHGICVLH---RKSFAPIAELVN.... 206
257 7.000e-71UniRef50_A0A0G1XRD9 Ribonuclease HII n=15 Tax=Bacteria TaxID=2 RepID=A0A0G1XRD9_9BACT  ali  18  4....................................................................KSPPTFKIERELLAQGFQRIVGVDEAGCGALAGPVVAAAVILPVDSRLGAL-----RDSKLLSQRRREELYPLIIEAVAWSVGMASVDEIERLNIRGANL-----LAMRRAVEAMDDQLNRIDYVLVDAWTIPGVM----------VPQRGIIRGDLKVKSIAAASVIAKVTRDRLMAELFPVYGFEVHKGYATKV---HRTAIALHGPCSHHRLGYKTF............ 209
258 8.000e-71UniRef50_A4IRL5 Ribonuclease HIII n=5 Tax=Geobacillus TaxID=129337 RepID=A4IRL5_GEOTN  ali  25  1.MSNYVIHADQKLLATLRAYYKDA-LSDRLPAGALFAAKRPDVTITAYRSGKVLFQGKAAEQEAAKWMENHTAPENKQKDQNRGSLSAIGSDEVGTGDYFGPIVVAAAYVDRG-HLDRIAALGVKDSKQLNDETITRIAPTIMETVPYAVTVLTNAEYNRWQQSGMPQTKMKALLHNRTLAKLIDDPIEPEAIIIDQFLERNSYFRYLEDETRIVRERVLPKAEGVHVAVAAASIIARYMFLAEMDKLSRTVGLPLPKGAGAIVDEAAAQLIRQQGVGALETCAKLHFANTKKALDIAKH 312
259 8.000e-71UniRef50_A0A2W5FKJ5 Ribonuclease HII n=1 Tax=Micavibrio aeruginosavorus TaxID=349221 RepID=A0A2W5FKJ5_9PROT  ali  17  13.....................................................................KRPSFNLEQS------GVICGCDEAGRGPLAGPVTAACVFIPHEKRSYKIWE-KVRDSKLLSPKERENIFDDLREKSCFGIASASVEEIDEINIL-----QAAILAMKRATENMCQNFDICDLALIDGNYKP---------QQFPYPTQPVIKGDMLSVSIAAASILAKVTRDRIMKELHPHYGWLSNAGYATPV---HLHALRQYGPCAHH---RRKFSKVKELL..... 215
260 8.000e-71UniRef50_A0A1W9SAZ4 Ribonuclease HIII n=1 Tax=Tenericutes bacterium 4572_104 TaxID=1971635 RepID=A0A1W9SAZ4_9BACT  ali  23  2...NYDFVIDEHNLEKLVNYYHQF-LEEKKDSRILYSFKSPDFKITIYNTKKVLFQGKRAFEEYSLWAEYEVKKPVDKSIYINEYEAVIGSDEVGTGDFFGPVVVCAALVSP-KDYEELDKLNVRDSKNLNDKQIISMGSKLIQTIPYHILVLSPAKFNDLTAKGYNMNKIKAYLHNHAIKKMVSKHKYFDRVIIDEFCSKKLYFDYLKDEEIYKNVTFHTKAESIHKSVAVASIIARYKFILEIDRISKSIGITLPKGSGPSTDAIGRLIYLQHGKDYFYKIAKINFKNMNKIINQ... 298
261 8.000e-71UniRef50_M2XQW9 Ribonuclease n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2XQW9_GALSU  ali  17  81.................................................................EFTRVLELTEEERKWRDKGYEVIVGVDEAGRGPLAGPVVAAACILPPDVLFE-----GLNDSKKLSPSQRNILYENIQKAIEYAIGQVDHHTIDQVNIF-----QATMMAVQDALRQLRTKP---DMVIADGPHW---------KLTLDIPLVGVIKGDNTILSVCAASILAKETRDRWMIKDYPEYGFEKHKGYGT---AFHLKAIQTFGPSALH---RMSFRP.......... 281
262 9.000e-71UniRef50_Q72DU5 Ribonuclease HII n=25 Tax=Deltaproteobacteria TaxID=28221 RepID=RNH2_DESVH  ali  20  19........................................................................................AGIDEAGRGCLAGPVVAAAVILPQEYALP-----GLTDSKKLTAARRESLAEGIRSAVTWGIGVVWPRDIDRINIL-----QATFRAMARAVRVLRQPPP---AILIDGKTLPPHVLTSLSCDGHLPTQRAIIGGDGCIPAISAASILAKTFRDRLMDTLYHGYGFAKHKGYGT---AEHLAAIAAHGPCAQH---RLTFRGVR........ 208
263 1.000e-70UniRef50_A0A1G3Q276 Ribonuclease HII n=1 Tax=Spirochaetes bacterium GWF1_49_6 TaxID=1802189 RepID=A0A1G3Q276_9SPIR  ali  20  5....................................................................SKDVLLSFENELLQKGYSHIAGIDEAGRGPIAGPVVAACVLFKQPAFIE-----GVWDSKMVSAAERERLYDRILESCAYGVGIIDNLIIDKINIL-----EATKLAMRTALEQVIGSGKGAHYVLIDAV-----------KLQSDIPMQAIIKGDSKSFSIGAASIIAKVTRDRLMHEEYPDYAWDRNKGYPT---LLHRELVRKHGLTPYH---RRSFR........... 202
264 1.000e-70UniRef50_K1LQ61 Ribonuclease HIII n=3 Tax=Facklamia ignava TaxID=137730 RepID=K1LQ61_9LACT  ali  26  1.MKQHTLKMTPSQLQ--QLKQYYQPHLTSSVPYSVFRAVHQQTTITAYTSGKVLFQGNHTLNELQQLSQQPNTQTRSVSTMVSQQYCVIGSDEVGNGSYFGSLVVASVYLRP-EDIDWVKALKVNDSKKLTDPQIEAIAPKLMERLFYNVIEVSPKQYNKVMGIKYNAVSLKVMMHYTNCQQLLQKIENLERIIIDQFTTPKNFYHYLTGRETIDRSLILFKAESQYLSVACASIIARHLFLESLRRFGAPYQCTLPSGAGTQVDQVGRELTQKYGAAILDEIAKLHFRNTEKILN.... 310
265 1.000e-70UniRef50_D0NJ61 Ribonuclease n=3 Tax=Eukaryota TaxID=2759 RepID=D0NJ61_PHYIT  ali  18  35...........................................................................FETRYEAKGYTTVIGVDEAGRGPLAGPVVAAACHVPLDVTIA-----GIDDSKKILEPQREALFELLTSNITYAVHVNSPQRIDDINIL-----QASLESMTKSVNEVAQQLQQKDFVLVDGNKLPPTL---------ELPAEAVVKGDSKVYSIAAASIIAKVTRDRLMREYFPQYGLAQHKGYPT---RDHVAAIAKHGPCEIH---RMTFAPLK........ 233
266 1.000e-70UniRef50_A0A174D1S8 Ribonuclease HII n=20 Tax=Firmicutes TaxID=1239 RepID=A0A174D1S8_9FIRM  ali  18  61.........................................................................WKYEREYG--MYTRICGIDEVGRGPLAGPVVAGAVILPKDCDI-----LYINDSKKLSAAKREELYDVIMEAVAVGIGMVGPERIDEINIL-----QATYEAMREAISKL---GDAPDILLNDAVTIP----------GVAIRQVPIIKGDAKSISIGAASIVAKVTRDRLMDKIMPGYGFAANKGYGS---AEHIAALKKYGPTPIH---RRSF............ 248
267 1.000e-70UniRef50_A0A1A8V6N6 Ribonuclease n=38 Tax=Bilateria TaxID=33213 RepID=A0A1A8V6N6_NOTFU  ali  18  21..............................................................................PDVCRTEDCCLGVDEAGRGPVLGPMVYGICFCPVSQK-EELKALKVADSKTLTEAERENLFQKLEEAVGWALQILSPNVISMLQRTKYNLNALSHDTAIGLVQFALDSGVQVKEVYVDTVGPAEKYEEKLSQHFPGVQVTVRPKADSLFPIVSAASICAKVARDHAVEGWFPELGMDGAYGSGYPNDPKTKAWLLKYPVFGFPQFVRFSWSTAQTQLDSK.. 249
268 2.000e-70UniRef50_A0A1W6CWX9 Ribonuclease HII n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1W6CWX9_9RHOB  ali  20  5....................................................................RARPTLRHEKACIAEGARFVCGVDEVGRGPLAGPVTAAAVILP-----ARGIPRGIDDSKKLSPARRESLARRIEACAIWAVAHASVDEIAALNI-----HHAAHLAMCRAVAAL---GQAPCAVLVDGRHVP---------RELGRPARAIVRGDAQSLSIAAASILAKVARDRIMVDLHPGYGWDRNMGYPTLT---HRRALAERGPTPLH---RMGFPAMRKIL..... 206
269 2.000e-70UniRef50_A0A2S8PN00 Ribonuclease HII n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A2S8PN00_9BACL  ali  22  91.........................................................KDSMDTEEIEQSPKDLLKYEREYIEKDYRYIAGVDEVGRGCLFGDVVAAAVILPEG-----LVLEGVDDSKKLSAKKRDLLYDVIMEALAVSVGYVDARTIDEINIK-----QAARLAMKKAVLGLT---IAADFLLVDA-----------EHVDVPVPQLAIIKGDANSQSIAAASIVAKVSRDRLWEAKYPEYGIAIHKGYATK---LHREQLAALGPTPMH---RRSF............ 296
270 2.000e-70UniRef50_A0A2A2RVK0 Ribonuclease n=14 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2A2RVK0_9BACT  ali  33  17..TSYTIKLDDAQMKKLQAACAAKHWETAEVPYARFAFKGPKVNVTAYTSGKVVVAGKETEEFVQNVIEAEPKLGYDEVLHPDWFEPHAGLDESGKGDLFGPVVAATVIAEGDAVRSWLAA-GVRDSKTIVDAQILKLDDLIRATVVVEVRHLDMAEYNRTMLQFASLNRLLAQHHADALDAALQKKWVPRGLL-DQFSKEPLVQRVMKKKGLERFDLQMRTKAEEDPVVAAASIVARAEFVRLMHALSREFGDKLQKGAGALAKAQASLLIEKLGARSLGHFAKLHFRTCYEVVAAAGK 319
271 2.000e-70UniRef50_A0A1D1V9M8 Ribonuclease n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1V9M8_RAMVA  ali  15  28.....................................................................................QVIMGIDEAGRGPVLGPMVYGACYV-ASQDQSLLSSLKVADSKTLNEEQRDACFEKIQESAGWIAQILSPSRISRSMLSKYNLNAISHDSAMFLIQSVRDMGVKISAVFVDTVGDPDKYQAKLKERFPTIPITVSKKADSLFPVVSAASVVAKVCRDQALKEWRFKEGSRFPYGSGYPGDPATKRFLEDYPVFGYPQLIRFSWATTTKALESA.. 251
272 2.000e-70UniRef50_A0A2E7PYH8 Ribonuclease n=1 Tax=Opitutales bacterium TaxID=2026772 RepID=A0A2E7PYH8_9BACT  ali  31  236.KSSYNLTLTSEQMDKLGQALSSRGWPSREVQYARHAFDGDQVKVVAYESGKLVVQGKGTEDFVAHILEPEVTGEYEEVNNPEWFEPHAGLDESGKGDLFGPVVSACVIADGNMVRKWM-DAGIRDSKTITDGAILKMAKTIAGTQGVVIKTAGMLKYNELYLKGENLNKFLAWLHGRALNDALA-LRKPKWGLLDQFSKQPLVQKYVEEEDFDLQ---MRTKAESDPVVAAASVIARATWLDQMKKLEEKAGRSIPKGSGAQAKEVATALFEELGEERMREFCKMHFKTAYEAMGKK.. 534
273 2.000e-70UniRef50_Q3Z8D7 Ribonuclease HII n=40 Tax=root TaxID=1 RepID=RNH2_DEHM1  ali  17  7.......................................................................PGWAEEKHLWKQGFSSIAGLDEAGRGCLAGPVVAGAVIMPP--RLKGDWVAMVRDSKVLTPEKREYLYCHIVSAISFGVGVVDNTQIDCLGIAP-----ATRLAMKQAVEHLDCRP---DFLLVD----------YLKLPDIPLPQKGIVDGDALCFSIACASIIAKVSRDRLMCELYPGYHLAKHKGYGT---ALHMECISQKGISPIH---RRTFAPLKSMFD.... 209
274 2.000e-70UniRef50_A0A1V6ADZ1 Ribonuclease HII n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V6ADZ1_9BACT  ali  18  3...................................................................LEITDHYKYEDIAHSEGYAVVAGGDEAGRGPWAGPVCAAMVVLPTNFKIP-----GLDDSKKLSRKKRQKLYKEIIEHITYGIGMASPEEIDKINIL-----EATRLAFDRALKQL---NPEPDYILLDCIKLPKLLE-------LGIPHQAFVKGETISASVAAASILAKESRDLLMEEMYPGYGFEKHMGYGTK---LHVDCLNKLGPCEIH---RKSYAPIKAI...... 207
275 2.000e-70UniRef50_A0A1G9XK28 Ribonuclease HII n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1G9XK28_9BACL  ali  17  1........................................................................MLEHEKLIWEQGFTLVAGIDEVGRGCLFGDVVAAAVILPIGYVLD-----GVDDSKKLSEKKRDVFYDQIMEAIAVGIGIVDVDMIEEINIK-----QAARLAMKQAVEQLS---IVPDYLLVDA-----------ENVNVDVKQTSLIHGDALSQSIAAASIIAKVTRDRMWDEQFPEYGLAIHKGYATKH---HREMLLRYGPTPLH---RKLF--IRKVMAQLEE 200
276 2.000e-70UniRef50_A0A1Q7ZEX0 Ribonuclease HII n=5 Tax=Bacteria TaxID=2 RepID=A0A1Q7ZEX0_9BACT  ali  21  10...........................................................................HERQLFAAGLRAVAGVDEVGRGCLAGPVVAGAVILDRSRPVA-----GVRDSKTLGAAARERLAREIARAVAFALGVVDPEEIDRTDILR-----ATLEAMRRAVMALRVRP---DFVLVDALNIPA----------IDVPQRGLVRGDRISVSIAAASIVAKFYRDEMMHDLYPAYGFDQHKGYGT---SEHLDALRRFGPTPWH---RSTFRGVRQ....... 202
277 2.000e-70UniRef50_A0A2R5G274 Ribonuclease n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5G274_9STRA  ali  16  36.......................................................................PSKDRENGLRKEGFKVVAGADEAGRGPLAGPVVAAACVVPEHVTFE-----GVEDSKRVSETDRERLYHEITSHVSYGISQASPAEIDE-----YNILQASLRAMSRAVAALSPS---ADFVLIDGPHLPKDLPASVQGKE------AVIKGDSKIYAIACASILAKVTRDRIMDKTYPIYGFAKHKGYPT---AAHRAAVATHGPSEVH---RQSFAPV......... 236
278 2.000e-70UniRef50_F2LUU8 Multifunctional fusion protein n=1 Tax=Hippea maritima (strain ATCC 700847 / DSM 10411 / MH2) TaxID=760142 RepID=F2LUU8_HIPMA  ali  23  5........................................................................................AGVDEAGRGPWAGPVVAACVILNKD--IPHLGD--IDDSKKLSPKKREELYRVIKENSIYGIGVVSNKEIDKLGI-----VKAVELAIKRAIDVMDEKP---SFLLIDG----------KDRFDLPIKYKTIIEGDAKVKSIAAASILAKVWRDRYMEDIYPKYGFEKHKGYGTK---AHTLALEKYGPCQIH---RFSFKPIQRVLEKKN. 190
279 2.000e-70UniRef50_A0A0W1SBI6 Ribonuclease HII n=26 Tax=Bacteria TaxID=2 RepID=A0A0W1SBI6_9GAMM  ali  22  2.......................................................................................ICGVDEAGRGPIAGPVVAAAVILDPERPIE-----GLNDSKKLSEKKREKLSIEIKEALYWAIAQSDPDEIEQINIL-----WATMKAMQRSVEAL---PVLPSKVLIDGNRVPEL----------TVPAEAIVGGDASEACIAAASILAKVERDRQMHERYPQYEFNKHKAYGT---ARHIELLKKYGPCPIH---RRDYKPVREALANL.. 187
280 2.000e-70UniRef50_A0A2R5HKB8 Ribonuclease HII n=8 Tax=Lactococcus TaxID=1357 RepID=A0A2R5HKB8_9LACT  ali  21  74.........................................................................LSFEKELYAQGISLIAGVDEVGRGPLAGPVVAGAVILPENCKIP-----GLNDSKQVPKSKHKAMAEAVKEALAYGIGVISPEVIDEVNIY-----EASKLAMMEAIRQLKPQ---AEHLLIDAMTLP-----------LAVEQTKIIHGDARSLSIAAASILAKVARDEMMDKTYPGYDFAHNAGYGT---AKHLEALKKQGITPIH---RKTFEPIRSML..... 269
281 2.000e-70UniRef50_A0A0S8GEL4 Ribonuclease HII n=1 Tax=candidate division WOR_3 bacterium SM23_60 TaxID=1703780 RepID=A0A0S8GEL4_9BACT  ali  20  12....................................................................RQRKVKALQDRNLWRNHSFIAGVDEAGRGPLAGPVVACAVILPRHFYHPE-----IDDSKKLPPKKREELYATIVRALSYAFGIVDSATIDRINIL-----NATKRAMQSAIDELTPQP---DIVLVDGMHLDTCVL----------KQIPLVKGDTLSISIAAASVLAKVERDTIMHKVYPQYHFYRHKGYPTK---LHRQCLSQYGPCPIH---RKTFR........... 207
282 3.000e-70UniRef50_K9AJC5 Ribonuclease HIII n=24 Tax=Staphylococcus TaxID=1279 RepID=K9AJC5_9STAP  ali  26  1.MTNVVLKLKDTEIKQLMSKIK--FEQSKLPQGMKAKCKYKGVTINIYNSNKVMFQGKTAQEVSNQLLQSTPSSASSHPTIPYNQYSCIGSDEAGSGDYFGPLTVCASYVSKDQ-IPLLKTLGVDDSKRLNDTKIVELAEQLVTFIPHSLITLDNVKYNERKALGWSQVKMKAVLHNACITNVLNKIDELDYIVIDQFAKREVYKHYALTEIPDKKTKFETKGESKSLSIAVASIISRYAFVKHMEQIEHKLKLDIPKGASAKVDLQAAKLIQKYDINTLDTYSKRHFKNRDKALDILNK 304
283 3.000e-70UniRef50_A0A2A5D6S1 Ribonuclease HII n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5D6S1_9BACT  ali  21  12.......................................................................PLLEFERQMWNSGIQRIAGVDEAGRGPLAGPVVAAAVILAGPVD-------GVNDSKKLTAAKRERLFGEISQNHAVGIAVIEADEIDRNGIQAANYAAMAQAA--------QGISPLPEFLLVDGFAI----------KGCAIPQKRIIKGDQLSQSIAAASIMAKVTRDRIMVELYPEYGFAKHKGYGT---RAHIEAIEKFGPCHIH---RKSFAPMSKMIE.... 209
284 4.000e-70UniRef50_A0A0C2E6U6 Ribonuclease HII n=6 Tax=Salinicoccus TaxID=45669 RepID=A0A0C2E6U6_9STAP  ali  17  43..........................................................RLEKEAALREKYAAMSRYENE-VRQTAQVIAGVDEAGRGPIAGEVVAAAVILPEGFVLP-----GLDDSKKLSLKKRMAFREIIMQEADYGIGLASVEEIDALNIY-----QASRLAMERAVADLGEKPG---HLLVDAMTV-----------DAGIPETSIIKGDAHSVSIAAASVIAKTERDMRMDKMYPGYDFAAHKGYGTK---DHLKALDALGPCEIH---RQTFEPVKNMI..... 251
