current user: public

If you have questions about the server, please let us know.

Query: [J] COG0094 Ribosomal protein L5, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MAKLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKNDEEGQALLAAFNFPFRKLast
1 -97.600[J] COG0094 Ribosomal protein L5  ali  100  1MAKLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKNDEEGQALLAAFNFPFRK 179
2 -79.500[J] KOG0398 Mitochondrial/chloroplast ribosomal protein L5/L7  ali follow..  27  107YHLNRPPKNPRGSKAQLPDIHPIKWSNIPGLESVVINCFVREARENQLLAITAALQLQQITGCKPHPIFSKNDVPTWKLRKGHQMGAKVELKGKEMSQFLSTLTEIVLPRIREYKGISNQSGNRFGGISFGLTAEFPEIDANQDSWPKTFGMHININTSAQLDYQARTLLSGFQFPFFG 289
3 -69.400[J] KOG0397 60S ribosomal protein L11  ali follow..  27  2..........AAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRE------NFSSTGNFGFGIQEHI-DLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRKRKSGTVGFQH 160
4 -5.540[P] COG4771 Outer membrane receptor for ferrienterochelin and colicins  ali follow..  15  1MSRFNPSP--SVTLGLMFSASAFAQDATKTDETMVVT-----AAGYAQVIQNAPASISVISREDLESRYYRDVTDALKSVPGVTVTTDISIRGMGSNYTL---ILVDGKRQTSRQTRPNSDGPGIEQGWLPPLQAIERIEVIRGPMSTLYGSDINIITRKDQQQ............... 167
5 -5.430[R] COG1540 Uncharacterized proteins, homologs of lactam utilization protein B  ali follow..  15  2................................NIDLNADLGEGCASDSELLTLVSSANIACGFHAGDAQTMLTCVREALKNGVAIGAHMVLPPETVYAQTLYQIG-ALGAIVQAQGGVMRHVKPHGML---YNQAAKDPHLAQAIAKAVHDYDPSLILVGLAGSELIRAGERHRLVT.. 155
6 -5.420[TQ] COG3916 N-acyl-L-homoserine lactone synthetase  ali follow..  15  72LDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR........................................................... 197
7 -5.220[K] KOG1659 Class 2 transcription repressor NC2, alpha subunit (DRAP1)  ali follow..  13  1...............MVAVSSFDAYITIFRIKKIMADEDVGKIALAVPVLVSKSLELQDLCDRTYEITLERGA------KTVSSLHLKHCVERYNVFDFLREVV........................................................................... 88
8 -5.200[S] COG3518 Uncharacterized protein conserved in bacteria  ali follow..  1...............MTYIAPEESAFGVGFFERLE-PMSLTRGPDAWDVLESIKRNVSNILNTRI----GAQSAPHLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATI........................................... 121
9 -5.160[S] COG3182 Uncharacterized iron-regulated membrane protein  ali follow..  11  340....RTAHFDQYSGALLTEVTWQDYSPFAKAMAAGISLHQGDLSVWNKIAFCLAFILISVTGVVMWWLRRPTGQARLGVPPRFEIGVAFPLAGATIVLALDGLLVSRIAKLKIA................................................................. 468
10 -5.140[K] COG5247 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog)  ali follow..  15  1...MGDPTNNNDSEKPNPATYWKSRFPVARIKKIMADQDVGKVAQVTPVIMSKALELQSIIQESCKQTRLHQA------KRVTVSHLKHAVQSVEQFDFLQDIV........................................................................... 99

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.