current user: public

If you have questions about the server, please let us know.

Query: [R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MRVRNRKGAGEMLAENAHIVVENPADFKGRWSERFGNDHPIHIEVGCGKGAFITGMAALHPEINYIAIDMQLSVLSYALDKAIEADLPNVQMMLVDGAALSEYFADGEIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPEGEIHFKTDNRGLFEYSLVSLANYGMELKKVWLDLHQDEEFAPQNVMTEYEQKFSQKGQVIYRLEAKFLPKKLast
1 -96.500[R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase  ali  100  1MRVRNRKGAGEMLAENAHIVVENPADFKGRWSERFGNDHPIHIEVGCGKGAFITGMAALHPEINYIAIDMQLSVLSYALDKAIEADLPNVQMMLVDGAALSEYFADGEIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPEGEIHFKTDNRGLFEYSLVSLANYGMELKKVWLDLHQDEEFAPQNVMTEYEQKFSQKGQVIYRLEAKFLPKK 217
2 -75.300[R] KOG3115 Methyltransferase-like protein  ali follow..  16  33.EGRLPMKRLFRQRAHANVLSDHELEYPYPDFDVESNKKVEIVDIGCGYGGLTVALGPQFPDTLVLGMEIRMQVSDYLKEKIQPGGYKNISVLRMNCQKLPNFFEKGQLSKMFFCFPDPHFKARKHKNRIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQHLDAHPLFRRFTKEEEENDICVTLMTNETEEGKKVARNGGKKFVACYERIPN. 271
3 -20.600[J] KOG3420 Predicted RNA methylase  ali follow..  15  1MPDKKTLWMLNELEGFEKKLEQYATSSELAVSMMEGFEGKKLIDIGCGCGMLMTTAATMYELETVLGVDIDDEALKICSRNLETAEVQDCELLQADILDPESDLPRGTFDVAVIN---PFGTKNNAG---IDMQFVQIGLQMVRPGGSVFS.................................................................. 156
4 -19.500[R] COG4106 Trans-aconitate methyltransferase  ali follow..  19  29....................................ERVLNGYDLGCGPGNSTELLTDRYGVNVITGIDSDDDMLEKA-----ADRLPNTNFGKADLATWK---PAQKADLLYANAVFQWVPD--------HLAVLSQLMDQLESGGVLAVQM................................................................ 129
5 -19.300[R] KOG2899 Predicted methyltransferase  ali follow..  15  113.........................................LLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHHGNYVLEDDVLLE--IERPQFDVILCLSVTKWIHLNFCDSGL--KQAFRRMYLQLRPGGKLILEP................................................................ 233
6 -19.200[R] KOG2361 Predicted methyltransferase  ali follow..  22  89....................................SGKSVILEVGCGAGNTIFPLIATYPDIFVYACDFSPRAVELVKAHDEYTETRFACDLTGDGLDK---ISPSSVDIVTMIF--------SAVSPEKMSSVLQNIRKVLKPNGCILFRD................................................................ 200
7 -19.100[R] KOG1271 Methyltransferases  ali follow..  17  58....................................KEASRVLDLGCGNGMFLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKL-SITYKVADLTQPQ-VHDKGTYDAVSLCPDNAKEKRA---------LYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKFGG---------------KVGNVVTSIVFKRKKE. 219
8 -17.500[H] COG2242 Precorrin-6B methylase 2  ali follow..  14  42.........DGLFERLPGIPLSKREVRLLIISALQLKEESIIWDIGAGTGTIPVELALLCPRSRIVAVERDEEVAGLIRRNCERFGVTNVTVHEGSAPDCLPQLIARPIKQI-----------------------LQETWAHLAPGGRLVATANNLESLYGISETLSELQVRNVEVVQ....................................... 197
9 -16.800[J] COG1889 Fibrillarin-like rRNA methylase  ali follow..  12  77....................................KEGTHILYLGAASGTTPSHISDI-ENGLIYSVEFSPRVFREFMEKLVDQGRRNVVPILGDARFPY--QYAHYVKGVDVVYIDVAQPAQ-------AKILADNADYFLKPGGHVMLVI................................................................ 185
10 -16.500[J] KOG2915 tRNA(1-methyladenosine) methyltransferase, subunit GCD14  ali follow..  15  245....................................NPGDTVLEAGSGSGGMSLFLSKAGSQGRVISFEVRKDHHDLAKKNYKHWRDSNVDFIHKDISGATEDIKSLTFDAVALDMLNPH-------------VTLPVFYPHLKHGGVCAVYVVNITQVIELLDGIRTCE............................................... 377
11 -16.400[R] COG2521 Predicted archaeal methyltransferase  ali follow..  18  129.........................................VFECCTGLG-YTAIEALKKGARHVITVEVDPHVLTLASLNPYSRGLWSVDVILGDCYAFVQTVRDSSIDFIIHDPPRL----SHATQRLYSEALYREFYRILKRGGGVFHYVSQSNPYKGVAERLRRVGFAVE........................................... 265