285 4.000e-70UniRef50_A0A2M7YJM4 Ribonuclease HII n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7YJM4_9BACT  ali  18  2......................................................................QDIFKEEKKLYKQGYKCVAGLDEAGRGPLAGPVSAAAVMIDRKSVIGDKKFRGIRDSKKLSEKQREEWYEIITSNIGWAVTSVSHEVIDKINIF-----EADKLAMRRAVAKLNRKLQTIDALIIDGNFNIENRSRNIARTVLVAPQKPIIKADEKVFLCMAASIIAKVARDRMMHKKYPRYGFDGHKGYGTK---EHLEAIKKFGPCEIH---RKSFKPMKKNL..... 241
286 4.000e-70UniRef50_Q49X31 Ribonuclease HII n=67 Tax=Terrabacteria group TaxID=1783272 RepID=RNH2_STAS1  ali  15  3...........ETIKDIKSKLQHMLSISELERSEYNNDARKGVQ-------NAMIQRKQLEKEQVLLDNYVKMTEFENSILAENPDLICGIDEVGRGPLAGPVVTCAVILNKNHHF-----TGLNDSKKLSAKQRHSIESKLLNDVAYAYGYASVEEIDEINIY-----EATKLAMHRAIEGLRIKP---THLLVDA-----------MTLDIDIPQTSLIKGDAKSVSIAAASVLAKEHRDQYMRDLYPGYSFENNVGYGT---QQHLDGIKKYGILNEH---RKTFEPIKSLVN.... 256
287 4.000e-70UniRef50_A0A0S7Y205 Ribonuclease HII n=1 Tax=Syntrophobacter sp. DG_60 TaxID=1703361 RepID=A0A0S7Y205_9DELT  ali  18  7...........................................................................LEERFWKKGLT-VAGIDEAGRGCLAGPVVAAAVILNPAPWSKFHYSTGVNDSKKLSPKEREECFDVIQKQAAIGIGLCSAEEIDATNIL-----KASLLAMKRAVEGL---NITPDYLFVDGPYSIDL----------QIPQACIKGGDGKILSIAAASIIAKVIRDQLMQDLFPMYGFEKNKGYPTKS---HKQALSRFGPCYLH---RLSFKP.......... 219
288 5.000e-70UniRef50_A0A1Y4T099 Ribonuclease HII n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Y4T099_9FIRM  ali  22  5.........................................................................LKFEQQAYDLGKKYIVGLDEAGRGPMAGPLVVGAVIFPQGYYNDK-----INDSKKLTEKKREELYQIIQEALAYQIEIIDVADVDRLNVY-----QASKKGMIDAIDHLSIRP---DYALTDA-----------MPLGDVIEHQAIVKGDAKSLSIGAASILAKVTRDHIMAKIYPEYGFEKHKGYPTK---QHKEALKAYGVTPIH---RRSFQPVIDVLNQ... 202
289 5.000e-70UniRef50_Q5KWF4 Ribonuclease HIII n=52 Tax=Bacillaceae TaxID=186817 RepID=RNH3_GEOKA  ali  26  1.MSNYVIQADQQLLDALRAHYQDA-LSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAGKWKRQERETASPPLEHRLEKLSAIGSDEVGTGDYFGPIVVAAAYVDRS-HIAKIAALGVKDSKQLTDEAIHKIAPAIMETAPYAVTVLDNAEYNRWQRSGMPQTKMKALLHNRTLAKLVDAPIEPEAIIIDQFLERGSYFRCLADEIVSDRVHCLPKAESVHVAVAAASIIARYVFLEEMERLSRTVGLLLPKGAGAIVDEAAARIIRERGAEALETCAKLHFANTKKALDIAKH 310
290 5.000e-70UniRef50_D8PHM8 Ribonuclease HII n=22 Tax=Bacteria TaxID=2 RepID=D8PHM8_9BACT  ali  18  12.......................................................................PTEEFEVEARCRGYRHIAGLDEAGRGPLAGPVVAAAVVLPRRCSLP-----GLNDSKQVGESDRVRLFVEIRRATGVGIGAATEAEIDQLNILH-----ATRLAMRRALEAL---PLQPDFLLLDAVTL----------SGLSIPQRSIIKGDGLSCSIAAASIIAKVTRDRLMHRWYPQYNFAEHKGYGTP---EHLRLLREHGPCAIH---RRSFAPVQQL...... 209
291 5.000e-70UniRef50_B3MUH9 Ribonuclease n=28 Tax=Protostomia TaxID=33317 RepID=B3MUH9_DROAN  ali  15  47..............................................................IASKENSKNTVYLSDVPAVCKDKPCMLGVDEAGRGPVLGPMVYGIAYCPL-ESKKALEDLGCADSKQLTEEKRDIIFNDITSCIGWAVEIISPNTISTSMRSKCSLNEVSMDSAMGLIQQAIDAGVNISEVYVDTVGPPEKYQEKLLKRFPTFKITVAKKADSTYPIVSAASICAKVTRDHALKVWNFPEGLDNAFGSGYPGDPVTKRFLAEHIVFGFPRLVRFSWSTAENALADK.. 294
292 5.000e-70UniRef50_B3QRP3 Ribonuclease HII n=4 Tax=Chlorobiales TaxID=191411 RepID=RNH2_CHLT3  ali  20  5...........................................................................FESPYWKK-FQYICGVDEVGRGPLAGPVVAAAVIFDRYFEPSGILEQ-IDDSKALRHETRVLLSSEIKKALSFSIAEISPEVIDEVNIL-----QATFLAMNQAIEQLSP---IPEFLLIDGNRFKTTL---------PIPFETVVKGDSKVFSIAAASIIAKVHRDNFMINLYPEYGFAQHFGYPTK---AHIEAIKMFGRSKVH---RKSFK........... 197
293 5.000e-70UniRef50_F8ABS2 Ribonuclease HII n=14 Tax=root TaxID=1 RepID=F8ABS2_THEID  ali  21  23.........................................................................WEKEKQFYRR-YQYIAGVDEVGRGALAGPVVAAAVILPQDFDHPDL-----ADSKCLTPEKREELYRLIQEAIAWAVAQIENHVIDEIGIL-----KASLKAMAEALEALTPRP---EIALVDGKFVTP----------WVGLQKAIVDGDALCKSIAAASIVAKVTRDHIMIKRFPEYAFEKHKGYATK---QHLEALKAHGPSPFH---RYSFKPISE....... 216
294 6.000e-70UniRef50_E7GLV8 Ribonuclease HII n=20 Tax=Bacteria TaxID=2 RepID=E7GLV8_CLOSY  ali  18  6...........................................................SEKLEQELKRLEQMREYERKY--EEYSVICGIDEAGRGPLAGPVVAAAAVLPKDAVILWL-----NDSKKLSERRREELFLEIREAVAYGVGIVSPAVIDEINIL-----QATYEAMRQAVSQL---PAEPDIFLNDAVMIPG---------INDKKQVRIIKGDAKSVSIAAASVLAKVTRDHMMDKLYPEYGFAKHKGYGTK---AHMDAIREFGVCPIH---RRSFLTKMDLKNE... 217
295 6.000e-70UniRef50_A0A2W1B7I3 Ribonuclease HII n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1B7I3_9CHLR  ali  19  2......................................................................KPTWNYENFLNDQGYLFVAGVDEVGRGPIAGPVVSAAVILDAGADHKWYRD--INDSKALSAGKREKLATLIKDHASFSIASLDSEAVDKMGIVG-----ATKATMLDAILGL---GVKPDHVLVDAVTLPEL----------GVPSTSLFKGDTLCKSIAAASIVAKVARDYEMHDIYPMYGFSKHKGYPS---REHVSNLNKFGPSPIH---RLSFAPVRNF...... 203
296 6.000e-70UniRef50_A0A2N9L4P6 Ribonuclease HII n=3 Tax=Acidobacteriaceae TaxID=204434 RepID=A0A2N9L4P6_9BACT  ali  19  69.........................................................................WRLENAARRSGALRIAGLDEVGRGPMFGPVVAAAVILPEGWRLR-----GLTDSKQLSEEQRNKFAVTIRKAVAWAIAAVDAETIDRINIRR-----ASLLAMRMAVEQLAIAP---DYLLIDGCDTIE----------WACPQQAVVQGDARSLSIAAASVLAKVHRDRLLVELYPGYGLARHKGY---CSQEHLAALARLGPTPLH---RKNWSPVQRML..... 266
297 6.000e-70UniRef50_A0A061FRD3 Ribonuclease (Fragment) n=3 Tax=Eukaryota TaxID=2759 RepID=A0A061FRD3_THECC  ali  16  16.....................................................................................PCIMGIDEAGRGPVLGPMVYGCLYCARS-YQKALATLNFADSKTLKEEKREELFELLKESIGWSVDVIDPRELSAKMLKKHNLNEMSHDSATGLIKTVLNKGVLLTEVYLDTVGDPDKYRIKLSERFPSIKFVVAKKADSLYPVVSGASIVAKVTRDKALREWETAENMHRSFGSGYPGDPETKAWLEKHSVFGFPTLVRFSWGNLIKWMK.... 234
298 6.000e-70UniRef50_A0A0F4LSN2 Ribonuclease HII n=16 Tax=Lactobacillus TaxID=1578 RepID=A0A0F4LSN2_9LACO  ali  21  63..........................................................................QFEESFWQQQ-KLVAGIDEVGRGPLAGPVVTAAVILKPQQVI-----LGINDSKVLSATQRRRLYQNIHQAIAVSVAVGSVQLIDQENIYH-----ATELTMAQAVKHLW---MSPQHLLVDAMIIP-----------LDIPQTKLIKGDARSVSIGAASIVAKVYRDALMAQIYPQYRFDQNFGYGT---AQHLTALKEFGPCPLH---RKSFAPIKDY...... 255
299 6.000e-70UniRef50_A0A2H5XAK1 Ribonuclease HII n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5XAK1_9BACT  ali  16  17...............................................................................EWVAKGRTVVGIDEAGRGPLAGPVVAAAILLPPAHDLLFTEPPLLQDSKKLTPQEREQAVRWLKRCACFAVGKASPAEIDRLNIRR-----ATLLAMRRAVQRLQHKTVGCDLALVDGDALGDL----------GVEAVFVIDGDEVCPLISAASIIAKVARDRVMDRRYPHYGFAQHKGYPT---RQHLEALRRFGPCPIH---RRSFAPMR........ 218
300 6.000e-70UniRef50_D8FC19 Ribonuclease HII n=3 Tax=Bacteria TaxID=2 RepID=D8FC19_9DELT  ali  18  16...................................................................QCPQDPFYHETQARNSGYRLIAGVDEAGRGPLAGPVVAAAVMIP-----DGVRFSGIKDSKKMTVRARIEAFHRIEGALTFGIGVVSVSYIEEFNIL-----NASLEAMLRAVQVLDPQP---EMILVDGIHTVPT----------SIKQKCLKKGDQVSRSISAASVLAKVYRDRIMHHMYPEYGFDKNKGYGT---RQHLEAIKEHGPCPVH---RLTFKGVR........ 215
301 7.000e-70UniRef50_A0A1V5RAN7 Ribonuclease HII n=1 Tax=Parcubacteria group bacterium ADurb.Bin316 TaxID=1852942 RepID=A0A1V5RAN7_9BACT  ali  15  2.......................................................................PSFVLEKKLFSDGYKIIAGVDEAGRGPLAGPVVAACVACNGRFSPGKKLLAQVNDSKKLSAKKRAELFFLLSNNLHIGIGASNHQEIDQFNIF-----QATLLAMKRAVSKVKARP---QFLLVDGRFTIPNL---------KTAQQAVIKGDSRHFLIAAASIVAKVTRDQMMQDWHPQYNFFSHKGYAT---REHLRQLTKNGPCAIH---RQTFQPVASLLSRIK. 211
302 8.000e-70UniRef50_A0A1J5DWX5 Multifunctional fusion protein n=1 Tax=Deltaproteobacteria bacterium CG2_30_63_29 TaxID=1805126 RepID=A0A1J5DWX5_9DELT  ali  21  18...........................................................................LEESLEKEGVTVIVGVDEAGRGPLAGPVVTAAVCLGTEHGLQ-----GLDDSKRLTAARREALFDQIKSALAYAIHEASPKQIDELNILQATLFSM-RESVMQVVGALRQRTIAPAVVVVDGN------QPLRLDSTAKVPERCVVKGDQKSTNIAAASILAKVHRDRLMAELYPGYGLAEHKGYPTKS---HKAAIAKLGPSIIH---RTTFRGVKEHL..... 223
303 8.000e-70UniRef50_A0A2P6LKK9 Ribonuclease n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6LKK9_NEPCL  ali  20  321.....................................................................................ELIAGVDEVGRGPLIGAVVTAAVILDPAQPI-----LGLTDSKKLTEKKRQLLAEEIKKALCWALGRAEPAEIDQLNILH-----ATMLAMQRAVAALAIQP---QWVLIDGNRCPAL----------AMPASAVVKGDSLVAEISAASILAKVARDQEMDQLYPQFGFAAHKGYPT---AAHLQAISEHGILPAH---RRSFKPVRLIAEQLE. 509
304 9.000e-70UniRef50_A0A0G0DNM8 Ribonuclease HII n=19 Tax=root TaxID=1 RepID=A0A0G0DNM8_9BACT  ali  15  18........................................................................TFILEKDFANQGFTHIIGTDEVGRGPLCGPVLACAAMFDINFKIPTDKQKLIRDSKKVSEKQREEIFDFINEHFYIGIGLCDHETIDRINIL-----EASFLSMKKAIQELKRDVEPKYIVLVDGNKVIPNL---------SMEQYAVVGGDKLVKSISAASIVAKVTRDRMMLEKYPQYGLDKHKGYGTKV---HMDALFKYGPCEIH---RKSFAPVKRAINEL.. 238
305 9.000e-70UniRef50_A0A2H6ELK7 Ribonuclease HII n=6 Tax=Bacteria TaxID=2 RepID=A0A2H6ELK7_9BACT  ali  19  1........................................................................MKNFDRRYLNKSINKIAGVDEAGRGPLAGPVVAAAVIFDDETVID-----GINDSKKLTEKKREELFELIVQSLSYGIGIIDQKEIDEINIL-----QAALKAMKAAVNNLNIKP---QLILIDGN----------KTFNSDIPCKAIVKGDGKSFSIAAASIIAKVTRDRLMAKNFPNYLWEKNKGYGTK---QHIEAIKKYGLTPLH---RKTF............ 191
306 1.000e-69UniRef50_A0A2N0MIU0 Ribonuclease HII n=6 Tax=Bacteria TaxID=2 RepID=A0A2N0MIU0_9CHLR  ali  18  2.......................................................................PDLTLEQELHRRGVNLVAGVDEAGRGPLAGPVVAAAVILPPDLTGNEPWLELLDDSKRLSPAQRVRAVEAVQKHVGVGVAQSSPQEIDNLGI-----GVATTEAMMRAVENLAWQPAYLDFVYI---------------SSCPLPYDTVVKGDSRSYSIAAASNIAKVTRDRLMQELYPGYFFARHKGYPT---ADHVARLKALGPCRIH---RYSFGPVR........ 202
307 1.000e-69UniRef50_L5K887 Ribonuclease n=49 Tax=Euteleostomi TaxID=117571 RepID=L5K887_PTEAL  ali  19  21..............................................................................PAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLS-RLADLKALKVADSKTLSESERDRLFAKMRNFVGWALDVLSPNLISMLGRVKYNLNSLSHDTAAGLVQYALDQGVNVAQVFVDTVGLPETYQERLQQCFPDIEVTVKAKADALYPVVSAASICAKVARDQAVKNWEKLQDLDIDYGSGYPNDPKTKAWLRKHPIFGFPQFVRFSWRTAQSILEKEAE 251
308 1.000e-69UniRef50_A0A0L0RX77 Ribonuclease n=2 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0RX77_ALLMA  ali  18  70..............................................................................PDVCRKHPCVLGVDEAGRGPVLGPMVYAVCYLPKDQG-EVLTEMKVDDSKVLNEEMRLSRFDLIKDVLGYSYNALSPQDLSEWMLRKYNLNAIAHNTTIALIRHVLSQGAQIDEIYVDTVGPPAPYEKKLKELFPKVATITVKKADSLYPSVSAASIVAKVTRDHNLSQWQFAETIDRDWGSGYPSDPNTVKWLKRNPVFGWPGIIRFSWSTAENLLKE... 300
309 1.000e-69UniRef50_R7HHH9 Ribonuclease n=1 Tax=Mycoplasma sp. CAG:472 TaxID=1262904 RepID=R7HHH9_9MOLU  ali  24  1.MNCVVFKLDERLHEKLIKFYKA--YEIKTPPYAKFAAKNYDVTITLYEKGKVMFQGVGADIEASIWQKSKDNKKNEKDDFYVYYSSI-GSDETGCGDFFGPVVVVATYVPSNK-IKELENLGIKDSKKINDDIIMKVAPEIMKTTPYTFFVLCNKDFNDLMEKNYNMVQIKAILHNKVLMDLVKKNPDYKYPVVDQFVNEKKFYSYLKDDDTALRGIKFTKGESKCMSVAAASVIARYIFINEMDKLSKISGFNLHKGAGIEVDNQIKEIIQKKGKDYLYQIGKVSFNNYTKLK..... 307
310 1.000e-69UniRef50_A0A2A4X0W1 Ribonuclease HIII n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4X0W1_9BACT  ali  42  3.QSPFVVVVDVHHSESIHDYLCNQGCIVSKPAHTFFQAKKPGLCVTFYKSGKLLVTGKQSDEFIEFYLEPEILQQVLKAALPSVKDSVIGSDEAGKGDYFGPLSVCSTYASYA-SIDQLYALGIKDSKKITDDNILILEKEIRKLCQVETVVLMPEKYNELYKKIGNLNHLLAWAHTTAATNLVEK-SGCNHVLVDQFAKPALLESFFAKKSLKI-NLSQRVRAEEDIVVAAASIVARAEFLKGLKALATKFHHPLPKGASSAVIKAGCSFVEKIGKEKLHLVAKIHFKTTQNVLD.... 301
311 1.000e-69UniRef50_A0A1A8Z418 Ribonuclease n=2 Tax=Plasmodium ovale TaxID=36330 RepID=A0A1A8Z418_9APIC  ali  19  63...................................................................................DEEVRLGIDEAGRGPVLGPMVYAGFYCNKD-NEKLLREMKIDDSKKISESDREKMFTKLNNSFGWRVHVLLPQDISAKMLKKYNLNEISHDTAISIIEHVVNRGCNLTEVFVDTVGKANIYEEKLQKLFPHIKCTVKEKADSLYPVVSAASICAKVTRDFLLKKWKPIINIDKGFGSGYPGDPITKNFLKNNPVFGFPSIVRFSWSTADNMIENAG. 287
312 1.000e-69UniRef50_A0A2V6BNZ8 Ribonuclease HIII n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6BNZ8_9BACT  ali  42  73..NSYTHVLTQEQVAKLRSLLKELGFKFAPKEWTIFFGQKNKLSVAVYEKGKVLVQGKGVEEFVQFELEPKILGEYEEVHSPEMFQPHFGVDESGKGDFFGPLVIAGVYVDRVIARKLL-DAGVVDSKRISDARIRALADTIRKSSLVEAVLIGPAKYNELYEKFGNLNKLLGWGHARVIENLLAKKPDCPRALSDQFAD-ARVVEQALLRNGRNIDIEQRPRAESDVAVAAASILAREAFIGWLECKGKEIGLRLDRGVSASVKENAKKLVETNGPGALRDVAKVHFRTAHE....... 369
