current user: public

If you have questions about the server, please let us know.

Query: [E] COG0002 Acetylglutamate semialdehyde dehydrogenase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MKVGIIGASGYTGGELLRLLVSHPDVRLELATSRSLAGKPVSSTHRHLTGFLDLKYENPVSEEIRERCDVVFVAVPHGTAMNYVPELLDGSTKVIDLSADYRLDTPVFENIYGIKHSDPRKAVYGLVELHPEAAREEFVANPGCFPTGANLAAAPLAAAGLIDIAVFDSKTGISGAGISPTETSHYPNIAENIIPYKLTAHRHRAEILQELTRLDGKLRNISFTPHVIPSIRGILTTAHLFTKEPLSTGDVQEIYEEFYRDKPFVRLPGGVPSLTAVRGSNFCDIGFEADKENNRVVVLSAIDNLVKGASGQAIQNMNLMFGLAETRGLWLPAAAPLast
1 -125.000[E] COG0002 Acetylglutamate semialdehyde dehydrogenase  ali  100  1MKVGIIGASGYTGGELLRLLVSHPDVRLELATSRSLAGKPVSSTHRHLTGFLDLKYENPVSEEIRERCDVVFVAVPHGTAMNYVPELLDGSTKVIDLSADYRLDTPVFENIYGIKHSDPRKAVYGLVELHPEAAREEFVANPGCFPTGANLAAAPLAAAGLIDIAVFDSKTGISGAGISPTETSHYPNIAENIIPYKLTAHRHRAEILQELTRLDGKLRNISFTPHVIPSIRGILTTAHLFTKEPLSTGDVQEIYEEFYRDKPFVRLPGGVPSLTAVRGSNFCDIGFEADKENNRVVVLSAIDNLVKGASGQAIQNMNLMFGLAETRGLWLPAAAP 336
2 -92.000[E] KOG4354 N-acetyl-gamma-glutamyl-phosphate reductase  ali follow..  29  20AKVVLLGARGYTGKNLIGLINTHPYLELSHVSSRELEGTKLPGYTKKEIQYVNLSTDDVKKLEEEGAVDAWVMALPNGVCKPYVDALTSANSVIVDLSADYRFEPSWQYGLPELND-------------REALRNSKRISNPGCYATGSQVGLTPILSLIDGQ-PSIFGVSGYSGAGTKPSPKNDLNVLTNNLIPYSLTDHIHEREISYRL------KQPVAFIPHVAQWFQGITLTINVPLKKSITSRELRNLYQDRYNGEPLIHVQGDVPLVKDNAHKHHVSVGFGVHSSGKRAVIVVTIDNLLKGAATQALQNLNLSCGYDEYAGIHL..... 333
3 -80.800[E] COG0136 Aspartate-semialdehyde dehydrogenase  ali follow..  20  20FKVAVAGATGNVGREMLNILEERPADEVVPLASRRSQGTEVSYGDKTLK-------VRALDTYDFSDTDICLMSAGGSVSQEWSPKIGRQGCVVIDNSSAWRYDADVPLIVPEVNPDAIA-----------GFTKKNIIANPNCSTAQLVVALKPLHDAAKIKRVVVSTYQSVSGAGKEGMDELFTKRIAFNVIPHEDGYTKEEWKMVAETKKMLDPKIKLTATAVRVPVFIGHSEAVNIEFENPITPEEAREILREAPGCQVIDKHENGYITPYESAGEDATFISRIREDIENGLAMWVVSDNLRKGAALNAIQIAELLVGLIKPKALA...... 360
4 -79.000[E] KOG4777 Aspartate-semialdehyde dehydrogenase  ali follow..  18  4KKVGILGATGTVGQRFITLLSDHPEFKIAVLASARSAGKPYAVATKWKQSIISQMSVKACDPKEFSECDIVFSGLDADFAGEIEKSFRDANLVIVSNAKNYRREPTVPLVVPTVNTDHLDVIKYQRQE--NKLDRGCIITNSNCSTAAVVVPLKALQDAFGIAQTNVVSMQAISGAGYPGVSSLDILDIGGEEEKIEWETRKILGSVNSTISGYELTDNVVSAQCNRVPVIDGHLMCISVKFAKTSPTPDQVREVLANYVSEPQKLGCYSAPLDRNNENGYAVSVGRIRSDSIFDIKFVSLVHNTVLGAAGAGILNAEVAVK.............. 353
5 -18.300[G] KOG0657 Glyceraldehyde 3-phosphate dehydrogenase  ali follow..  12  2..AGVNG--GRIGCLVTRVAFNSGKVDIVAINDRFIDLNYMAENGKLVISGNPITIFQERDPSKIKDAEYVVESTGVFTPMEKAGAHLQEGAKRVIISPH---FVDAPMLVMGMNHEKYD-------------NSLKIISNAFCTTNCLAPLANVIHDNFGIVEGLMTTVHAITATGPSGKLWRDSCRALQNIIPASTGAAKAVGKALSELNG------KLTGMAFCVTTAKVSVINLTCHLEKPAKYDDIKKVVKQTSEGPLILGYTEHQAVSSNFNSNTHSSTRAGIALNNHFVKIISWYSD---GYSNKVVDLMAHMASKRKTT......... 316
6 -17.600[Q] COG4569 Acetaldehyde dehydrogenase (acetylating)  ali follow..  15  4RKVAIIGS-GNIGTDLMKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKIRLIDLTPA-------------------AIGPYCVPVVNEANVDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANI........................................................................................................................................................ 171