12 -16.100[J] COG2519 tRNA(1-methyladenosine) methyltransferase and related methyltransferases  ali follow..  19  92....................................SPGDFIVEAGVGSGALTLFLANIGPEGRVVSYEIREDFAKLAWENIKWAGFDRVTIKLKDIYE----IEEENVDHVILDLPQPE-------------RVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFK............................................... 211
13 -16.100[R] COG4123 Predicted O-methyltransferase  ali follow..  12  46....................................PKKGLIVDFCAGNGAVGLFASTRTQ-AQILSVEIQERLADMAERSVRLNGLEEMQVICDDLKNMPAHIQGSKVDMILCNPPSEHYLLARHEITTNLEEICRSAQSILKSNGRLAMVHRPDRLLD-ILDTLKRHNLAPKRLQF-VYPKREKEANMLLIEAIKDGSTSGFKV........... 225
14 -16.000[A] KOG1975 mRNA cap methyltransferase  ali follow..  18  110MTANRSINVDQIVREHYNERTIIANRAKRNLSPIIKKPGDVVLELGCGKGGDLRKYGAAGIS-QFIGIDISNASIQEAHKRYRSMRNLQVVLITGDCFGES--DCRFPCDIVSTQFCLHYAFETEEKAR----RALLNVAKSLKIGGHFFGTI................................................................ 283
15 -15.800[R] KOG1331 Predicted methyltransferase  ali follow..  15  1MSISSENVEQEYVHSIYSRLATYQQKEHKPWPRV--SAGSIILDVGCGEAKYT------SQKSHVIGFDTCSEVLSSSKKD-------DIDLCLADAINI---IRDDSVDAILNVS-------HHLATTARRRQVLQECSRCLRIGGQMLIYA................................................................ 143
16 -15.200[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  10  242.........................................IVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMPEALDRCEFMINNALSGVEPFRFNAVLCN--PPFHQQHALTDNVAW-EMFHHARRCLKINGELYIVANRHLDYFHKLKKI................................................... 363
17 -15.200[IR] KOG1269 SAM-dependent methyltransferases  ali follow..  12  123....................................KPGSRVLDVGCGVGGPAREITEFT-GCNLVGLNNNDYQISRCNNYAVKRNLDKQVFVKGDFMHM---FEDNTFDYVYAI-----EATVHAPSL---EGVYGEIFRVLKPGGVFGVYE--------MSDDYDSSIPKHREIAYNIEVGDGIPQMVRKCDAVEAIKKVGFNLLEED....... 280
18 -14.700[R] KOG2940 Predicted methyltransferase  ali follow..  15  61KRIHRDRAAWLSRQKN-DSFVDAVADNLLDRLEDCKKSFPTAFCLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDDNSIETSYFVGDEEFL---VKESSVDLIISSLGLHWTND---------PGSMIQCKLALKPDGLFLAAI----LGGETLKELRIA................................................ 216
19 -14.600[R] KOG3010 Methyltransferase  ali follow..  17  32....................................QDHKFAWDVGTGNGQAAIGLVEHYENV--VATDINEAQLQRAIKHSRSYHHTPTTISEDEMVDLL--GGENSVDLIVAAQAVHF---------FDLNVFYNVAKRVLRKEGGLIA.................................................................. 134
20 -14.600[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  20  46....................................QPCSFILDIGCGSGLSGEILTQEGDHV-WCGLDISPSMLATGLSRELEGDL----MLQDMGTGI---FRAGSFDAAISWLCNADTSYNDPKQRL--MRFFNTLYAALKKGGKFVAQF................................................................ 158
21 -14.600[J] KOG3191 Predicted N6-DNA-methyltransferase  ali follow..  19  48.............................DIKEIRSRDPKLVLEIGCGSGVVSTFVNQALGNVTSVATDLNPHALDVTLETAKLNDI-KIDVVRTD---LFAGLENLLGKVDVLLFNPPYVPTDEEPKRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKEHSE................................................. 196
22 -14.100[R] KOG4300 Predicted methyltransferase  ali follow..  21  310...............................FDNLVGKAEKVLEIGIGTGPNFKYYTDI-PNVSVIGIDPNAKMESYARKSATEAGLKEFTFVHALGESI---LEDASVDAVVGTLTDV-------------TQTLKEIKRILRPGGIYHVAAEDGTFLRLVQTVLD.................................................. 440
23 -14.000[I] COG3963 Phospholipid N-methyltransferase  ali follow..  14  51....................................HSGLPVLELGPGTGVITKAILARIKPESLTAIEYSTDFYNQL-----LRSYPGVNFVNGDAFDLDATLGEHKGQMFDSVISAPMLNFPMAARI----KLLDELLKRVPHGRPVVQIS................................................................ 160
24 -13.600[H] KOG1270 Methyltransferases  ali follow..  16  91.........................................ILDVGCGGGLLTEPLGRL--GASVIGIDPVDENIKTAQCHKSFDPVKRIEYRVCSLEEIVETFDAVVASEVVEHVIDL-------------ETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSE-QIAGIVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLYNPFSGY 256