313 1.000e-69UniRef50_D6GPS6 Ribonuclease HII n=2 Tax=Peptostreptococcaceae TaxID=186804 RepID=D6GPS6_FILAD  ali  17  47.........................................................KNRLKAEEEKQRILQMKAKEQDWNSKGILLVGGVDEAGRGPLAGPVVAACVIMKSDSLI-----LGMNDSKKIKETVREELYDKIQDSISFGIGIASSEEIDR-----YNILQATFLAMKRAMQEMKQ---VPDLVLVDGN---------QEISNCSIRQETVIHGDSICYSIACASILAKVYRDRIMDRIYPEFDFLSNKGYGTSH---HYDALRTYGVTPIH---RKSF............ 253
314 1.000e-69UniRef50_A0A2A9NYQ4 Ribonuclease n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NYQ4_9AGAR  ali  16  14.....................................................................LTESYTYHSSTPIAPGPYILGVDEAGRGPVLGPLVYGVAYCPAAYN-EELEKLGFADSKTLTPETRASLLETLSDNLGWSVRVISPQAISSSMLRRTNLNRQSQDATILLIKEVLERGITLTEVYVDALGTTTTYEAYLSSLFPGINFTVTAKADSKFKIVGAASVAAKVTRDACIEGWTFEEGWSNEVGSGYPSDPKTQAWLRENPTFGFPKIVRFSWATVKVMLENNGH 253
315 2.000e-69UniRef50_I0I9T6 Ribonuclease HII n=7 Tax=Bacteria TaxID=2 RepID=I0I9T6_CALAS  ali  19  9...................................................................KSNLPSLQVEQSLWERGFWRVAGVDEAGRGALAGPVVAAAVLITPDSRTAPIWSS-VRDSKLLSPGRRIQLADEIRRAVAWAVCEVDAATIDAIGI-----AAATRRAMQEAVAALSP---AAEYLLIDWVRLP----------HIGLPQQAQAGADRIMASVAAASILAKVHRDQVMQEYYPAYRFAVHKGYG---VAVHRTAIERFGPCPIH---RRTFAPIAR....... 213
316 2.000e-69UniRef50_A0A2U3DAH7 Multifunctional fusion protein n=2 Tax=Acidibacillus sulfuroxidans TaxID=1765684 RepID=A0A2U3DAH7_9BACL  ali  18  11...........................................................................YDQMARREFGPFLCGIDEAGRGPLAGPVVAAAVILPDTLNQEW-----IYDSKKLKPAEREELYQVIVEALAHGVGVIDHTYIDQ-----YNVLQATYEAMRTALRQVATTMPQIDMVMVDGATIPNVQYLQRK----------LIRGDHLSQSIAAASIVAKVTRDRIMEKIFPDYGFERHMGYGTP---EHLQALAQFGPSPIH---RLTFAPVKAAVE.... 209
317 2.000e-69UniRef50_A0A0G1V6K3 Ribonuclease HII n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1V6K3_9BACT  ali  21  7...........................................................................HERMLKRKGYTYIAGVDEVGRGAWAGPLVAAAVILPSRHGI-----TGIDDSKRLTPATREALFERITKAVSWAVHTVSPAVIDKRGISFAN-----KLAIKRAVVKLS---TPPDFVLVDA-----------LPVHFRMPSRSIIDGDAISESIAAASIVAKVTRDRMMNKRFPGYAFDAHKGYGT---SRHMTSLYALGTCAIH---RLSFAPIRDMVKKNCQ 205
318 2.000e-69UniRef50_B2J5B6 Ribonuclease HII n=10 Tax=Nostoc TaxID=1177 RepID=B2J5B6_NOSP7  ali  24  26......................................................................................LVAGVDEVGRGALFGPVVAAAVILP-DHALPILIAAKIKDSKKLSSSRRTQLAQQICAAIDWKIGFASTAEIDKINIL-----QATLLAMKRAVLKLKVQPAIC---LVDGNQSIKDLL---------LPQQTIIKGDERSLAIASASIVAKVWRDDLVLRLYPMYNLERNKGYGS---QRHLLALQQYGPSPLH---RQSFRPCQKVLN.... 216
319 2.000e-69UniRef50_R6GT96 Ribonuclease HIII n=1 Tax=Firmicutes bacterium CAG:582 TaxID=1262997 RepID=R6GT96_9FIRM  ali  24  3.QQTIVFKISDNLKNKVIDFYKDRALPNH-PPYSVFQVKDYDCVITLYESGKLMFQGIGADIEASYWMEEERINNXXXXLNDTRFKNIIGSDEVGTGDYFGPIIVTASFVDISKK-SFLFDLGVRDSKKITDEKIMAIAPTLIKEFPHVTYILTPSDYNRLGI--TNMNKVKAILHNKVLFALKSKNYNYDKIVVDQFCFPTKYYEHIKETPSKVTNITFTHAEDKCLSVAVSSIISRYIFIKEMKKMEEQLKMKVPKGAGDIVDQTGVKIVNSYGIEKLKDIAKLNFKNTDKIKE.... 313
320 2.000e-69UniRef50_R6SEX7 Ribonuclease HII n=4 Tax=Firmicutes TaxID=1239 RepID=R6SEX7_9FIRM  ali  21  1........................................................................MLDYEKPLYQKGYKLIVGCDEAGRGPLCGPVVCAACIMEENYINDE-----INDSKKLTDKKRRQLFDVIISHISYAIVAISPQEIDKINIY-----EASRKGMQDAIDLLKVKP---DYILTDAMP---------LLKFKDIPQEAIIKGDAKSINIAAASILAKVTRDNILDKKYPQYQFAKHKGYPTK---LHLELLEKYG--PIKEIYRFSYKPVQKF...... 199
321 2.000e-69UniRef50_A0A1Q4B9S1 Ribonuclease HII n=1 Tax=Rhizobiales bacterium 62-17 TaxID=1895810 RepID=A0A1Q4B9S1_9RHIZ  ali  19  17...............................................................AEQTLPEAPHFNHERALLRRGLRFIAGVDEVGRGPLCGPVVAAAVILDPN-----LLPEGVTDSKQLDADERLTAFDQVMQALAVGIGMASAAEIDTINIR-----QATHTAMRR---ALAALSLAPAFALIDGNDCPKNL---------RCEASTLIKGDAISLSIAAASVIAKVTRDRLMHEWHPQYGFADHVGYPTK---RHREALAAHGPCAFH---RFSF............ 217
322 2.000e-69UniRef50_UPI00037122BF ribonuclease HIII n=1 Tax=Allobaculum stercoricanis TaxID=174709 RepID=UPI00037122BF  ali  26  1.MPTKSVKLSANQIEALYKRLQPHAKKESQPQYTLWQIRTDSINVCAYQSGKVVISGQDIDWLVEDLEALATQSALFQPTKQKKMTSIAGSDEVGNGDYLGPFVVASVIIENEEMAKKLIEMKVTDSKAMTDKMILKVAPELMDLIPYSVQVLTPIHYNKIYDKYHHLNYIKAMMHNQAYLNLEQKGALPQLKIVDQFCSPKRYFELLYDIQIVRPIHFETKAESKYISVACASVIARYHFLQYWDKMEEKYEIKFSKGGGAQATKCAQEFVDHYGYNRLYEIAKLHFVNTQRLKHDQDE 320
323 2.000e-69UniRef50_A0A223ATD1 Ribonuclease HII n=2 Tax=Mogibacterium TaxID=86331 RepID=A0A223ATD1_9FIRM  ali  15  22..........................................................KQEREEKKMKRMHELLQIEDELRESGIKNIAGIDEVGRGPLAGPVYAACVVLPSDFRVP-----GVDDSKKVSEKQREKLYKEICEAVAYGIGIATAKEIDDINIL-----NATKLAMHRAITEVQNKGENIEMLLIDAVDLEAE----------GIAQKPIIKGDATCYSIAAASIVAKVSRDSFMKEIYPGYGFASNKGYGT---ATHYDGLHNLGISPIH---RKSF--LKKFKASEE. 241
324 3.000e-69UniRef50_A0A1V5K6Q0 Ribonuclease HII n=1 Tax=Candidatus Aerophobetes bacterium ADurb.Bin490 TaxID=1852830 RepID=A0A1V5K6Q0_9BACT  ali  20  6..............................................................................EFDRQYKGIICGVDEAGRGPWAGPVVAAAVILDPEKVSMLGE---VDDSKKISEKKREGLFQVVINACTYAIAEISAKIIDRSDILSSTLN-----AMKSCTEKLSQKP---DVVLVDGNKAPAL---------AGYNVITVVDGDAKSLSIAAASILAKVYRDRIMDKLYPGYGFASHKGYGTK---EHMDALNRLGTCGIH---RLSYKPVAEIAAKK.. 203
325 3.000e-69UniRef50_Q9SEZ6 Ribonuclease H2 subunit A n=154 Tax=Embryophyta TaxID=3193 RepID=RNH2A_ARATH  ali  18  14.....................................................................................PCLMGIDEAGRGPVLGPMVYGCMYCPIS-YQSSLASLHFADSKTLKEEKREELYESLKKSLGWAVDVIDPRELSAKMLNKTNLNEISHNSAMGLIKRVLDMGVLLTEAYLDTVGDPDKYRIKLSERFPSIKFVVSKKADSLFPIVSGASIVAKVTRDRALKEWETGEDINRNFGSGYPGDPETKAWLHKHSVFGFPSLVRFSWGTCTTHLK.... 232
326 3.000e-69UniRef50_Q5HPU6 Ribonuclease HII n=29 Tax=Terrabacteria group TaxID=1783272 RepID=RNH2_STAEQ  ali  15  4............TIKEIKEKLSRIETLEELHKHEANNDSRKGV-INAIKSR-----EKNILKQQALEEHYLSMNQYENNIMSSNRDLICGIDEVGRGPLAGPVVACAVILEKNHHY-----IGLDDSKKVSPKNRARLNQNLKENVYYAYGIASSVEIDELNIYR-----ATQLAMLRAINQLD---VTPTHLLIDA-----------MTLDIDIPQTSIIKGDAKSVSIAAASIMAKEYRDQYMRQLFPEYGFDKNAGYGTK---QHLKAIDQVGIINEH---RQSFEPIKSMMK.... 256
327 3.000e-69UniRef50_A0A1W9ULU9 Ribonuclease HII n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9ULU9_9CHLR  ali  19  2......................................................................KPDISEELVLQAAGHTRVAGIDEAGRGAWAGPVYAAAVVLPLDRDDLLDLLASVRDSKQLSRTRREELLPAIREVAAVGVGWAEPAEVDEIGIAP-----ATRQAMARAVAGLDGR---VNALLIDYVRLPEL----------DLPQRSLAKADIHCLSVAAASIVAKVTRDRLMIALFPGYGFARHKGYGT---RQHREALARLGPSPIH---RMSWRPMQEL...... 205
328 3.000e-69UniRef50_A0A1I3NKX0 Ribonuclease HII n=34 Tax=Bacteria TaxID=2 RepID=A0A1I3NKX0_9BACL  ali  16  1......MNMAELSIKEIREWVEKLDEVPKDFLQLLKDDKRAGVQEIA---RKAEAAIARREKLAAQW---TEMTQYERSLRESGHVHLFGIDEVGRGPLAGPVVAAAVCLPADFYLP-----GLNDSKKVPIATREAFYEIIRDATAVGIGIVDAFRIDAINIL-----NATKEAMLLAIQNASIAP---DACLIDAV----------QLAGLSCKQVPIIGGDGKSVSIAAASIVAKVTRDRMMVDYFPEYGFEKHAGYGT---AEHLSAIERFGATPIH---RKTFTGVKE....... 256
329 3.000e-69UniRef50_A0A1J5IVB4 Ribonuclease HII n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IVB4_9BACT  ali  18  5.......................................................................PSFAEEQQLWSQSTMAVAGLDEAGRGPWAGPVYAAAVIFPAGLDASKLH--GLTDSKLLTRTARDRWFEVIKSAAGFGISKTEAEEIDRIGIVP-----ATKRAMLLAISQLAS----CSHILCDAMSFNPIDFQQAEVSHLINHQKSYVRGEQISLSIAAASVLAKVSRDREMDERYPRYGFSRHKGYGT---REHQQTLLRYGPCPLH---RVSFKPIKQLLE.... 222
330 3.000e-69UniRef50_J5U8R7 Ribonuclease HII n=2 Tax=Mogibacterium TaxID=86331 RepID=J5U8R7_9FIRM  ali  18  3..........................................................KQEREERKLQRMKELKQIEDELHASGIKNIAGIDEVGRGPLAGPVYAACVVLPEEFNVP-----GIDDSKKVSEKQREKLDRLIRESASYGIGTATAREIDDLNIL-----NATKLAMHRAIIEVKSKLAKIDMLLVDAVDLKEE----------GIPEKAIIRGDATCYSIAAASIVAKVARDREMDEKYPGYAFASNKGYGT---AAHYEGLRSVGLSPIH---RKSF............ 213
331 3.000e-69UniRef50_Q9VPP5 Ribonuclease H2 subunit A n=127 Tax=Bilateria TaxID=33213 RepID=RNH2A_DROME  ali  15  29............................................VDFKDSGKISSLKALGPFIAGKENSRNTVYLSDVPDICKDKPCMLGVDEAGRGPVLGPMVYGISYCPLESN-KALEDLGCADSKQLTEGKRDIIFNDITSCVGWAVEIISPNTISTSMRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPEGLDNEFGSGYPGDPVTRRFLTEYIVFGFPRLVRFSWSTAENALADK.. 294
332 3.000e-69UniRef50_A0A2D4C565 Ribonuclease n=19 Tax=Oomycetes TaxID=4762 RepID=A0A2D4C565_PYTIN  ali  18  80..............................................................................KVERDGYQVVVGCDEAGRGPLAGPVVAAACYVPLDVSIE-----GVHDSKKLSEPQREALFERLTTHVKYAVHVNSAQRIDEINIL-----QASLEAMALAVDALD---VRADFAFIDGNRMPPTL---------RIAGETVVQGDSKVFSIAAASIIAKVTRDRIMVELYPQYNLKQHKGYPT---REHMAAIAKHGACEIH---RMTFAPLK........ 270
333 3.000e-69UniRef50_R6GMN8 Ribonuclease HII n=13 Tax=Bacteria TaxID=2 RepID=R6GMN8_9FIRM  ali  21  15.....................................................................................DIVAGCDEVGRGPLAGPVTVAACIMPHGFFIE-----GINDSKKLSEKKREQLFEKIIKVAKYEVCSIEPKVIDQINIL-----EATKLAMKTVISKL-----NAPLTLVDAV-----------NLDIPQKTVSIIKGDATSYSIAAASIIAKVIRDRLMDELYPQYGFADNKGYGT---SAHILALKTYGETPIH---RKSF--IKNFI..... 193
334 3.000e-69UniRef50_A0A2E9QY00 Ribonuclease HII n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QY00_9DELT  ali  19  17.....................................................................FESHRWLEQEYAQQKIHRIIGIDEAGRGPLAGPVVAAAATLPPDTWIPQL-----DDSKRLSEAQRDKLFDQVLDKAAVGVAVISAAEIDEINILQS-----TLKAMRLALVQLLRQPEEPQLILIDGN----------QKFPFDGPLKTVVKGDHLSHNIAAASILAKVTRDRIMHDLYPIYDFASHKGY---ASAKHRQAILDHGPCPIH---RFSFKGV......... 217
335 4.000e-69UniRef50_A0A2D6K1X5 Ribonuclease HII n=30 Tax=cellular organisms TaxID=131567 RepID=A0A2D6K1X5_9PROT  ali  17  1........................................................................MDSTNFTLEDSHEHAVCGIDEVGRGPLAGPVVAACVHIP-DQVREMDFIKDVKDSKRLSWKKLETLYEQITLHCPHGVCEVSVEEIDEINIL-----QASLRAMERAYEKMKTDMA---HALIDGNKLPKNL---------PCPATAIIKGDSKSKSIAAASIIAKVTRDRIMHKLHPHYGWESNVGYPSK---AHLAGIDCHGITKHH---RKSYAPIKKFIEN... 204
336 4.000e-69UniRef50_A0A137P130 Ribonuclease n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137P130_CONC2  ali  19  19...................................................................LKYNFLYYSDAPQVALDEPCVLGIDEAGRGPVLGPMVYGACYYPLSF-EEEFKKLNFDDSKKLSKEKRERLFETYKDKVGWIIHSLSPQFISMLRKNKYNLNDLAHDTTVGMIQKLVDLGVAIEHVYVDTVGPPKSYEQWLTKQFSTIKFRVAKRADSLYSCVSGASICAKVIRDSILENWEESLDLAISLGSGYPADPLTKEWLAKDPVFGYYPVVRFSWSTIDDLLIKQG. 258
337 4.000e-69UniRef50_A0A0R3CVL9 Ribonuclease HII n=4 Tax=Bradyrhizobium TaxID=374 RepID=A0A0R3CVL9_9BRAD  ali  18  52.......................................................................PSFRRERALIKRGVWPVAGCDEAGRGPLAGPVVAAAVILDPDRIPR-----GIDDSKRLTAEEREKLFDKICATAQVSVAVASPARIDRDNILR-----ASLWALKRAVVAL---PEAPRHVFVDGRD----------RLDTACDCEAVIGGDGIVLSIAAASIVAKVTRDRLMCALCPGYGFEQHKGY---AVPEHLDALDRLGPSIHH---RRFFAPVAAARAK... 251
338 5.000e-69UniRef50_A0A1X7E404 Ribonuclease HII n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1X7E404_9DELT  ali  18  19......................................................................................LIAGIDEAGRGCLAGPVVAGAVILPAEYDLP-----GLTDSKKLTESARDILAQQIREAVCWSLGVSRAQVVDRINIL-----QATFRAMARAAIHLK---VQPSVLLIDGNKTIPLNHFNGIAGF---QQESIIKGDEKIPAISAASILAKTFRDSLMEKIYPGYGFAVHKGYGTK---FHMDAVREKGPCLIH---RLTFKGVRPEKKKSGQ 214
339 5.000e-69UniRef50_A6TRS3 Ribonuclease HII n=33 Tax=Bacteria TaxID=2 RepID=RNH2_ALKMQ  ali  19  4.........................................................................LEIENQLWEEGYESIAGCDEVGRGCLFGSVLAATVILPKGLLIE-----GVKDSKKLSPKRREELYEVIKKNIAMGVGIISAEVIDQINIR-----QASRLAMKKSVLSLTTESKIPDYILVDA-----------ENIDIAIPQSAIIKGDDRSQGIAAASIVAKVIRDRLWDEEYPNYGIAQHKGYGTK---LHREALLKYGPSELH---RRSF--LKKILK.... 204
340 5.000e-69UniRef50_UPI00040C2860 ribonuclease HII n=1 Tax=Chrysiogenes arsenatis TaxID=309797 RepID=UPI00040C2860  ali  17  20................................................................................HARQWSYIAGIDEVGRGPLAGPVCAAAVVLPPACDHPA-----IRDSKKMTEKKRVEMDAFIRENAGYAIACVDATDIDRINIL-----QATRHAMAQAVAGLV---GHIDGLLVDGMD---------GAFAPQYSSVKVIGGDHCSLSIAAASIIAKVYRDGLMDEQYPEYGFARHKGYGT---ALHLQAIREYGLSPIH---RRSFR........... 204