7 -15.600[G] COG0057 Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase  ali follow..  13  3VRVAING--GRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHYDSVHGRFPKEVEVAGDTIDVGYGPIKVHAVRNPAELPWKEENVD---IALECTGIFTSRDKA-VIVSAPADGADLTVVYGVNN-DKLTKDHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPMHKDLYRARAAALSMIPTSTGAAKAVGLVLPELKG------KLYGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLILGYTDEKLVSHDFNHDSHSSVDQTKVMDGTMVRILSWYDN---GFSSRMSDTAVAL................ 331
8 -11.600[S] COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase  ali follow..  11  3IPVVQLG-TGNVGVHSLRALIADPEFELTGVWSDAKAGKDAAELAGLADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYLAAGINIVGSGPVFLQYPWQ-----VIPDEIIKPLQDAARAGNSSLYVNGI--DPGFANDLLPMALAGTCES--IEQIRCMEIVDYATYDSALQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPE---AFNIASGHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRA---DLCPEWPQPAQPGGSYRIEISGEPCYAMDICLSSRHGDHNHAGLVATAMRIVNAI--VAAEPGIRTTLDLP 347
9 -11.000[R] COG1712 Predicted dinucleotide-utilizing enzyme  ali follow..  15  2LKIGIVGC-GFIGGQICRAIDGGVSAELYALCDSSE-----SKALELAASLKTCKPSYMKIEELIRGVDLIIESASQNAVRFIVPQALKAGCDVMILSVGALADEELRDTLFGLAKE----------------HNCKLYFPSGAVVGIDGLNSASAAGISSVTLSTRKPPAGLMGAPYVVEHGIELEKLEKKTVLFE---------PASEAVKAFPANVNVAATISLAGIFERTRVKVIADPSLFRNVHEI-----IVEGEFGKFSTVENLPSPE--------------NPKTSYLAALSAVSTLKKILN-------PVQIG.............. 270
10 -10.200[E] COG1748 Saccharopine dehydrogenase and related proteins  ali follow..  11  3KNVLIIGA-GGVAQVVAHKCAQNSDVLGDIHIASRTV-DKCRKIVESVREKKSLKTEVKLEAHALDGSQIVINVGSAFVNMSVLRACMDTGVAYMDTAIHEEPNKICETPPWYGNY---------EWKRAAECKEKGITADPGVVNAYARLAKDEYFDKTDVDIVDINAGNHGKYFATNFDPEINFREFTGVVYSWQKGAWQTNRMFEV............................................................................................................................... 221
11 -9.780[Q] COG5310 Homospermidine synthase  ali follow..  13  19.PVVMIGF-GSIGRGTLPLIERHFKFRMTVLDPRDTDRKLLDERGIAFVTENNYKKLLTPLLTNGGGQGFCVNLSVDTGSVDLMRLCRKLGVLYIDTVVE---WLGFYFDAKADNASRTNYALREAMIKEKHDKPGGATVNPGMVSWFVKQALVNLATDLGLEFSEPAQEDREGWAKLMKKAGVKGIHIAE................................................................................................................................................. 218
12 -9.140[E] COG0289 Dihydrodipicolinate reductase  ali follow..  12  3LKIAIAGAGGRMGCQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSDDLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENG--------------------KVAIKAASDKIAIVFASNFSVGVNLVVMGDYCDIEVIEAHHRHKVDAPSGTALS---------MGEHIAKTLGRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEISH...................................................................................... 232

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.