341 6.000e-69UniRef50_A0A1Q7FJR2 Ribonuclease HII n=62 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Q7FJR2_9BACT  ali  15  1........................................................................MYRRCEKLRAIGAARIAGIDEAGRGALAGPVVAAAVILPKKFRHRRL-----NDSKQLAPELREEIYHALISNLSWAVAIVDSIEIDRINILR-----ATHKAMRAAVAALSSMP---DHVLIDG----------LPVIPFPVPQTAIIDGDCLSLTIAAASVIAKVTRDRMMRDFFPEYYFSQHKGYST---ELHLLRLHEFGPCPIH---RRSFEPVAQ....... 197
342 6.000e-69UniRef50_A0A089L2G5 Ribonuclease HII n=25 Tax=root TaxID=1 RepID=A0A089L2G5_9BACL  ali  20  6........................................................................MLSFEKAGWEQSYRRIAGVDEVGRGCLFGDVVAAAVILPEGLIID-----GVDDSKKLTAKKRDALYEIIMEALAVCVGHVESAIIDEINIK-----QASRLAMKKAVEGLSE---AADYLLIDA-----------EKVDLPLPQQSIIKGDANSQSIAAASIVAKVTRDRLWEELYPDYGIKIHKGYATK---LHREQIVSLGPTPMH---RRSF--IGKILAE... 203
343 6.000e-69UniRef50_A0A0G1FT64 Ribonuclease HII n=19 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G1FT64_9BACT  ali  16  1...............................................................MQKAKLKLPNFKEEQKLWQQGYDFVVGLDEVGRGPLAGPVIACAFCFYKXXXXXXXXXXXXKDSKKLSANQRAKWFEFLTTHVKWGIGIVSEKTIDRINIL-----EATKLAMKRALENLK---IEADYLLLDGNFLLDDLL---------INQKAMVRGDEKIWSCAAASIIAKVTRDRLMHQKFPQYGFDSHKGYGT---RQHFAAIQQHGPCAIH---RLSFAPF......... 219
344 6.000e-69UniRef50_Q89S84 Ribonuclease HII n=134 Tax=Alphaproteobacteria TaxID=28211 RepID=RNH2_BRADU  ali  18  12.........................................................KDAPKKAAVKEAAPVKASFERALIKRGIWPVAGCDEAGRGPLAGPVVAAAVILDPDRIPR-----GIDDSKRLTAEQREKLFDKICATAQVSVAVASPARIDRDNILR-----ASLWALKRAVVAL---PEAPRHVFVDGRD----------RLDTACDCEAVIGGDGIVLSIAAASIVAKVTRDRLMCALCPGYGFEQHKGYG---VPEHLDALNRLGPTVHH---RSFFAPVAAARAK... 227
345 7.000e-69UniRef50_A0A0G0F000 Ribonuclease HII n=12 Tax=root TaxID=1 RepID=A0A0G0F000_9BACT  ali  14  10........................................................................TFILEKDFAAKGFTHIIGTDEVGRGPLCGPVLACAAMFDINFEISADKQKLIRDSKKVSEKQREEVFDFICENFYIGIGLCDHETIDRINIL-----EASFLSMKKAIQELKRNNVEPRYVLVDGNKQIPNL---------SMEQYAVVGGDKLVKSISAASIVAKVTRDRMMQEKYPQYGLDKHKGYGTK---MHMAALSKYGPCEIH---RKSFAPVKKAINEL.. 230
346 7.000e-69UniRef50_A0A0R2CAC6 Ribonuclease HII n=76 Tax=root TaxID=1 RepID=A0A0R2CAC6_9LACO  ali  16  4.......KLTIKQIKELKQHYSNELVASLT------ADRRIGVQ-------KLVQQAQRWQARQQTQQKFAQRFVYEKKFWQAGKQLVAGIDEVGRGPLAGPVVAAAVILPHDFSI-----LAVNDSKQLSSHLREELSSQILAALAVGIGVADNQQIDQANIY-----QATRIAMKQAVAALK---ILPQQLIIDA-----------MQIETAIPQLKLIKADAKSNSVAAASIVAKVWRDHLMDKIYPGYGFAQNAGYGT---AQHLAALKSQGITPIH---RLSFAPVAKVAKN... 256
347 8.000e-69UniRef50_A0A290QBA9 Ribonuclease n=42 Tax=root TaxID=1 RepID=A0A290QBA9_9BACT  ali  34  16..SSYTVKLDDAQMEKLRAICAARHWEQAEVAYTRFAFKGEQVNVTAYTSGKVVIAGKGTEDFVRDTIEAEPKLGYDEVNHPDWFESHAGLDESGKGDFFGPVTTATVIADRDAVESWLAA-GVKDSKKISEGQIFKLEDVIRNTRGVVVETFSWEKYNELMLRGANLNRLLAWQHAKGLLAALDRKA-VSWGLLDQFTEQPLVQKELAKKELKNFELKMRTKAEEDPVVAAASVCARAEYVRQMVKLSRKFGANLQKGAGPLVKDQARGIIEKFGAKSLGEFAKLHFRTAYEVVSEMGK 321
348 8.000e-69UniRef50_A0A150WE28 Ribonuclease HII n=15 Tax=Bacteria TaxID=2 RepID=A0A150WE28_BDEBC  ali  19  16..........................................................................EYPKVNWREFFPPVIGVDEVGRGCLAGPVYAAAVIFKSDALAED-----VTDSKLLSEERREELAALIQKEHHVGIGFATVEEIDEMNILR-----ASLLAMKRAVEALGVKGG---HVLIDGNMKIPGLE--------GFEQTTMVKGDLRVAPISAASIVAKVTRDRLMKQLYPLYGFEVHKGYSTPV---HKDSIVAHGPCSVH---RKSFAGVKEYLAEL.. 216
349 9.000e-69UniRef50_X1HL47 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HL47_9ZZZZ  ali  18  4.....................................................................................QLVAGIDEAGRGPLAGPVVAAAVILDQERPFE-----GLADSKQLTAKRRAALYDVILDALAVGIGESQRAEIDRRNIF-----QATITAMQRAVDAL---NPGPGHLLIDG----------KNIQLDHPSQETIVDGDETEPAISAASIVAKVHRDRLMAEYYPEYGFDRHKGYGTK---AHMQALADHGACPIH---RQSFRPVKQHL..... 188
350 9.000e-69UniRef50_Q03VG4 Ribonuclease HIII n=61 Tax=Lactobacillales TaxID=186826 RepID=RNH3_LEUMM  ali  27  1MQK--VIQVNNQKLKQMAHYYSQFS-SKKVPTGALFSISSGSATVTGYYSGKVMFQGKTASAEAAKWQSNSIHSLDTPKKMSTTLPSVLGSDEVGAGAYFGPLTTAAVYVSQ-ENLEWVRALGIADSKTLTDDRMKKIAPQIIAKLPHHVVNLMPEKYNQLQPL-HNVNQMKAISHNFALGKVLDKPITPQAILIDQFAQQSTYFNYLKNAKIHENVYFTTKGEQYHLSVAAASILARVVELDAMSKLSVEAGIKLPIGAGREVDTVAAELLRR-GID-LKHYAKLHFANTKKA...... 299
351 1.000e-68UniRef50_A0A1V4HTN5 Ribonuclease HII n=95 Tax=Bacteria TaxID=2 RepID=A0A1V4HTN5_9BACL  ali  20  2................................................................................WEQGFSFVAGIDEVGRGCLFGDVVAAAVVLPKGYVLE-----GVNDSKKLSEKKRDYLYEQIQEALAVGVGIVDVAQIEAINIK-----QAARLAMKQAVDQLK---ITPDYLLVDA-----------ETVDVDLEQTAIIHGDALSQSIAAASIIAKVTRDRMWDDQYPEYGLAIHKGYATKH---HRDMLLRYGPTPLHR.................. 180
352 1.000e-68UniRef50_A0A177PXQ1 Ribonuclease HII n=1 Tax=bacterium SCGC AG-212-C10 TaxID=1799370 RepID=A0A177PXQ1_9BACT  ali  20  5.....................................................................PPPTLQFESDAWVAGVLWVAGVDEVGVGPLAGPVTAAAVALKPGESYPWFSA--VRDSKVLTEPERDDLAAQIRATAHYAIGWASHEEIDRINIY-----QARRLCVMRALEGLT---VWPGAVISDALKLPLPGVR------------PIVKADALSISVAAASIVAKVARDAVMAELYPGYGFCHNKGYPTP---EHKKLLARKGPCPEH---RRSYAPVR........ 202
353 1.000e-68UniRef50_A0A1I7HQ23 Ribonuclease HII n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1I7HQ23_9FIRM  ali  16  3..........................................................KAEREKKMMERLLALRGFDDRFRKSGELYLAGVDEVGRGPLAGPVVTAACVLPADFDVP-----GIDDSKKLTDRRRREMSRIILDALAFGFGISTNERIDRINIL-----AATKEAMYQAVQEAEKMGCGLDRVLVDAVNL----------DMLPVPVTSMTKGDATSLSIAAASIIAKVRRDDMMEETYPGYDFASNKGYGTK---AHYAGLKEQGISPIH---RRTF............ 215
354 1.000e-68UniRef50_A0A0C2UI74 Ribonuclease HII n=3 Tax=root TaxID=1 RepID=A0A0C2UI74_9BACL  ali  21  1........................................................................MLHYEEQIWEQGYIAVAGVDEVGRGCLFGDVVAAAVILPRGWAMED-----IDDSKKLTAKARERLYDVIMSNAAVGVGVVDVPTIERINIK-----QAARLAMKQAVEKLQREP---DYLLVDA-----------EKVDVDVPQLAIIDGDALSQSIGAASIIAKVTRDRMWDLQYPEYGIAIHKGYATKY---HREKILQFGPTPLH---RKTF--LRKLLHEQQE 200
355 1.000e-68UniRef50_B1CAB8 Multifunctional fusion protein n=1 Tax=Anaerofustis stercorihominis DSM 17244 TaxID=445971 RepID=B1CAB8_9FIRM  ali  19  48.........................................................KKNEKYQMEIKRIENIKAFENSLHDEGYKYIAGIDEVGRGPLAGPVVTAAVMLPKESNI-----LYINDSKKLSSQKREELAEKIKEAISYAIGIKDNGIIDKINIL-----NATKEAMLEAVDNLKIKP---EILLIDAVHLN-----------TDIKQESFVKGDENIYSIGAASILAKVYRDKLMEDYYPEYGFEKNKGYGT---FDHIEAIKNNGLCPIH---RSSFTN.......... 254
356 1.000e-68UniRef50_R6Y1T7 Ribonuclease HII n=9 Tax=Bacteria TaxID=2 RepID=R6Y1T7_9CLOT  ali  17  3.......................................................................NMYEYEENLYKEGYNFIAGTDEAGRGPLVGPVVAGCVVFPKGYKNDL-----INDSKKLTEKKREQLYDIIKDAVTYGIGIVSAKEIDELNIY-----EASRKAMIKAYEEANKK-VKIDYLLTDAMPI----------TTLDIPVLKIIKGDAKSVTIAAASILAKVTRDRILDKKYPEYNFKKHKGYPTK---EHLEKINEFGVF---DEYRMTYKPVKNVLD.... 204
357 1.000e-68UniRef50_A0A2E6TJY7 Ribonuclease n=4 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2E6TJY7_9BACT  ali  32  17.KSMYNLKLTSEQVDKLGKVLHALGWPKREVKYARHAFDGDGVKVVAYESGKLVVQGKGTEDFVTHILEPKITGEYEEVNNPDWFEPHAGLDESGKGDLFGPVVSACVIADGDMVKFWMEK-GIRDSKTITDGAIMKMAKQIAMTRGVVIKTASMVKYNELYLKGENLNKLLAWLHGKALNDALD-LREPKWGLLDQFTKQPLVQKYVEDRNFELQ---MRTKAESDPVVAAASIIARATWLQQMKKLEKFAGCTIPKGSGAQAKEVASELFSRFGEAKMNEFCKMHFKTAYEAMGKI.. 315
358 1.000e-68UniRef50_A0A1V5Y420 Ribonuclease HII n=1 Tax=candidate division BRC1 bacterium ADurb.Bin183 TaxID=1852823 RepID=A0A1V5Y420_9BACT  ali  23  2.................................................................RRINSQDLYDFDRVFFEEGARLLCGIDEAGRGPLAGPVAAAAVIFAEGVFIE-----GVADSKTLAPEKRERLYEEILSRASASVGIASAEEIDRLNIL-----AATHLAAGRALGAL---PITPDLIITD----------FLKLKDVSAPVRFFARGDALSHAIASASILAKVARDRLMHEEYPMYGFAQNKGYGTK---EHLDALRKWGPCPIH---RRSFK........... 200
359 1.000e-68UniRef50_A0A1G7CBJ7 Ribonuclease HII n=3 Tax=Bhargavaea TaxID=941338 RepID=A0A1G7CBJ7_9BACL  ali  20  1........MAKLTISEVRAWLETA--EEGDPY---FRELKSDSRAGI---RKLLASYERRKDKRRLELE----RHLEKERFDNGFRLVAGVDEAGRGPLAGPVVTAAVILPPSCP----ELSGLDDSKAISRERRERLAAVIREHIAWSVHIQPAAEIDRLNIYG-----ATRESMEKAVAGLSVK--------------PETVIADAMALEGEVPCHPVVKADGLSLCVAAASVLAKTERDAYMKRLYPAYGFDRHSGYGT---AAHLEALEAHGPCPEH---RKTFAPVAGFL..... 255
360 1.000e-68UniRef50_A0A1M5VRJ8 Ribonuclease HII n=1 Tax=Desulfofustis glycolicus DSM 9705 TaxID=1121409 RepID=A0A1M5VRJ8_9DELT  ali  18  25........................................................................TFQFERLLLDRGFCYIAGTDEAGRGPLAGPVVAAAVILPPGADYRP-----FCDSKQTTARQRSCLRDRLREIAAIGIGCIDAATIDRINIL-----QASLRAMADSIAALAEHGTTPDFILVDGTC----------RVPLTIPQQPIVKGDCRSASIGAASIIAKITRDEIMAELYPVYDFLANKGYPT---RYHRQAVQHHGPSPVH---RFSFKGVREFVTTAE. 229
361 2.000e-68UniRef50_A0A0L0MJ66 Ribonuclease (Fragment) n=1 Tax=Candidatus Phytoplasma phoenicium TaxID=198422 RepID=A0A0L0MJ66_9MOLU  ali  24  1MNDFYTLKLNLSQMQILRKYYKETLIQFKLFN-IFFIAKKKQCRITCFRNGTCLIQGKDSTKETLYIKKLLPNFDFHNQNN-------IGCDEVGTGDFFGPIVVCCVFLSPADRI-FLQQIGVKDSKKLSSKNIYRIAHLTMKKIPYCYRILSPQEYNYL-IKNNNLNKIKALLHNEIILKLLKQIKKPTIVVLDQFVYPYKYFEYLKNVYPVHKDIFQIRAEQKYLSVSLASIIARYLFLEEMKKLSQKMNF.............................................. 245
362 2.000e-68UniRef50_A0A0F2CQC7 Ribonuclease HIII n=138 Tax=Bacteria TaxID=2 RepID=A0A0F2CQC7_STRCR  ali  24  1.MESITLSPKRAEIEAFVQKYQDK-LVPSKNQYIQYLLKLNQATVSIYTSGKVLFQGEKAGHYAAFFGHQA-----EEASKTSQKISLIGTDEVGNGSYFGGLAVVASFVSPEQH-AFLCKLGVGDSKALTDLKIRQLAPILKKEIQHQALLLSPEKYNEVIASGYNAVSVKVALHNQAIYLLLQKGLTPEKIVIDAFTSQQNYDKYLQNEKFPNPVSLIEKAEGKFLAVAVSSIIARDLFLENLENLSQELGYTLPSGAGSKSDQVASQILQAYGMAGLQHTAKLHFKNTEKAKKLLE. 293
363 2.000e-68UniRef50_A0A1W9RIW1 Ribonuclease HII n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RIW1_9BACT  ali  19  7...................................................................LTFDELVEFDNLIAYSRYNLVAGVDEAGRGALAGPVVAAAVICRPTERLDR-----VRDSKLLSENLRESLYELIIDAIAWGVGIVESDEIDRVNIL-----NATMEAMKEAVASLA---VMPEFVMVDGGKLPEL----------AVPSKAVIGGDGKSFSIAAASIVAKVTRDRIMRKEFPLYGFARNKGYGT---REHIAAIVKHGHSPFH---RRSFK........... 203
364 2.000e-68UniRef50_A0A2N0LFV4 Ribonuclease HII n=3 Tax=root TaxID=1 RepID=A0A2N0LFV4_9CHLR  ali  19  2.......................................................................PDLSLESGILNSGVQFVAGVDEAGRGPLAGPVVAAAVILPPDLTGDELWLQSLDDSKKFTQARREHAAQVVHEHAAVGVGTVSPEDID-----VMGVGRAALSAMMRAVGQLALQPGHLLLDFIHVRECPYTYD-------------TIVKGDSRSYSIAAASNIAKVTRDRLMEETYPGYYFARHKGYPTK---AHFERLNELGPCPIH---RRSFAPVAQA...... 204
365 2.000e-68UniRef50_A0A1Y1VFU7 Ribonuclease n=5 Tax=Opisthokonta TaxID=33154 RepID=A0A1Y1VFU7_9FUNG  ali  18  5......................................................................SPMYSTETPEICKEEEVLIGIDEAGRGPVFGPMVYATCYCPISK-IDALNNFGFADSKTLNEQARNDLFDVINKNFGWMATACSPQDISKHMREKYNLNQFAHDTTIDLINNVLKHKVKVKEIYIDTVGPASVYQAKLKTFFPTLKITVENKADSKFPIVSAASICAKVNRDNLISNWKFIENFIGEKGSGYPGDPKTKDWIKNHKVFGFPGLVRFSWSTCENYL..... 242
366 2.000e-68UniRef50_A0A139DTI0 Ribonuclease HII n=1 Tax=Candidatus Adiutrix intracellularis TaxID=1705730 RepID=A0A139DTI0_9DELT  ali  20  2.....................................................................LEELNPVEDAYFRLGASPLAGTDEAGRGPLAGPLVAAAVILDPNQAYP-----GVGDSKKLSALERGKAFEIIVSAVVWAWTGVEASEVDRLNPLR-----AALLAMRRAVAALVIRPA---LVLVDGNVKPDL----------EVPARTLVRGDERSLSIGAASILAKVTRDRLMVEWYPQYNFDQHKGYGTK---KHYEALRLYGPSPCH---RLSFRGVK........ 200
367 2.000e-68UniRef50_A0A2N2JF54 Ribonuclease HII n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2N2JF54_9DELT  ali  21  34..........................................................................EVERWAVEQGLSSLIGLDEAGRGPLAGPVVAAACALPWPCPVA-----GLNDSKQLTEARREALFDQIVEHIAFGLVLVEPDVIDEINIL-----QASLLGMAHAWQAVEAAPGLATAVLVDGN--------QRAPLPATVDQRTLVKGDARSLNIAAASILAKVARDRYMDCDYPEYGFGRHKGYPTP---QHQAALNAHGPCPLH---RRSFR........... 230
368 2.000e-68UniRef50_A0A2V9JUG3 Ribonuclease HII n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JUG3_9BACT  ali  24  13........................................................................TRRLEAQAARQGWRLVAGCDEAGRGALLGPLYAAAVILDPVRPIP-----GLDDSKKLSPQERASLAAEIHKAIAFQVVALEAAEVDALNVY-----EASRQAMIRALCALRPAP---DYVLTDAM----PLHRPSDAQEFSIPYRPVIHGDALSISIAAASILAKVARDARLQELYPEYQLKKNKGYGT---REHLEALARHGPCPEH---RQTFEPVKDYL..... 216
369 2.000e-68UniRef50_UPI0008357BDE ribonuclease HII n=2 Tax=Pseudovibrio TaxID=258255 RepID=UPI0008357BDE  ali  18  21...........................................................................FESELSLKLGADLVGIDEAGRGPWAGPVVIAAACLDYTQLPN-----GLNDSKKLNEATREALYGEILAKAQVSICVQSAQTIDQLNIR-----EATLQGMTKCYLRLASKK---THAFIDGRDVP---------SGITGPAQALVKGDGRCLAIAAASIVAKVTRDRLMKKHFPGYGFAQHKGYGTK---LHQAALATLGPCALH---RRSFRPIHALLD.... 216
370 2.000e-68UniRef50_A0A2H0CD64 Ribonuclease HII n=5 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2H0CD64_9BACT  ali  18  1.................................................................MLSKARQMLAWEKKALLEGASIVIGVDEAGRGPLAGPVVAGAVILKSPDY-----KTRIDDSKKLRPLQREKAFREIREKAFFGVGIKDNKYIDR-----ENIHMATLAAMKQAVKNLVSKIRKDICVLVDG----------LFGGFLPYKTIPIVKGDSKSLTIAAASIVAKVTRDAIMDKLYPRYGFSKHKGYGTK---NHLEALGQYGPCPIH---RKTFAPLKN....... 216
371 2.000e-68UniRef50_A0A2V9RHB6 Ribonuclease HII n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9RHB6_9BACT  ali  22  18........................................................................DLTYEKLALEQGYRRIAGLDEVGRGALFGPVCAAAVVFDIAHAIPK----GINDSKKLSAKQRVHLAESIREAADFSIAFVESSIIDRINIL-----EATREAMRQAVNGLRQKP---DYVLCDG----------IVITNLSTPQENIIKGDTRSISIAAASILAKVERDGLISRLYPGYDLGNNKGYPT---SNHLQALKSLGPTPYH---RITFRGVR........ 213
372 2.000e-68UniRef50_A0A087SM52 Ribonuclease n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A087SM52_AUXPR  ali  15  15.........................................................................................GVDEAGRGPLAGPVVAAACIIPPDVTIP-----GLDDSKVMSEEGRETAYDLLTQHVEWAVAVVPVEVIDGINIL-----QAALKAMVEAVDALPT--GYPDYVLVDGNRLPKDMDRERSA--------AIIKGDSKSIPIAAASILAKVTRDRLMHQQHPEYGFDQHKGYG---VPAHIAAIRQHGPCPAH---RRTFAPVK........ 216
373 2.000e-68UniRef50_E2BXN6 Ribonuclease n=2 Tax=Harpegnathos saltator TaxID=610380 RepID=E2BXN6_HARSA  ali  17  51..........................................................................FSEVPQMCKSEPCQLGVDEAGRGPVLGPMVYGISYAPLS-RKQLLVELGCADSKSLTEKKRDEIFDGICEHIGWAVEAISPNVINSMYRRKVSLNETSMVSATELIKAAIEAGVNVAEVYVDTVGKPETYQARLKAVFPGVKVVVAKKADSTYPIVSAASICAKVSRDHAIRAWFREVDVAFPYGSGYPTDPVTKKWLSANGVFGFPQLVRFSWSTAEQILQSN.. 283
374 2.000e-68UniRef50_A0A2E1AGY6 Ribonuclease HII n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E1AGY6_9CHLR  ali  16  17..........................................................GARVIMTKRKSKTASLKYEMEYYRNGYTRIIGVDEAGRGPWAGPLMVGAVALPLDRTDLQKALKGVRDSKLMTANQREGLVETIKESLTWGLGAAEVDEIDELG-----LTDATKLAVERALNDAIERGFQPDCLFCDFMAWPPKWQMH---------QLSIVKGDQLSLTIAAASVIAKVSRDAYMIDIFPQYGFEKHKGY---HSPLHVAALEQLGPTPIH---RRSYAPIRKFLGE... 240
375 2.000e-68UniRef50_B9EBC6 Ribonuclease HII n=8 Tax=Macrococcus caseolyticus TaxID=69966 RepID=RNH2_MACCJ  ali  17  44.........................................................KQIAQETQAIHEYEQMLEYERRY---NGKVVCGIDEVGRGPLAGPVIACAVILNDGHHY-----IGLNDSKQLSKHKRASLYDALTQSVTYAIGAASVEEIDKFNIY-----EATKLAMHRAIDKL---PVKPDVLLIDA-----------MNLNTGLIEESIIKGDAKSVSIAAASVIAKVYRDHLMEEIHEEYDFNRNAGYGTK---RHLDGLMQYGITAHH---RKSFEPIKSMIKTEEN 256
376 2.000e-68UniRef50_UPI000A72FD04 ribonuclease HII n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=UPI000A72FD04  ali  20  2......................................................................................LVCGVDEAGRGPLAGSVFAAAVILDMSRSLPEL-----NDSKKLPKKKREELFLVIQEAIAWAVAEATVAEIDQMNIL-----QASLLAMKRAFDKVS--HVPCDDVCIDGSHCPNL----------STVCRAVVCGDALIPAVSAASIMAKVSRDHYLHELYPQYDFVKHKGYPTK---QHFLLLEKFGPSPVH---RCSFAPVKNLLKE... 188
377 3.000e-68UniRef50_A0A0L0FM82 Ribonuclease (Fragment) n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A0L0FM82_9EUKA  ali  18  87........................................................................TIESEVPDICKTEPCRLGIDEAGRGPVLGPMVYGTAFCPISK-LDELRKMGFADSKVLKEEQRDALLEVIKDNIAWNARVLSPQDISSLRKDKYNLNALSHDTAIALIRCALAKGANVTEIYVDTVGHAGKYQEKLEGLFPGKKIRVESKADAKYAVVSAASIVAKTLRDEEIREESDMANVDRNFGSGYPGDPTTKAWLRNNPIFGFPGLVRFSWSTVTKLLDE... 321
378 3.000e-68UniRef50_A0A139T0Z6 Ribonuclease HII n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A139T0Z6_9FIRM  ali  23  5.........................................................................LKFEKMAYDLGKQYVIGLDEAGRGPMAGPLVVGGVIFEKGYYNEL-----INDSKQLSEKKREELYDIIRDALAYQIEVIDVEDVDRLNVY-----QASKKGMLDAIEHIA---IEPDYALSDA-----------MPLGDQIEHLAIVKGDTLSMSIGAASILAKVTRDRIMDKIYPEYGFAKHKGYPTK---QHKEALKQYGVTPIH---RRSFQPVIDVLNE... 202
379 3.000e-68UniRef50_E3DRN8 Ribonuclease HII n=12 Tax=Halanaerobium TaxID=2330 RepID=E3DRN8_HALPG  ali  15  1MNNSLDFRVSELTIKELKNKCSNLELKQELIS-VIKVLKKDSRKGVQKIAAKLE---RKIAKKEAIVTKWEKMQQLEKEYSQKGYQVIIGIDEAGRGPLAGPVVAAAVLLDPQNKI-----YGLDDSKKLNLTKRENLFKQIKAKAKVGIGQATSSEIDKYNIR-----EATFTAMKRAVKDLLPKLQKPDLLLIDGNAVIPGL---------TVEQESIIDGDAKVNNIAAASIIAKVSRDKLIYKYFPEYNLESNKGYGT---AEHIAALKKYGSTPIH---RKSFA........... 267
380 3.000e-68UniRef50_Q6FCT7 Ribonuclease HII n=102 Tax=root TaxID=1 RepID=RNH2_ACIAD  ali  18  2.......................................................................................IAGVDEAGRGPLVGSVVAAAVILDPHNPID-----GLNDSKKLTEKKREKLFVEIQEALAWSIAEANHIEIDELNIL-----QATFLAMRRAVDGLQIQP---DKVLVDGNQIPK---------GISIHCEAIVGGDASHAEISAASILAKVYRDQQMDEKYPLFGFAKHKGYPTK---AHFQAIAIHGVVDEH---RRSYAPVRRALN.... 186
381 3.000e-68UniRef50_A0A1F5B7H6 Ribonuclease HII n=9 Tax=root TaxID=1 RepID=A0A1F5B7H6_9BACT  ali  21  2.......................................................................PDFRLEREFWSTGLRHVAGVDEAGRGCLFGPVVAAAVVFPPHFNPAWLRE--VNDSKLLSPARRERLARSILAGAAVGLGLVHPAEIDRLNIY-----WASLEAMRRAVSDLAQ---PPDGLLLDGFPLKEV----------NYPQRPVHGGDRASVSIAAASIIAKVFRDDAVIRLFKGYGLARHKGYGTP---EHYRALSRLGPTPYH---RRSFR........... 206
382 3.000e-68UniRef50_L1JAA8 Ribonuclease n=2 Tax=Eukaryota TaxID=2759 RepID=L1JAA8_GUITH  ali  16  1........................................................................................MGIDEAGRGPVIGPMVYGACIIC-SKRNNELKEMGFADSKTLTEEKREVLFERIKESLGWLVEVLSAKQLSMLQRAPYNLNAISHDTAIGMIRKVLAANFNLKKVFVDTVGDPERYESKLSSLFPSIEFAVRKKADSLFPVVSAASICAKVTRDRCVRDWFKETGFSTDYGSGYPSEPQ---------VFGYPDLVRFSWSTTKKIIETQGE 209
383 3.000e-68UniRef50_A0A1G1W189 Ribonuclease HII n=2 Tax=Candidatus Chisholmbacteria TaxID=1817900 RepID=A0A1G1W189_9BACT  ali  20  3.......................................................................PTLRYEKRLWEKGYTRIAGVDEVGRGAFAGPIVSAAVVFPK-MHRKIHSLHDVRDSKLLSAKKRELLAPKLRKSLQWSVGSASTSEINN-----YGIVKATFTAMRRALKKLK----HVEYVLIDAFYIP------YLRGLSRKRQLAIVKGDARCFSIAAASILAKVHRDRLMVELFPQYHLDRHKGYGT---LLHRQALKKFGAQSFHR.................. 198
384 4.000e-68UniRef50_A0A2D5Y3K0 Ribonuclease HII n=1 Tax=Micavibrio sp. TaxID=2024841 RepID=A0A2D5Y3K0_9PROT  ali  17  2.......................................................................PDFSLEEQYGNK----VCGIDEVGRGPLAGPVVTACVFIPENKRN-LSFISGIRDSKKLSRTKLEYCEAYIKEHCVWALGSCSVEEIDHMNIL-----QATLLAMKRSFDAMPETVKPNMRILIDGNHLPQNM---------PCPAYTIKKGDDKSYSIAAASILAKLSRDRIMEKLHPYYGWSSNVGYPSP---AHKLAIKNHGITEHH---RKSFAPVKAYIDRK.. 206
385 4.000e-68UniRef50_A0A1Z8TNB9 Ribonuclease HII n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8TNB9_9PROT  ali  21  7.....................................................................................SVLAGVDEAGRGPLAGPVVAAAVILGSGFQYEDL-----ADSKKLSERKREEANLEVRKQAAWSIGLASAAEIDQ-----FNIHTATLIAMRRAVLGL---PFEPERVIVDGNFTPNL----------PWPSTAKPRADATETSVSAASVLAKVFRDRYMRELFPEYGFGQHKGYPT---RVHLEALEHFGPSLVH---RFSFRPVREAL..... 191
386 4.000e-68UniRef50_A0A0G1D6Y4 Ribonuclease HII n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1D6Y4_9BACT  ali  17  2.......................................................................PTRDLEYRLREEGYTAIVGIDEAGRGAWAGPLYAGAVILD-DAGAEVLSGI-VKDSKVMTAHQRDNAYNAIVANAAWGVGCSSHDEIDTLGLARANQ-----LAAERALQQLTQ---PYDYVILDG----------RLTVSFDIPQQSIIDGDAKCLSIAAASIIAKVSRDRVMHEQYPEYGFDTHVGYGT---REHQTALNTYGACPLH---RKSYAPIRALL..... 203
387 4.000e-68UniRef50_C4XKL6 Ribonuclease HII n=8 Tax=Bacteria TaxID=2 RepID=C4XKL6_DESMR  ali  20  8.....................................................................................RLVAGVDEAGRGCLAGPVAAGAVILPEIYELP-----GLTDSKKLTPAKREALAPAIKQALAWAVAFVWPGEIDRINIL-----QATFAAMAKALAHLR---LFPGLACIDGNKIIPE--AYLGLLAGRLRQECVIGGDASVPAISAASILAKTARDRLLDRRHPGYGFAAHKGYG---VAVHLDALRRLGPCSIH---RLTFRGV......... 196
388 4.000e-68UniRef50_E9GHZ3 Ribonuclease n=15 Tax=Daphnia TaxID=6668 RepID=E9GHZ3_DAPPU  ali  17  23..............................................................................PDVCRKQPCALGIDEAGRGPVLGPMVYGITYCPES-RAEELKAIGCADSKTLTEEQREKLFGKLQDFVGWAVEVISPNSINMFKRLKHSLNEVSHDSAIGLIRKALSLEANITSVFVDTVGPPEKYQAKLSALFPGIKITVSKKADSLFPVVSAASICAKVARDKALSTWFKESPFELKWGSGYPGDPTTKKFLAQNGVFGFPQLVRFSWSTSEQILKTKG. 258
389 4.000e-68UniRef50_A0A1F8UVJ2 Ribonuclease HII n=1 Tax=Clostridiales bacterium GWF2_36_10 TaxID=1797682 RepID=A0A1F8UVJ2_9FIRM  ali  21  3........................................................................TWDMQNTFYTETINVICGCDEAGRGPLAGPVFAAAVILPKGHIIKEL-----DDSKKLNEAARERLYDLIRESVAFAIAHAEVYEIEAINIL-----NASMLAMRRAIEQLKIQPN---LALVDGN----------IVRNFPIPAQPVIKGDGIIPSIAAASILAKVARDRFMDMFYPGYGFAKNKGYATK---EHKAAILKIGPCPVH---RKSF--LKKTLGDN.. 201
390 5.000e-68UniRef50_A0A2T6DGH4 Ribonuclease n=1 Tax=Verrucomicrobia bacterium LW23 TaxID=2161867 RepID=A0A2T6DGH4_9BACT  ali  43  39..SSYTFDLTPAQSEKLHKLLMERGYEFKQVPYTTFAATKDRLTVNSYKSGKLVVQGKGAKEFVEFILEPEILGEYAELHDPQMFEPHIGVDESGKGDFFGPLVVAAVY-TKKATARKLMDLGVRDSKAISDAAAEKLADQIREVVGCKVIALGPETYNKLYGKFRSLNRLLAWGHAEVIEELLSRIPDCPRALSDQFTDPD-VIRKALKPLGKQIVMEQRTKAESDIAVAAASILARAEFVRRLRELGPG-SLTLLKGASAQVKALAKKIATEQSPEALRRLCKAHFKTYYEA...... 344
391 5.000e-68UniRef50_A0A2I4E2R8 Ribonuclease n=24 Tax=Magnoliophyta TaxID=3398 RepID=A0A2I4E2R8_9ROSI  ali  16  9................................................................................KWASKPCIMGIDEAGRGPVLGPMVYGCLYCARS-YQKTLSALNFADSKTLKEEKREELFENLKDSIGWDVDVIDPKELSAKMLKRNNLNEISHDSAIGLINRVLNIGVLLTEVFLDTVGDPEKYRMKLSQRFPAIKFVVAKKADSLYPVVSGASIVAKVTRDRALREWVLDENTHRNFGSGYPGDPETKAWLEKHLIFGFPSLVRFSWGTCTPYLKD... 233
392 6.000e-68UniRef50_A0A0P0FII6 Ribonuclease n=131 Tax=Bacteria TaxID=2 RepID=A0A0P0FII6_9BACT  ali  40  12..HTYTAPLTLRQVEKLRQILTLHGFQLAIQPHTVFCAQKDKLRIVVYQKGKVLIQGKGIEDFVTFQLEPQASFGYTEAVQSELHAPHFGIDESGKGDFFGPLVIAGTYVDHSLAH-IFSSLGVRDSKRISDKRIRDLARQIRKSAPSEVIAISPLKYNELFLRFGNLNKLLAWGHARVLENLCKKQPDCPYALSDQFADVSLLQ-QALMTYGKKLCLKQRTKAESDVAVAAASILAREKLIDWLDVASAQHALRLPRGASLAVKNAAVTAVEKHGLHILHKIAKIHFKTATEV...... 308
393 6.000e-68UniRef50_A0A2M7T6R3 Ribonuclease HII n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T6R3_9ACTN  ali  19  3........FSKYTIAEIKTMLDQAGASERARLVSRLGNDPRQGVQRIVTSY-----HNEIKRFEAEDMRQKELSKYERAIHKQGFTLVAGADEAGRGALAGPIVAAAVILPKNAKIH-----GLRDSKLLSAEQREDLYGKIVNAVAWKAARIEHHQIDAHGIQWANLQSLE-----RAILGLEP---GPDYVLLDAFDIKTL----------EIPHLAIVKGDRLSLSIAAASVIAKVTRDRIMREYYPAYGFDRHKGYGT---QPHIRALEECGISPIHR.................. 249
394 7.000e-68UniRef50_A0A2A5RI64 Ribonuclease HIII n=6 Tax=Streptococcaceae TaxID=1300 RepID=A0A2A5RI64_9LACT  ali  25  2...NIVLNLDEKTIQQLMKKF-SLKQSTSKNQYIRFLAKVNGVSISVYSSGKVVFQGSGAEQVAKEFG-------YQAQVVSHQQINCIGTDEVGNGSYFGSLEVVATFVTADK-VDLLHRLGVADSKKLTDEKIRQIAPEIRKNLHHVALSVSPHKYNEVIEKGYNAVSIKVALHNQAIYLLEKKINSPENIIIDAFTTKANYEKYVVKEKNQVSSTVLPKAEDQFLAVAASSVIARASFLDHLDELSVLAGLKLPSGAGNKSDQIAAELIVKNGEQILDKYAKLHFANTQKAIQLVKN 292
395 7.000e-68UniRef50_A0A1V6I676 Multifunctional fusion protein n=1 Tax=Candidatus Marinimicrobia bacterium ADurb.Bin030 TaxID=1852851 RepID=A0A1V6I676_9BACT  ali  19  1..................................................................MKNEFPTLDFENNLWEQGISHIAGVDEAGRGPLAGPVVAAAVVFDKSSEI----ISGIQDSKQISPRKRERLFDEIMSQAAIGIGLVESEEIDRINILR-----ATHKAMRMAIGRLK---INVQHILVDGKPLPDKIY----------PQTAIIGGDRKCYSIAAASIIAKVYRDRLMQQYFPGYGFAEHKGYGTK---KHLESIVKLKPCPIH---RISFRGVTEYIVDINK 210
396 7.000e-68UniRef50_B2KC56 Ribonuclease HII n=1 Tax=Elusimicrobium minutum (strain Pei191) TaxID=445932 RepID=B2KC56_ELUMP  ali  17  3.......................................................................ELQRFDCEILQKNSCALIGIDEAGRGPLAGPVVACAVCAPKEIYHLF---EDVNDSKKLTDVKREKIYARINGKIAYGVGFASAKEIDEINIL-----QATFLAMRRACQKFLD--INEALALVDGNHKIKDFL---------LPQQTVIDGDAKSFSIAMASVIAKVHRDRYMHELYPVYGFDGHKGYGS---GKHIAAIKEHGPCKEH---RMTFAPLKNL...... 204
397 8.000e-68UniRef50_A0A1F8JHT9 Ribonuclease n=1 Tax=Chlamydiae bacterium RIFCSPHIGHO2_12_FULL_49_11 TaxID=1797603 RepID=A0A1F8JHT9_9BACT  ali  36  1MSTCFTTKLSKEKIAAFESDLQNLGFTVTKPQYTHFQARRGKLTLTYYRSGSLVIQGQDTDEIVRTYIEPVTDLSYSYPVHAIDTSPRIGCDEAGKGDIFGPLVVAAVYVN-DSLVEKLFQAKVKDSKQMTDTLVAKAASLIKTICPHEIMVLNPPKYNELYDKIGNLNHLLAWAHVTLMEKLALR-TEAESIILDKFGS-EHYVEKLKQGRGIKIPLKQMVRAEEDIAVAAASVLARNAFVMGLHELEKKHGVSLAKGAGTPAMAAHR--LRNTSPELIPAVGKLHFKSFR........ 292
398 8.000e-68UniRef50_D1ANU2 Ribonuclease HII n=41 Tax=Bacteria TaxID=2 RepID=D1ANU2_SEBTE  ali  21  3............................................................................ELRLFDNEYNCIIGVDEAGRGPLAGPVVAAAVII--EDYFEELEE--INDSKKLTEKKREKLYAVIREKRKVGIGTADEKEIDKINIL-----NATFLAMRRALE----QIDNYDIVLVDGNHKIREY---------SGRQEEIIKGDGRSLSIAAASIVAKVYRDNIMKRQYPDYRFEKHKGYGTK---LHRELLHAHGACKIH---RKTF--LRKILGE... 197
399 9.000e-68UniRef50_A0A1Z9M761 Ribonuclease HII n=1 Tax=bacterium TMED198 TaxID=1986779 RepID=A0A1Z9M761_9BACT  ali  17  1........................................................................MKEFEEKYWRNNYKRVCGIDEAGRGPLAGPVVAASVIFSPNSFLESA-----KDSKKLSEKKRNAIFKDIYNAASVGVGIVNEETIDRENIL-----EATYIAMRKSIYRLS---VNPDIVLVDG----------RKAKIGEYKQESIIKGDALSFTIASSSIIAKVTRDRMMDKVFPEYGFASHKGYGTKY---HIEAIRENGATCIH---RKSFRPVSSFLPTFKE 203
400 1.000e-67UniRef50_A0A0U9HM51 Ribonuclease HII n=10 Tax=Bacteria TaxID=2 RepID=A0A0U9HM51_9BACT  ali  20  2.......................................................................NLFAFDESFFAQGYSSIAGIDEAGRGCLAGPIVAACVSFRDNVFIE-----GIRDSKELTPEQRENLFEQIISNAFVGVGIID-----VDIIDRINILEATRLAMIKAYENL---GRKVELLLIDAVSLPEL----------KIPQKAIIKGDRKSALIASASIIAKVTRDKIMKDYHEKYGFDRHKGYATK---EHLQALKKFGPCPIH---RKSFSPVRELM..... 199
401 1.000e-67UniRef50_A0A2A5RXY1 Ribonuclease HII n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2A5RXY1_9LACT  ali  16  28...............................................................IAEAKRLETLLIHERELYINNIMLIAGIDEVGRGPLAGPVVAAAVILPENCKIA-----GLNDSKQISKSQHQKVYDEIAQALAVGIGCIDHQVIDQVNIY-----EATKLAMLQAIDQLTIKP---QHLLIDA-----------MQLAVDIPQTSLIKGDAKSMSIAAASIVAKVTRDKLMDKQYPGYDFAHNAGYGTK---KHLQALVEQGVIDIH---RRSFEPIKSMKND... 235
402 1.000e-67UniRef50_A0A2H0VNL8 Ribonuclease HII n=1 Tax=Chlamydiae bacterium CG10_big_fil_rev_8_21_14_0_10_35_9 TaxID=1973935 RepID=A0A2H0VNL8_9BACT  ali  16  1........................................................................MSIFEYHLHERGYRKIAGVDEAGRGPLAGPVVTACCVLPYGF-----ELIGIDDSKKVDADLRKQIYQTLINKVEYSIAVIDVETIDRLNILH-----ATLYGMKKAVLGMKNKP---DYLLIDGNQVPDVDIAKE----------AVVSGDAYSLSIAAASIIAKCTRDAIMENYHPNYKFDRHKGYGTP---DHLDALEKYGPCSIH---RKSFEPIKKFFKSEE. 203
403 1.000e-67UniRef50_A0A1F8GWN8 Ribonuclease HII n=8 Tax=Candidatus Yanofskybacteria TaxID=1752733 RepID=A0A1F8GWN8_9BACT  ali  15  4.......................................................................PTRLLERKLFRDGYTSVIGIDEVGMGCLAGPVVVCAVSFSKEFYASKRSSLGVRDSKLLTARQRETLASQLIASLQYTISYCYPKTIDKINIY-----QAARKAMRRAVAKLYSHKPPRAIVLVDGPH---------KIQGLEMPQRAIVKGDRTVFAIACASIIAKVHRDRMMARYFPQYGFERHKGYGTK---FHVAMLVRFGPTEIH---RRSFAPVGNL...... 225
404 1.000e-67UniRef50_A0A1G9A8S4 Ribonuclease HII n=2 Tax=Staphylococcaceae TaxID=90964 RepID=A0A1G9A8S4_9STAP  ali  16  35...................................................KALLQRNRLEKQALLLEKYEYMMRYENEHPGK---VVAGIDEAGRGPIAGEVVAAAVILPDDFKLP-----GLDDSKKLSVKKRLEFREFIMAHADYGIGIATSEEIDE-----YNIYQAAKIAMNRALENLTEQP---DHLLIDA-----------MTLDTDIEQTSIIKGDANSNSIAAASVLAKTTRDMMMDKEFPGYDFENNKGYGT---RKHLDGIENFGVTKIH---RKTFEPVKSKINQK.. 252
405 1.000e-67UniRef50_A0A0G0HTC4 Ribonuclease HII n=9 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0HTC4_9BACT  ali  16  5........................................................................NFILEKDFASQGYTHIIGTDEVGRGPLCGPVLACAAMFDINFEIPAEKVKLIRDSKKLSEKQREEIFEFIGEHFYLGIGLCDHETIDRINIL-----EASFLSMKKAIQDLRIKNGNPNSVIHDSKFLI-LVDGNKEIPNLSIEQYPVIGGDKLVKSISAASIVAKVTRDRIMEQMYPNYGLDKHKGYGTKV---HMQALIEFGPCPIH---RKSFAPVKKSLKK... 232
406 1.000e-67UniRef50_A0A1V9WXY3 Ribonuclease n=2 Tax=Gamasina TaxID=1723665 RepID=A0A1V9WXY3_9ACAR  ali  16  2.............................................................EAVDKWKENLELSSSPDSEICLNKDCVLGIDEAGRGPVLGPMVYGTAYWPISKA-KTFEEMGLDDSKTLSEADRERLFDLYNAISGWHLICISPVTISKAMLSKDNLNEVSHNAAISLIRRALARGVRVAEVYVDTVGPPDKYQSKLQNIFPDIKITVSKKADSLFKVVSAASICAKVARDRALKTWCWREGIYENIGSGYPGDTMSINFLRKDPIFGFPSIARFSWLTAENLLEKN.. 250
407 1.000e-67UniRef50_A0A1B0CZB7 Ribonuclease n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0CZB7_PHLPP  ali  15  294.........................................................KDLEAFLGTWDNSGNTVFFSKPENCLNTPCVLGIDEAGRGPVLGPLVYGISFCAMS-NTDVLKDLGCADSKQLTEEKRENIFWDILDNMGWAVELISPNYISQSMLRKHSLNEVSMESAIGLINQAISLNVNIAEVYVDTVGPPETYQAKLSRLFPNISITVAKKADSTYPIVSAASICAKVVRDAALRTWKFEVAPEKPFGSGYPGDPLTKAFLEDNNIFGYPRIVRFSWATAEQALEKTAQ 547
408 1.000e-67UniRef50_A0A1Y2F2W5 Ribonuclease n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2F2W5_9BASI  ali  15  47.........................................................................KEVEQPAIE--GDWMLGVDEAGRGPVLGPQVYGIAFC-QLEYSDELKSLGFADSKTLKDPEREELFEVIMENVKYAVTVMSPHDISRGMLRRYNLNAQSHDVTINLIREVLERGYKIKEAYIDTVGIADTYQQRLEGLFPTVSFTVTSKADAIYPIVSAASIVAKVTRDRLLAAWNFKGDESRVFGSGYPSDPKTVAWLENNPVFGFPNVARFSWQPVKTALMKKG. 282
409 1.000e-67UniRef50_Q8E5I2 Ribonuclease HII n=506 Tax=Bacteria TaxID=2 RepID=RNH2_STRA3  ali  17  2...........ATIKEIKAILETIVDLKDKRWQEYQTDSRAGVQKAILQRKK------NIQSDLDEEARLEQMLVYEKKLYIEHINLIAGIDEVGRGPLAGPVVAAAVILPPNCKIKHL-----NDSKKIPKKKHQEIYQNILDALAVGIGIQDSQCIDDINIY-----EATKHAMIDAVSHLS---VAPEHLLIDA-----------MVLDLSIPQTKIIKGDANSLSIAAASIVAKVTRDKIMSDYYPGYAFSKNAGYGTK---EHLEGLQKYGITPIH---RKSFEPIKSML..... 253
410 2.000e-67UniRef50_UPI000D37817A ribonuclease HIII n=1 Tax=Candidatus Similichlamydia epinepheli TaxID=1903953 RepID=UPI000D37817A  ali  37  1.MSVHVFQLDNSKWKLLETFLLDNGFVQKKIPHVVFLLQKSGVSCCLYESGKCTVQGKEGQEFIEFVLEPFLEDFSYSLGKIEDSSVRIGTDESGKGDLFGPLCVTAVFIDTS-TEQKLKKLGVRDSKKLSDQRAISLAQEIREICRYRSLRLVPSTYNRLYDKFGNLNLLLGWAHAKVVADLIKETGTPDKLVVDQFAKDQKLLERAFAKENINVPLEQRFRAESDISVAAASVISRAIFLDWIKDTSEKIGLLLHKGSGEKSQDSLEAFMNREDTSLIFDIAKMHFKQIKEI...... 295
411 2.000e-67UniRef50_A0A1F3Y477 Ribonuclease HII n=2 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3Y477_9PROT  ali  19  10.......................................................................................VVGVDEVGRGCLAGPVVAGALLLPAVVDEPWLRE--VTDSKFVKPETRERLAPLIEKWAACAVGVASVEEIDAINIF-----EASHLAMCRAILGLKGLGGTPDHVLVDGKFKP-----KFEVHGIVCSSDAIIQGDRQCLSIAAASIIAKVWRDRLMVQLYPGYGFAVHKGYSTP---EHSACLKKQGVCAIH---RRTFAPVASLLGKSG. 216
412 2.000e-67UniRef50_I0AH85 Ribonuclease HII n=9 Tax=Bacteria TaxID=2 RepID=I0AH85_IGNAJ  ali  17  1........................................................................MKNIDKKYFRQGIDFLAGVDEAGRGPLAGPVVAAAVILPKDFHHKE-----INDSKKLSFRQREKLFEVIIENISYSFSVISHSTIDRINIL-----NASLLAMKKSVSKLKP---VPQIVLIDGN----------KSFGANQNLIPVVKGDSLSQSIASASIIAKVIRDKMMSRLAEQYGWEKNKGYPTK---QHIEALLKFGPSPVH---RKTF--LKKIMNQSFQ 201
413 2.000e-67UniRef50_A0A085NDL1 Ribonuclease n=1 Tax=Trichuris suis TaxID=68888 RepID=A0A085NDL1_9BILA  ali  15  875..ETQVVRLLPQDM-EIIERLKSMGFPESAVIEAYFACEKNETLAVQIMSDKLVISSNTA--------------------FLRGKSCTLGIDEAGRGPVLGPMVYAVGIC-ETTELGRLELLGVKDSKQLTEETRCSIFDKLVDAFSYGLKILPAAFISKLGRVKYNLNEISHDAAIELIEAALRNDVKVEKVYVDTVGPAETYARKLSSRFPLLDIVVSKKADSLYPIVSAASICAKVTRDKQLRDNFKELDAGINVGSGYPSDPATVEYLQTDPIFGFNSFVRFSWSTARELLQKK.. 1159
414 2.000e-67UniRef50_A0A2E8Y781 Ribonuclease HII n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8Y781_9BACT  ali  20  4............................................................................ELGLLGQGHVRIAGVDEAGRGAWAGPLTAAAVILPPIAYYDRRLFWGVTDSKKLTPLQRDRWAYQIHKTAAVGVAHVTPQEIDR-----YGMAAAGRLAMTRALERMRLDP---DHVLVDAFPLEE-------GNRFADRQTALVRADTSCLAVAAASICAKTARDRLMHRQFPSYGFDRHKGYGT---RVHRDVLGELGPQSIH---RHSFAPVR........ 202
415 2.000e-67UniRef50_A0A2M6ZZD5 Ribonuclease HII n=1 Tax=Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_38_7 TaxID=1973971 RepID=A0A2M6ZZD5_9DELT  ali  17  9...................................................................LPKDSLTFFEKRLYKDGVDLVAGIDEVGRGCIAGPVVAASVILPKNCDIPKL-----NDSKQLTKKQRDYFYNLITDAVDWSIAFVDSLEIDRINILR-----ASLKAMLQAV---SQHKIKPQFLLIDG----------LQKIDSELPQLALKKGDSRSLSIAAASVMAKVTRDKWMDDLYPGFTFSTHKGYCTK---AHIRELAKYGVTPIH---RKTFRPV......... 207
416 2.000e-67UniRef50_A5EV63 Ribonuclease HII n=7 Tax=Bacteria TaxID=2 RepID=RNH2_DICNV  ali  20  2.......................................................................................IAGVDEAGRGAWIGNVVAAAVILPNDYDLPDL-----TDSKKLSAAKRERLCAAIYEAIAVACAWCSPEEIDQLNI-----HYATLCAMKKAVITLK---VAPTEVLIDGKFAPEL----------PFPTRTIIGGDALEPAISAASIVAKVTRDKQMDALYPDYGFAAHKGYGT---QKHQQALRQFGVLPLH---RRSYAPIAALLKNNKK 189
417 2.000e-67UniRef50_UPI0001D17A80 ribonuclease HIII n=1 Tax=Geobacillus thermoglucosidasius TaxID=1426 RepID=UPI0001D17A80  ali  32  1.MSNNVITLDKEQIRKLEQFLLNNGLKQIQNTGTVFR--TDSVVISIYKSGKVLFQGKEATTWYNLIRENYVIDEKEDFEESKNNKIIIGTDESGKGDFFGPLVTASFLLQSKDAENKLIAIGVTDSKKISNKQIIALASEIKKIGPYSIVKIGPKKYNELYAKIGNLNNLLGWSHARAIENILTKY-NCSVAVADQFGDEKIIKNSLLKNGKEIKLYQFHKG-ENDIAVAAASILARSEFLQFINELEIKLGMRVPLGAGSSVLEIGIKLAKEKGLDYLSEVAKIHFKTYNMIKNS... 305
418 2.000e-67UniRef50_A0A1R0IQK9 Ribonuclease HII n=7 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IQK9_SULTH  ali  20  16..........................................................................QWEQQFWRKGWA-VAGVDEVGRGPLAGPVVAAAVILDPYTDI-----MGIDDSKKLSALKRQQLYEEIRTAIAIGVGAVGPRTIERINIL-----EASRMAMSRALGHLTIRPR---VVLTDA-----------MRIGGPWEELPIVHGDQVSASIGAASVIAKVIRDRYMQELFPVYGFEQHKGYPT---AYHRAMILQHGPSTAH---RRSF--LRKMMSSAQE 212
419 2.000e-67UniRef50_A0A2H0A9M6 Ribonuclease HII n=12 Tax=Bacteria TaxID=2 RepID=A0A2H0A9M6_9BACT  ali  15  9.....................................................................QQNIADVEKIAYMSGYEMIGGIDEAGRGPLAGPVVASVVILPKNTVIP-----GINDSKKLTPLQREKLYKIISTAIDWGVGIVEPVVIDQINIL-----QATYMAMKQAVAKLR---VNPQLLLVDGN---------LAIPEVSIPQCPIPRGDTFVTSIQAASIISKVIRDKIMDAIYPEYGFAKHKGYGTEG---HLQSMERHGVCNIH---RTTYAPVRELL..... 210
420 2.000e-67UniRef50_A0A2E5LQH8 Ribonuclease HII n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E5LQH8_9CHLR  ali  19  9.......................................................................PTFKQELQLIQKGFKYIAGIDEAGRGPLAGPLVAAAVILYCSITQSPFINL-IRDSKTLSERQREQARQVVKAHASIGVGISSTEFIDQHGIM-----SATISAMNEAVDKLS---ITPSFLLVDAVILKDN----------PLPSSSFIKGDSKCLSIAAASIIAKTTRDSIMDKTYPLYGFSQHKGYGT---QKHLAMLKHLGPSPVH---RRSFTPVKILLSSITK 216
421 2.000e-67UniRef50_A8MHC7 Ribonuclease HII n=13 Tax=Bacteria TaxID=2 RepID=RNH2_ALKOO  ali  19  2.......................................................................PTIDIESAIWNSGYENIACCDEVGRGCLFGSVLAAAVIMPKDVIID-----GVKDSKKLSHKKREQLYEIIKEKLAIGVGTVSSEIIDKINIK-----NATRLAMKKAILSLKDKIVAPDYILIDA-----------EEIDVPTPQSAVIKGDDLCHGIAAASIVAKVLRDRLCQRWHPNYGIGQNKGYGTK---AHREALKEHGPSPMH---RKSF............ 198
422 2.000e-67UniRef50_R2THP4 Ribonuclease HIII n=15 Tax=Enterococcaceae TaxID=81852 RepID=R2THP4_9ENTE  ali  23  1MSQTQVIKVTKDTMKKMKSFYE-RNYLNRTIPYSEFVAKVGNTTITAYTSGKVVFQGPDAETAAAKWGKPAQSKTSNKSSAKKTTSLVLGSDEVGNGSYFGPVTVCAAYVDKTMVTK-LKALGVRDSKELTDPQIRQLSDVIKELIPYKLLIVEPEKYNQIQPK-YNAVHMKVALHNQAIHLLLSEPIKPEAILIDQFTPEANYKKYVRNEQNQVSEKFITKGEQYHVAVAAASIISRAAFLEELDNESEELGMKVPSGAGTASDKVAAKILAKGGMALLSKYAKLHFANTEKAKRIASK 309
423 3.000e-67UniRef50_A0A2N2CH23 Ribonuclease HIII n=1 Tax=Firmicutes bacterium HGW-Firmicutes-19 TaxID=2013780 RepID=A0A2N2CH23_9FIRM  ali  27  7.MKTISISASAGQIKKIKELYKD-EITDKKIPYADCFIATEDCAITVYLSGKVVLQGAMAQHHAEIIASF------------NGFFAHGGSDEVGTGDYFGPVCVCAVYLDH-QHLDFVNSLNPSDTKGMDDGQIIAIAKALIKKVPYSLLILPNDKYN-VYHKKYNLNAIKSMLHNQCYLHLQKKVTKPFTGIIDQFTPQESYFRYLKDEKEIFKDLFETKAENKYLAVACGAIIARHAFLEALHQLEKYVGMPLPKGAGAKVDQAAADILEKHGIEMLSKVAKLHFKNTEKAKEILG. 290
424 3.000e-67UniRef50_A0A0L6URH1 Ribonuclease n=8 Tax=Puccinia TaxID=5296 RepID=A0A0L6URH1_9BASI  ali  14  41..........................................................................DEEEKLKRD--DWIMGIDEAGRGPVLGPMVYGAAFCTQAFAQDKLVDLGFADSKTLTHKRREELLEMIVQRVEWNVKVLTPADISQGMNRRYNLNAQAFDATCEIIQHALDRRYNLQHIYVDTLGPPKTHQMKLEHAFPGIKFTVCSKADSIYPIVGAASVVAKVTRDAIVSHWSEDEDATKSLGSGYPSDPNTVKWLSENFIFGFGQLVRFSWGTIKTLLAERG. 289
425 3.000e-67UniRef50_A0A1V5HMQ0 Ribonuclease HIII n=1 Tax=Tenericutes bacterium ADurb.BinA124 TaxID=1852921 RepID=A0A1V5HMQ0_9BACT  ali  25  2...SYTLNLTSSQAGEIISKYHEYSVSH-TNNYTLFRAKYKRTVVTIFKTLTLIVQGANTQEVYNEICGLLDMDKAQETNINSSNLSVVGTDEVGTGDFFGPIVVVGAFVPKNKIL-NLMKLGVKDSKSINDSKIMQLAPRLMKEIKYSALVMDNVKYNYLTKVHFNMNKIKALLHNNVIYNLLPKISDYDAIIIDGFTNKDKYFDYLKDQEHIITNVQEEQGESKYISVATASIIARYLFLVNFEKLSEMVGFELPKGAGPKVDLAIIKIIKEQSERYLELVGKTNFKNLEKMKKKDNH 301
426 3.000e-67UniRef50_Q6MLA0 Ribonuclease HII n=23 Tax=Bacteria TaxID=2 RepID=RNH2_BDEBA  ali  18  11.............................................................KHRGIRMAKKEKIEFPKIEWRDFSPPIIGVDEVGRGCLAGPVYAAAVIFKSDALNDL-----VTDSKLLSEKRREELADLILKEHIVGIGSASVEEIDEINIL-----NASLLAMKRAVEKL---GVKSGHVLVDGNKKIPNLK--------GFEQSTIVKGDLRVAPISAASIVAKVTRDRLMKDLYPHYGFEIHKGYSTPV---HKQSIVDHGPCIAH---RRSFAGVKEY...... 220
427 3.000e-67UniRef50_I4D9P0 Ribonuclease HII n=40 Tax=Bacteria TaxID=2 RepID=I4D9P0_DESAJ  ali  14  45.........................................................KQKQALSQEDARIQQLLVEEKKLWQNGFLLIAGIDEAGRGPLAGPVVAAACILPTRFNLP-----GLNDSKALTESRREKLFTKIQQAIDYAIGSAEPAEIDALNIL-----QATKLAMKRAVEGLTVRPH---YLLIDALTLPAV----------NLPQFPLVRGDQA-----------KVTRDRLMDTLYPEYTFAKNKGYGT---SDHMKVLRRLGPCPLH---RRSFAPVKQ....... 255
428 3.000e-67UniRef50_A0A0Q5TPJ3 Ribonuclease HII n=28 Tax=Bacteroidetes TaxID=976 RepID=A0A0Q5TPJ3_9SPHI  ali  20  13........................................................................................AGCDEAGRGCLAGPVFAAAVILPKGFFLE-----GLNDSKQLSHEQRDLLRPVIREALAWAVASCDHEEIDEINIL-----NASFLAMHRAIEKLHTQP---QYLVIDGNRF---------KAYPQIPHSCIIKGDGKYLNIAAASILAKTHRDEYMANLYPHYNWQQNKGYPT---IAHRKAVIEIGLSPFH---RKTF............ 188
429 3.000e-67UniRef50_E7GDN0 Ribonuclease HII n=2 Tax=Coprobacillus cateniformis TaxID=100884 RepID=E7GDN0_9FIRM  ali  24  5.........................................................................LRYEKAAYALGKSYIIGLDEAGRGPMAGPLVVAGVIFEKGYYHEA-----INDSKQLSEKKRESLYDIIRDALAYQIEIIDVEDVDRLNVY-----QASKKGMIDAIHHIAIQP---DFALSDA-----------MPLGDEIAHNAIIKGDSLSMSIGAASILAKVTRDRIMKKYYPEYGFAQHKGYPTK---QHKELLKMYGVTPIH---RRSFQPVIDILNE... 202
430 3.000e-67UniRef50_A0A1G5RSV5 Ribonuclease HII n=11 Tax=Bacteria TaxID=2 RepID=A0A1G5RSV5_9FIRM  ali  18  44.............................................................KLEKAADKFKQMSVFEAQFTKEGMPLVAGIDEAGRGPLAGPVVAAAVILDPEAPI-----YGLDDSKKLSEKVREMLYEEIEKALSVGIGYATCAEIDELNIL-----KATKLAAKRALETMEISPEA-------------LLLDALELENCTVSQLSLIKGDQRSVSIAAASIIAKVTRDRYMKRLYPEYGFDAHKGYGT---ERHYEALRSYGKTPEHR.................. 242
431 3.000e-67UniRef50_A0A1G2VJ25 Ribonuclease n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A1G2VJ25_9BACT  ali  18  2.....................................................................KKPTLAFEKKLWDRGHRCVIGLDEAGVGPLAGPVVAAAVFLRRRYQSTPQELTLVRDSKSLSEKQREKMFVALTAHVRYSVSRVWPAVVDRYNIRR-----ATELAMRRCVGKLMPALSGQVFLLADGLATIKRM---------PYPQAAVVRGDQKIFSISAASIIAKVTRDRIMHKKYPQYEFARHKGYGTIV---HYAAIKKFGPSPIHR.................. 202
432 3.000e-67UniRef50_UPI000781AD87 ribonuclease HII n=1 Tax=Alicyclobacillus sendaiensis TaxID=192387 RepID=UPI000781AD87  ali  22  21........................................................................................AGVDEVGRGCIAGPVVAASVVLPLERAYEELKD--VVDSKQLKANVREELAARIRKALAVGIGLASPEEIDRINILR-----ATQLAMKRSLDALD---VPVELALVDGNR----------GFRHRFPVLPVVDGDARSLIIAAASVVAKVFRDRLMAKLFPGYGFSEHVGYAT---RAHMEALRRLGPSVVH---RLSFAPVRALLSEKEQ 211
433 3.000e-67UniRef50_A0A2E5L812 Ribonuclease HII n=5 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A2E5L812_9PROT  ali  19  2............................................................................EDNLRLPSPALIAGVDEVGRGPLAGPVTAAAVVLHRAK-CPNRVLSKINDSKKLNVKTRQFLFDEIQQVSAIGIGWANTEEIDR-----KNIHWATMLAMQRAIIALRNLPRKLDFALIDGNRVPEL----------NCSAKSVVKGDAKSMSIAAASIIAKCTRDSYMNKLYPGYGWDRNAGYGT---REHLDALNFLGLTDQH---RRSFGPIAR....... 200
434 3.000e-67UniRef50_A0A2D8U9M0 Ribonuclease HII n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D8U9M0_9BACT  ali  14  14......LNFSKLSIAQIKSL--SQEWSLDSSHWELLGKDNRNGV------KKLVIAAKRREQAKTERIRQDKCLRYERKFWDAGLNFVAGVDEVGRGCLAGPVXAXAVILPMEFFLP-----GLDDSKKLSESKRIELDKAIREAISFSCFQVEAKTIDSINIL-----QASLEAMRNALKALE---TIPQQVLVDGHIKPRSLF----------PELPIVDGDSRSLSIAAASVVAKVYRDKRMCDLYPGYGFSKNKGYGSP---LHLIALNEKGLTPEH---RKSYSPVKSILKKSKN 275
435 3.000e-67UniRef50_G5GM61 Ribonuclease HII n=34 Tax=Bacteria TaxID=2 RepID=G5GM61_9FIRM  ali  16  1........MTNLTIKEIENIFLHGDVTDDLIESCRRDARKSVQTIL-----------RRYERTQRERERLDAMYVYERAAVAAGHTLVAGVDEAGRGPLAGPVAVAAVILPHEAHLPR-----INDSKKLSPAVREELFAQISDAISYHVALIDADTIDCMNIL-----QATRMGMYEAIAALTPAP---DEVLIDAVQLPKL----------SMPSQSIIKGDAKSASIAAASILAKVTRDRLMDEYYPNYGFAKHKGYGT---REHVEAIRTYGVCPLH---RKSFEPIRSILNNI.. 254
436 3.000e-67UniRef50_A0A0K2UDK3 Ribonuclease (Fragment) n=1 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2UDK3_LEPSM  ali  16  6...............................................................YTKNQDRNLILESDIPFICKSKPCLLGIDEAGRGPVLGPMVYGTVFCPIEKSQD-LKDLGVDDSKVLKEEAREELWSKLLENIAWILHVLSPLEISKGMLKKYNLNTLSHDTAIALIQRALTGGARISQVYVDTVGPPEKYQAKLQEIFPGIQITVAKKADSLYPCVSAASIGAKIARDKCLNNWHGDYPLANPWGSGYPGDPVTKKFLADHPVFGFPSIVRSSWKTADNL...... 247
437 4.000e-67UniRef50_A0A0D6ET16 Ribonuclease n=7 Tax=Sporidiobolaceae TaxID=1799696 RepID=A0A0D6ET16_SPOSA  ali  13  78.....................................................................................EWMLGVDEAGRGPALGPQVYGIAFCKLS-YLDELKELGFADSKTLTDPLREKLFKTIQENVKYAVTVMSPNDISMGMLRK------SHDVTINLIREVLERGYDVKECYVDTVGPAADYQAKLSSFFPTISFTVTSKADALFPIVSAASIVAKVTRDRVLEEWRFVEGEEVEKGSGYPSDPKTVAWLQDHPIFGFPNIARFSWAPVRNALQKKG. 296
438 4.000e-67UniRef50_A0A2E3YES3 Multifunctional fusion protein n=4 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E3YES3_9BACT  ali  18  8........LSEATIAEIEELLARRGGAGRTVLALLEQDARAGVRRLA------VRERQRLRRREAEQRRLRWIRQHEDGLWSTQMTHVAGVDEVGRGCLAGPVVAAAVILAPGTRLK-----GVDDSKVLDPPERQALRRQIEDAIAWHVAVVSAARIDRINIL-----EASMEAMRVALDGLQPAP---QHVLVDGNRSPGSSF----------PETLLVDGDARSMSIAAASIVAKEHRDELMDGLHPGYGFASNKGYASPG---HRDALLNHGPCAEH---RYSFSP.......... 258
439 4.000e-67UniRef50_A0A0F7GDT8 Ribonuclease HII n=2 Tax=root TaxID=1 RepID=A0A0F7GDT8_9CHLR  ali  18  6.......................................................................PHFREESDFIRQGLKLVAGVDEAGRGSLAGPVVAGAVILGKQRKCGWLKD--VQDSKLLSSETREELFQIITDAISFGLGIVSHTYIDTFGIVP-----ATRLAMRLAVAELTPAP---QALLIDFLRLPD----------IPLAQKGIVDGDAICVSIACASIVAKVSRDRLMRRLNEEYRLDQHKGYGTRG---HLELLVKHGPSCYH---RKSFAPVRNL...... 206
440 4.000e-67UniRef50_UPI000C13FD1C ribonuclease H2 subunit A n=1 Tax=Spodoptera litura TaxID=69820 RepID=UPI000C13FD1C  ali  15  3.........................................................KSLQELQDYIKSKDNFTNFTNPDVCKTEPCMLGVDEAGRGPVLGPMVYGIAYCPVNQT-KVLQDLGCADSKALTEEKRDDIFTKMINNVGWIADVISPNYISNSMYRKHSLNEVSMNSAIALIKKAAESGANITEVYVDTVGPPEKYQAKLSEIFPNYKITVAKKADSLYPIVSAASIVAKVTRDHALKVWKFLEGLDIDFGSGYPGDPVTKKFIREQIVFGYPMLVRFSWSTAELMLQEK.. 259
441 4.000e-67UniRef50_A0A147I7P2 Ribonuclease HII n=22 Tax=Bacteria TaxID=2 RepID=A0A147I7P2_9SPHN  ali  18  5..............................................................................KHEKQCLPPVAGVDEAGRGPLAGPVVACALVLP-----DRGVPRGIDDSKKLSATERARLCARLTDCAALGIGIVEPAEIDTLNIY-----WATMKAMTLAVDRLAELGRVPGHVLVDGNRLP----------RWGYAATAIVSGDAHSRSIAAASIVAKHTRDQIMAEAHPHYGWHANKGYGS---AQHLAALREHGPTPLH---RRSFAPVAQ....... 197
442 4.000e-67UniRef50_A0A0Q0WAP8 Ribonuclease HII n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q0WAP8_9DELT  ali  16  5........................................................................SRDYELEALSSGAKLICGVDEVGRGPIAGPVVAAACLITLSSKIS-----GIKDSKKLSKKRRELLFNIITEAEDVGIGIVEPETIDKINIL-----NASLLAMKMAVCSL---NIFPDYLLVDGIYSIP---------ISGIHQKVIIKGDDKSYTIATASIVAKVIRDRLMDLLYPGYNFSQNAGYPT---SDHLNRVRQLGPCPIH---RMTFKPFKN....... 201
443 4.000e-67UniRef50_A0A1Y1URD6 Ribonuclease n=2 Tax=Agaricomycotina TaxID=5302 RepID=A0A1Y1URD6_9TREE  ali  17  20...........................................................................FHSTRHESSEGWIMGIDEAGRGPVLGPMVYAAAYCPMSFK-PTLESLGFDDSKALSPETRQALWDTFDTHAPYSSATLSPQSISAGMLRRINLNQQAQDATIGLIRSALERNINVVECYVDALGPSPQWQARLSEIFPTIKFTVCPKADSIYKIVGAASIVAKVTRDRYVHHWVDPEGDDTSRGSGYPSDPRTQAFLKDHPVFGYKSIVRFSWATVKVLLEK... 254
444 4.000e-67UniRef50_Q6GHJ1 Ribonuclease HII n=251 Tax=Terrabacteria group TaxID=1783272 RepID=RNH2_STAAR  ali  16  4............TIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKAL------EKEQALKEKYVEMTYFENEILTENPNIICGIDEVGRGPLAGPVVACATILNSNHNY-----LGLDDSKKVPVTKRLELNEALKNEVAFAYGIATAEEIDEFNIY-----KATQIAMQRAIDGLSVQP---THLLIDA-----------MTLDNALPQVSLIKGDARSVSIAAASIMAKVFRDDYMTQLYPEYGFEKNAGYGTK---QHLLAIDDIGIMKEH---RKSFEPIKSLL..... 255
445 4.000e-67UniRef50_A0A2W1AVX4 Ribonuclease HIII n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1AVX4_9CHLR  ali  34  1.MNQFSTTLSSDQVPLLKRCLENLDFVCEEKNSVL-IAKNQGIRITVYKTNKVLFQGAETDKWVVKLAAIEKTPLLKSAGLPQGYSPRIGSDESGKGDYFGPLVTVAAFVD-SESESRLRDIGVRDSKELSDKAIKVMAADIKSLVTWKIVTVGPERYNELYDKMKNLNKLLGWSHARALEDVLN-VKECNLAITDQFGD-EKFVRDSLMTKGREINLIQMPRAESDIAVASASIIAREAYLTGLESLSREMGIDLPKGASSKVIDKGIEIATKYGFDKLRYVAKLHFRTTIQI...... 294
446 5.000e-67UniRef50_A0A2E5HDB4 Ribonuclease HII n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2E5HDB4_9RHIZ  ali  19  7......................................................................KPSLIFEEKFLRKGYRRIAGIDEAGRGPIAGPVVAASVILDQNNIPK-----GINDSKKLSPASREIIFHQIMLTAIVGIGIGDVEKIDSINIL-----NATKYAMNLSVERLDDKP---DLLLIDGNFTINN----------NTQNIPIISGDTKSLSIAAASIIAKVTRDNLMNKIFTKYKFAKNNGYPTK---DHLNIVNNFGICSLH---RKSFKPINKIINKNN. 209
447 5.000e-67UniRef50_A0A223B036 Ribonuclease HII n=4 Tax=Clostridiales TaxID=186802 RepID=A0A223B036_9FIRM  ali  16  3..........................................................KKEREKYLQKRLFEMQEFERELHLQGIKYIGGVDEAGRGPLAGPVVAACVVLPQDFDV-----LGVDDSKKLTEKKREILYDKIEKAVAYGVSMEDADVIDSINIL-----QATKSAMRKAVVKANKNPGAVRFARADAISIEHLLIDAIKLENFNVSQTAIVKGDSKSLSIAAASIIAKVYRDRVMVNYYPGYLFEKNKGYGTK---AHYDGIEENGITPIH---RRSF............ 233
448 5.000e-67UniRef50_A0A2V3PUG3 RNase HII n=3 Tax=Dysgonomonas TaxID=156973 RepID=A0A2V3PUG3_9BACT  ali  20  52........................................................................................AGCDEAGRGCLAGPVFAAAVILPPDFSCELL-----NDSKQLKEKTRYSLRKVIEEALAWAVGVVSHTEIDEINIL-----NASFLAMHRAVSDLK---MTPEHLLIDGNRF---------KKYENIPHTCVVKGDGKYLAIAAASVLAKTYRDDFMMKLYPQYGWNQNKGYPT---IRHRLAIEEHGITPYH---RLTF............ 227
449 5.000e-67UniRef50_Q2NK23 Ribonuclease n=8 Tax=Candidatus Phytoplasma TaxID=33926 RepID=Q2NK23_AYWBP  ali  26  1MMSNYSLKLNNNQLLTIKKFYRKQ-LKLSANKTVAFVVDKSFAKITVYNNGTLLVQGKNALFMVSFIKKMLKMKTLQLNNKKTYYLPSIGSDEVGTGDVFGPVVVCCVYLT-AKNIAFLQNLGIAESKKISDEKIINIAPLIMKEVIYSSKIMMPLEYNQI-IKQCNLNKIKALMHNEAIKQTVFKAPPNVPVILDQFCFPKNYFNYLQDQKDQNEIIFETKADSSYFSVAVASVIARYLFLTQIAKLSKQINFKLQLGAGKLLDLQIDLIVKQHGLEILPQIAKCNFKNI......... 325
450 6.000e-67UniRef50_Q5ZVR7 Ribonuclease HII n=73 Tax=Bacteria TaxID=2 RepID=RNH2_LEGPH  ali  20  8......................................................................................LMAGVDEVGRGPLAGAVVTAAVILKKPID-------GLTDSKKLSPKQRNLLAIRIKEALAFAYGRAEVEEIDQLNI-----HHATLLAMRRAVEAL---PIQPDNVFVDGAFTPQL----------NIPCKAIVQGDSLIPEISAASILAKVLRDEEMDKIYPGYGFAEHKGYATPV---HKEALMRLGPCKIH---RRSYSPVADLISK... 191
451 6.000e-67UniRef50_F2NF72 Ribonuclease HII n=1 Tax=Desulfobacca acetoxidans (strain ATCC 700848 / DSM 11109 / ASRB2) TaxID=880072 RepID=F2NF72_DESAR  ali  21  19..........................................................................DLEEAYRRQGIRFIAGVDEVGRGPLAGPVVAAAVILASDSVFPRL-----TDSKQLTPARREFFDRQVRDALAFAIQEVGVPEIESLGIL-----SASLKAMALAVQSLVLKP---ELVLIDGP----------WGLQIQVQQQPIIKGDQRCLSIAAASVLAKVYRDRQMHELYPHYNFASHKGYGT---REHLEAIRRWGPCPVH---RRTFRGVRE....... 212
452 6.000e-67UniRef50_F4S9X9 Ribonuclease n=3 Tax=Basidiomycota TaxID=5204 RepID=F4S9X9_MELLP  ali  17  1........................................................................................MGIDEAGRGPVLGPMVYAASFCPVDFS-EELKSLGFADSKTLTHQKRCNLFESIVQKIQWNVKVMSPSDISMGMSRRYNLNAQAFDATVQIIQAALDHQYILQHIYVDTLGPPKTHQLNLQKAFPNLHFTVCSKADSIYPIVSAASIVAKVTRDAIVENWFVELSWNLPTGSGYPADPNTTAWLKSHKVFGYPQLARFSWATVKTLLADRG. 236
453 6.000e-67UniRef50_A0A2E9GQG2 Ribonuclease HII n=4 Tax=Bacteria TaxID=2 RepID=A0A2E9GQG2_9DELT  ali  20  108......................................................................................HVAGVDEVGVGPLAGPVVACAVVLPGRVDLP-----GIDDSKRLTARTRLRLAAEIREALAVSVAAVSSREVDRLNVYR-----ASLVAMGRAVRGLR---VAPDHVLVDARTLPDL----------DLPQTAIVGGDGLDGSIAAASIVAKVHRDEWMTRLYPGYGFERHKGYGT---REHLAALERLGPT---RDHRRSFGPVNQL...... 290
454 7.000e-67UniRef50_A0A212DXR5 Ribonuclease HII n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A212DXR5_9BACT  ali  16  4..................................................................KNREKPDFAEEIKLRERGYKFIAGVDEVGRGPLAGNITAAAVIFPANFQFSIFPPEEINDSKKLSAKKREKAYKLLTKKIIWSVASVSEKIIDKINI-----HKATQLAMLKAIRKLKIRP---DFIIIDGNEFRNENFDGYGKKF-------IVKADAKTMSCAAASIIAKVTRDRLMHKKYPRYGFDKHKGYGT---RKHFTALKKNGPCPLH---RETFEPLKSLFQSL.. 230
455 8.000e-67UniRef50_A0A1K1NXT4 Ribonuclease HII n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1K1NXT4_9FIRM  ali  17  2.................................................................EEQSILTLHDFDLQYYDK-YPLLCGTDEAGRGPLAGDVFAAAVILAPDTVIE-----GINDSKKLTAKKRDKLFDEIKEALYWAIASATVEEIETLNILNC-----AMLSMQRAVEGL---GVVPDIVLADGNKTPKV----------ACPVEYVIKGDAKSQSIAAASVLAKVARDRYMEEMYPEYAFDKHKGYGTK---LHYQMIDKYGESPIH---RHSF--LKKYYAKKQE 208
456 8.000e-67UniRef50_A0A1V5SXH7 Ribonuclease HII n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5SXH7_9BACT  ali  18  11...............................................................KRRRESKTSPFDFEDLLRKKGFLAIAGVDEAGRGPLAGPVVAAAVILPEGFRLE-----GLRDSKKLTAKRREFFYSEIVDSLAYSISSVSPEEIDRVNI-----HQASLLAMSRALDGLAMKP---DAVMVDGPYKIDS---------ISVEQFPIIGGDDKSHTIAAASVVAKVFRDSIMSRLSPRWFRPPHKGYGTP---AHFEEIRLHGITPVH---RHSF............ 211
457 8.000e-67UniRef50_Q835V5 Ribonuclease HIII n=225 Tax=Bacteria TaxID=2 RepID=RNH3_ENTFA  ali  25  1MAQNHVIKVSKKTLAEMTTVYQPNRLN-KTVPYTVFVAKVGTTTITAYQSGKVMFQGPQAEKEAARWEKKKVSPQTTTLPADFGNWSVIGSDEVGNGSYFGPVTVCAAYVDKSM-ISKLKSLGVRDSKELTDPQIIQLSHVIKELIPYKLLIVEPKKYNEIQPN-YNAVHMKVALHNQAIYLLLQEPTKPEGILIDQFTPENNYRKYVRNEKNQVKLFFVTKGEQYHVAVAAASIISRAAFLEELDKESAELGFSVPSGAGSKSDQVAARILKKGGLDLLANYAKLHFANTQKA...... 301
458 8.000e-67UniRef50_A0A1W9W9A9 Ribonuclease HII n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W9W9A9_9DELT  ali  17  14...................................................................SRQVPVDPFYHETWARGHKLIAGVDEAGRGPLAGPVVAAAVILPEGVRLS-----GVRDSKKMTVRARSEAFHTVMAALTFGIGVVSVS-----YIEKFNILQASLEAMSRAIKALDPQP---EIILVDGIH----------AVPIPTRQKCLKKGDQISRTISAASVLAKVYRDRIMHRLYPAYGFDQNKGYGT---RRHLEALKQVGPSPVH---RLTFRGVQSF...... 217
459 9.000e-67UniRef50_P0CAW4 Ribonuclease HII n=776 Tax=root TaxID=1 RepID=RNH2_CAUVC  ali  22  14...................................................................................GQAPVCGVDEAGRGPWAGPVSAGAVILDPDRIPK-----GLNDSKKLSAKARAALEEEIKDAISWCVGLASIEEIAQLNILH-----AAGLAMRRAVEGLA---VTPAFALVDGNY----------AFKLPCPVKTVIKGDSLSCSIAAASILAKEARDRIMDALYPGYGFAGHKGYHAKV---HVEGLRRLGPSPIH---RLGWAPVK........ 197
460 9.000e-67UniRef50_K3YE64 Ribonuclease n=8 Tax=Mesangiospermae TaxID=1437183 RepID=K3YE64_SETIT  ali  15  166................................................................................WATKEPCLMGIDEAGRGPVLGPMVYGCMYCARSYNN-TLATLKFADSKTLKEEQREELFESLKSSIGWEVDVICPKDLSAKMLKKSNLNEISHNSAMGLVRKVLDMGVLLAEVYIDTVGDPEKYRIKLTEKFPGIKFVVAKKADSLYPVVSGASIVAKVTRDRALRNWFDETALNMHMGSGYPGDPDTKQWLEKHPVFGFPTLVRFSWGTCTPFFKDA.. 391
461 9.000e-67UniRef50_A0A2E1K195 Ribonuclease HII n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E1K195_9GAMM  ali  18  11........................................................................................VGIDEVGRGCLAGPVVACAVIWPNLDT----SQADIDDSKKLTDRARRRSAIKITQAVSWGIGICSAEEIDRINIR-----QASLLAMRRAVENC---PKKPEKAWVDGHDDPGL----------CMPTETIIQGDAKVPLIACASIVAKVFRDDMMAAYAKEYGFGQHKGYGT---QAHLAALKTYGVSSLH---RRSFRPVSQILAQ... 195
462 9.000e-67UniRef50_A0A1G2BEC9 Ribonuclease HII n=1 Tax=Candidatus Kerfeldbacteria bacterium RIFOXYB2_FULL_38_14 TaxID=1798547 RepID=A0A1G2BEC9_9BACT  ali  17  4......................................................................KPHLRYERRLSKEGYSAIVGVDEVGRGAWAGPIISCAIVMPLDHRVK-----NVRDSKELSPRKRKKVAAKIQEAISCSIGIVENTEIDEMGIVQAN-----EESMIRAIRGLS---VEPDYVLVDAFN---------LQSLSGVKQSAVAHGDATVYSIAAASIVAKVTRDQIMDELFPKYGFDKHKGYGT---EKHKRALDKHGVTQAH---RLTFHPMKTMLK.... 205
463 9.000e-67UniRef50_Q2G794 Ribonuclease HII n=100 Tax=root TaxID=1 RepID=RNH2_NOVAD  ali  18  4........................................................................................IGVDEAGRGPLAGP------VVAAAVVLCKPRPSGLDDSKKLSAARRAELEEKIKRRCRWAVGVVEPDEIDRLNIFG-----ATMLAMTLAVGALCEQLAHVGEVLVDGNLTP-----HGRRPEWCWPARPIVGGDALEPCISAASIIAKEHRDRLMREAHPHYGWERNAGYGTP---EHLAALREHGPTPLH---RRSFAPVAQL...... 193
464 9.000e-67UniRef50_UPI0004ADA2F2 ribonuclease HIII n=1 Tax=Atopobacter phocae TaxID=136492 RepID=UPI0004ADA2F2  ali  27  1MNEVLVLKLNLSELNQLAQQLNDS--IQSKPPHTIFLAKKDGHTITAYQSGKLMIQGPAPQQLAQDLSPSKKSTRSKKQPLPADFDHIIGSDENGNGSYFGSVTVAATYVGPKE-MKRLNQLGVRDSKTMTDTTIRQLAQEIKQTIPYELCIVPPQKYNEV-IQTMSQHQMKAILHNHVLTKLETRILNLDGLLIDEFEATSTYLKHIKNEKKKTQSKSTYRAESEHLAVAAASIIARDAFLTSLETLGAPYQVILPSGASAQSDQMAATLIKKYGEEALFHTAKLHFKNTEKAKKLAR. 312
465 1.000e-66UniRef50_A0A1G0ID35 Ribonuclease HII n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22 TaxID=1798290 RepID=A0A1G0ID35_9GAMM  ali  22  9........................................................................................AGVDEAGRGPLAGPVVCASVILHPRRPIE-----GLGDSKALNESTRERLFPIIQERCAWQVIFVPRDEIDELNIL-----WATMAGMRRVLAALDPAP---THAIIDGDRVPPGLC---------CPATCLVKGDSLEPAIMAASILAKVSRDRHMIELYPGYGFDRHKGYPT---AEHLLALDRLGPCPEH---RLSFAPVR........ 188
466 1.000e-66UniRef50_B0TYD6 Ribonuclease HII n=42 Tax=root TaxID=1 RepID=RNH2_FRAP2  ali  22  2......................................................................................IILGIDEAGRGPLSGPVVAAGVILDPEKTID-----GLADSKKLTEKKRQSLYEVITAHAAYTIVEVSPQQIDQLNIL-----QATLKAMNQVADNLKGQ---FDKVLVDGNKLPN----------WDYNSEAIVKGDSKVQEISAASILAKVHRDNICDRLFPQYGFAKHKGYPTK---EHLENIRKYGVLNIH---RKSYKPIQLLL..... 185
467 1.000e-66UniRef50_D2PZG3 Ribonuclease HII n=61 Tax=Actinobacteria TaxID=201174 RepID=D2PZG3_KRIFD  ali  20  16........................................................................LYGYERALRRVGLDPIAGVDEAGRGPCAGPLVAAAVILPDGKRGQIPE---LADSKLLTAKARERCYDEIRKALAWSVVSIEADECDRLG-----MHVANVQALRRALFRLDVRP---QYVLTDGFGV----------DGLGVPGLAIWKGDRVAACIAAASVVAKVTRDRIMEHWYPQYGFAIHKGYCTP---EHQAALDEYGPCPQH---RRRFENVRRSL..... 215
468 1.000e-66UniRef50_A0A0C1Y3K2 Ribonuclease HII n=3 Tax=Tolypothrichaceae TaxID=119859 RepID=A0A0C1Y3K2_9CYAN  ali  21  1.....................................................MVQKKQAVASLGLPTSLEESIWLELSGYSDIEQLIAGVDEVGRGALFGPVVAAAVILPES-AMPVLMAAKIKDSKKLSSSRRIQLAQQICAAIDWKIGFATIAEIDSINIL-----QATLLAMKRSVLKLKVQPALC---LIDGN---------QLVKDLLVPQQTIVKGDERSLTIASASIVAKVWRDDLLMRLYPMYDLERNKGYGS---QRHLTALQHYGASPLH---RRSFRPCQ........ 220
469 1.000e-66UniRef50_UPI000B360790 ribonuclease HII n=6 Tax=Proteobacteria TaxID=1224 RepID=UPI000B360790  ali  19  9...............................................................................EYPAGFSLIAGVDEVGRGPLVGAVVTAAVILDPNNPIA-----GLTDSKKLSEKKRLALLPEIKEALAWSLGRCEAWEIDELNIL-----QATMVAMQRAVAGLA---VTPDYVLIDGNRVPELTMASA----------AVVKGDLRVAEISAASIIAKVARDEEMKQLYPMFGFAKHNGYPTK---AHMAAIEEYDLNSMPELLRKSYKPVKKVLG.... 206
470 1.000e-66UniRef50_A8NUD1 Ribonuclease n=26 Tax=Agaricomycetes TaxID=155619 RepID=A8NUD1_COPC7  ali  17  24.....................................................................LTESYTYHSPLPTAPGPYILGVDEAGRGPVLGPLVYGVAYCPVA-YKETLEELGFADSKTLTADTRSSLISTLCSNLGWSVRVIAPQAISSGMLKKTNLNKQSQDATIGLIRQVIDKGINVTEVYVDALGNTSTYEAYLSSLFPGIDFTVANKADSKFKIVGAASVAAKVTRDVCIEEWVFEEDWSKALGSGYPSDPNTQAWLKNDPVFGFPKIVRFSWSTVKVVLDKQAK 267
471 1.000e-66UniRef50_F9MTG2 Ribonuclease HII n=13 Tax=Firmicutes TaxID=1239 RepID=F9MTG2_9FIRM  ali  17  5..........................................................................EFDQTYYQEGYGSLVGIDEVGRGCLFGDVVACAIVMPRESFIE-----GVKDSKKLSEKRREALYEEILKECAVGIGRVDSKTIDEINIK-----QASRLAMKKAVENLRDQVFKPDLALIDA-----------ETIDLDIEQKAIIHGDDLSYSISCASIVAKVYRDRLCIQWYPGYGIEKHKGYAT---VLHRGAIKALGPSPLH---RMTF--LRKILSNESH 208
472 1.000e-66UniRef50_R5W241 Ribonuclease HII n=4 Tax=root TaxID=1 RepID=R5W241_9FIRM  ali  17  105...................................................KLSLNRKKDKKLLNMALAKNDKYIHERALYEAGYNLIAGVDEVGRGPLVGPVVAAACILPKNCQLE-----GLNDSKALTEKKRDELYPKIIEECAYGIGVIDAKTIDEVNIY-----EASKLAMIEAIKNLQTKP---DYVLVDA-----------MKLNIDIPTEGLVHGDYISASIGAASIIAKVTRDNMMDKKYPMYGFRNHKGYPTK---EHLDALEKYGPL---DNYRFSYGPVKKYKKSKDE 330
473 1.000e-66UniRef50_UPI00037DB3DB ribonuclease HII n=1 Tax=Succinispira mobilis TaxID=78120 RepID=UPI00037DB3DB  ali  19  2............KILEIKELLAQDNVNIEIL-TTLATDERKNVQ-NLLKSY-----YKRQEKIKKTTLRQQELLKFERCYYQQGVKYIAGVDEAGRGPIAGPLVVASVILPEKCDLP-----GVDDSKKLTANKRELLCKAIQQALAVNVQVISPKVIDELNIY-----QATLKGMQDSLQALVIKP---EVALIDAMPLKIPEIIIESII----------KGDSLSLSIAAASIVAKTTRDKLMHKLYPVYGLDKHKGYPT---REHVQAVEKYGVAEF---YRQSYEPIKSIVAKKG. 256
474 1.000e-66UniRef50_F2UII9 Ribonuclease n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UII9_SALR5  ali  17  101.............................................................KHATATNRDSVIIECDIPEVCKQKPCILGVDEAGRGPVCGPMVYGVAFAPKPM-EKTLKNMGFTDSKVVKEEERERLFTEMKSKMGWKVHSLSPNTISTGMRQKYSLNELSHDTCIGLIRRCLDQGVNLEAVYVDTVGPDTVYQAKLQGIFPQLKITVSKKADSKYVIVSAASICAKVVRDHVLSAWHPEIGANTEYGCGYPSDPKTKAWLRANKVFGFPSVVRFSWQTAQTLLDK... 346
475 2.000e-66UniRef50_B1VG82 Ribonuclease HII n=148 Tax=Bacteria TaxID=2 RepID=B1VG82_CORU7  ali  16  33...............................................................................LRFHGFSHVAGVDEAGRGACCGPITIASCILP-DHGVPELA--GLNDSKKLTPKRRERLFGAITEHVAYEIVHIPAAEIDQRGIQYANIN-----GMYRVVAGL---GVEPDVVLTDAVHLPEL----------ACEHAPLVKGDALSPAISAASILAKVSRDRLMVEMYPGYGLAGHKGYGT---AKHMAAVRLHGACPEH---RYTYSNV......... 221
476 2.000e-66UniRef50_A0A091AJV3 Ribonuclease n=1 Tax=Smithella sp. F21 TaxID=1538640 RepID=A0A091AJV3_9DELT  ali  29  4.QNTVTLKFEKEDFNKARETLLAYGWKEEDNQYVAFKFRSSDSVALMYFSGKLVFQGK--EDFTSMISALKK----EAEISEGKFLPHMGVDEVGKGDYFGPLIVVGCFLTEEFSNKV-KLLGFADSKKFSDEKISKLFNMVRDYPYYYSSIVNPKEYNEMTVKYRNASLLLAKQHSLVIENLKNKGIECNHVVIDQFSTAKSRVSDELGELGKMCKLIQFHKGESDIAVATASIIARGIFIEEWEKMNEKYDFHFPKGASN-VIDNARLFVSNFGQEELNNVAKVSFKTTKEVL..... 296
477 2.000e-66UniRef50_A0A231P487 Ribonuclease HII n=1 Tax=Desulfovibrio sp. MES5 TaxID=1899016 RepID=A0A231P487_9DELT  ali  20  15........................................................................................AGVDEAGRGCLAGPVVAGAVILPASFDLP-----GLTDSKACTARQRDILAPRIKAAVSWGLGIVWPRRIDAINIL-----QATFVAMSLAIRHLRATPA---LLLIDGKTVPDHVLAHLWSLGHPPRQRAIIHGDATEPAISAASILAKTCRDRLMDKRWPGYGFGVHKGYGTK---EHYEALRRLGPCPQH---RLTFRGV......... 206
478 2.000e-66UniRef50_H3FM51 Ribonuclease n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=H3FM51_PRIPA  ali  17  17................................................................................FADGAPCVLGIDEAGRGPVLGAMVYGCA-VSPVSAAEDLKELGVADSKALTEEKREQIFEKMKKTVAYALRSLSPQLISMLQRSKCSLNQLSHDAAIALIRDALDCKINVVQIFVDTVGPKATYQAKLEAIFPGISITVTEKADALFPVVSAASIAAKVTRDHELRDWKFAETTSKKFGSGYPSDPTTKAFLAKDGVFGYPGLIRFSWKTVDTILDKKG. 248
479 2.000e-66UniRef50_UPI0008D8DD6A ribonuclease HII n=1 Tax=Ileibacterium massiliense TaxID=1870997 RepID=UPI0008D8DD6A  ali  18  7..........................................................KEERIIKQKEKWNEMRSHEIELHNKGFKSIAGIDEVGRGPLAGPVVAACVILPLDCEI-----LGIDDSKKLSDKKRREIVEEIKEAIAIGIGSATNVEIDDINIL-----NATKLAMKRAVDKVQNKID-IDILLIDAIRLNDV----------DISQESIIKGDEKSATIAAASIVAKVARDDYMENLYSGYNFASNKGYGTK---AHYEGISKIGISPIH---RKTFKTLNKNIDKIKK 226
480 2.000e-66UniRef50_E6RAZ2 Ribonuclease n=10 Tax=Agaricomycotina TaxID=5302 RepID=E6RAZ2_CRYGW  ali  15  32.................................................................................NSEEGWIMGIDEAGRGPVLGPMVYAAAYCPLSFK-PTLESIGFDDSKALSAETRQRLWEEVHSPLCYSSSTLSPQDISSSMLRKINLNRQAEDSTVGLIQAALNRGINVTECYVDALGPAPQWQARLTAIFPTIKFTVCPKADSLFKIVGAASIVAKVTRDRYVHGWSEDEEEVI-RGSGYPSDPKTQAYLKKDPVFGYKGIVRFSWATIKVLLDKQG. 253
481 2.000e-66UniRef50_D1VVL3 Ribonuclease HII n=22 Tax=Bacteria TaxID=2 RepID=D1VVL3_9FIRM  ali  19  6...........................................................................YEKDYRKKGSKLIAGIDEVGRGSLFGDVLSCAIIMKEDSNIE-----GVNDSKKLTAKKRKELYNKILESLAVGIGRADAKTIDKLNIKM-----ATHLSMVRAIENLRDSLVVPDLVLIDA-----------ENIETTIFQHSIIKGDENCYSIACASIIAKVYRDSLCDKWYPGYGIEKHKGYGTK---FHREALKAYGPSPMH---RKSF............ 198
482 2.000e-66UniRef50_Q0AEI5 Ribonuclease HII n=5 Tax=Proteobacteria TaxID=1224 RepID=RNH2_NITEC