25 -13.300[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  18  51.........................................VLDIGCGGGILSEAMAQR--GASVTGIDMGEAPLAVARLHQLESGV-AVDYRQITAEQMAGQFDVVTCLEMLEHVPDP-------------ASVIRACHRLVKPGGQVFLSTINRNPKAYLFAVIGAE-YILQLLPRGTHDFRKFIRPSELGAWSREAGLEVKDIIGLTYNPLTKH 213
26 -13.300[H] KOG1540 Ubiquinone biosynthesis methyltransferase COQ5  ali follow..  20  110....................................TTPLNFIDVAGGSGDIAFGLLDHAESKTMDIVDINPDMLKEGEKRAMEQGKPRVRFLVSNGEKL-EEIDSDSKDIYTVSF-----------RNFTDQKGLNTAYRVLKPGGIFYC.................................................................. 225
27 -13.200[L] COG1041 Predicted DNA modification methylase  ali follow..  12  177..................................LTKATREVLDPFMGTGGMLIEAGLI--GLKVYGLDIREDMVEGAKINLEYYGIRDYVVKVGDATKIEEVFPGKTFEAVATDPPYGNSTTLPMDRNELYKRSLESIHSVLEGRLAIAFPA................................................................ 293
28 -13.100[H] COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis  ali follow..  19  62....................................RRGQTVLDLAGGTGDLTAKFSRMGETGKVILADINDSMLKMGREKLRNIGVGNVEYVQANAEAL---FPDNTFDCITISF-----------RNVTEEKALRSMFRVLKPGGRLLV.................................................................. 168
29 -12.700[R] COG4798 Predicted methyltransferase  ali follow..  16  109....................................KPGDTVVDYIMGGGYFTRIISGAGPQGVVYAYQPAEFIRFAASLKAVTAALANSKPLDGPITALD----PDNVDAVITV------QNYHD-----AAKANAEIFKSLKPGGVFLV-IDHSA--AAVKQEVEAAGFKLEAESGLLADPADARTINVFDP-----AIRGKTDQFILKFRKPK. 298
30 -12.500[S] COG4627 Uncharacterized protein conserved in bacteria  ali follow..  16  2.......................................DLKVVVGAGPYNNN---------PGWIHTQEEKLSLLDRSMWEKR-------------------FTPESISAIL---------AEHVWEHLTFREAANICYDFLKPSGYIRCAVDGFFRDETYQAVVQV................................................. 97
31 -12.400[J] COG2890 Methylase of polypeptide chain release factors  ali follow..  16  129..............................FEPWLTEEPTRIMDLCTGSGCIAIACANAFPEAEVDAIDISVDALNVAEQNIQDHGLEQVFPIRSD---LFRDLPQEQYDLI-VTNP-PYSEFRHEPELGLARRILANAPLYLKENGILVCEVGNSM--VHMMEQYPHIPFTWLEFENGGHG................................... 293
32 -12.300[QR] COG0500 SAM-dependent methyltransferases  ali follow..  16  113....................................NDNSFVVEIASNDGYLLQHFLPK--NIPILGIEPAAN----VARTAIAKGVPTLVDFFGSRLALEMIGEGRKADLIIGQVPDL-------------NDFVRGMQLLLKPEGLLRWNSRISSI........................................................... 220
33 -12.100[R] COG4262 Predicted spermidine synthase with an N-terminal membrane domain  ali follow..  13  291.........................................VLVLGGGDGLALRQILKYPQVEHVTLVDLDPRMTSLFSHAEALVALNQVTVVNADAGQWLQ--AADMFDVAIVDFPDP---SNFSIGKLYSVPFYRLLSRHVADTGLVVIQATSPYFAPRSYWCVDAT................................................ 421
34 -12.100[R] COG1568 Predicted methyltransferases  ali follow..  148.....................................ENKEIFVLGDDDLTSVA-LMLSGLPKRIAVLDIDERLIKFIEKVADELGYNDIEIFTFD---LRKPLPDYALHKFDTFITDP-PETIKAIRA-----FVGRGIATLKGPRCAGYESSLDKWREIQRLLINEFNVVITDIIRNFNEYV................................. 290
35 -11.900[S] KOG4174 Uncharacterized conserved protein  ali follow..  13  21.AIGSSSINSQNSLTNDKIGKGKNKGPTERYVLPFEKNNRFLL-LGEGNFSFAFSLLLHHSEGFVLATSYDSKEDLKQKYPDAAEYISKIEMHEIDATKLHLHLKTQKFDTIFWNFPHSGKGIKDQDRQKMLLAFFKASKFLLSEKGVIVITAETKPYTLWNLKGLAKDAGYTSLMTEKFDSSF--------PEYSHR................... 225
36 -11.900[O] COG2518 Protein-L-isoaspartate carboxylmethyltransferase  ali follow..  16  76....................................RKHEDVLEVGAGSGYMAALLAHRGRHV--TTVDIAPELVAFARDNLARNGVTNVDVVQGDAGQ----WGNSLYDVICVS---------------SVPAVPESLLAQLKVGGRLSIFVGSAPVMEAQL...................................................... 183
37 -11.800[J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase  ali follow..  11  197................................GAAEGLGGDLLELYCGNGNFTLPLSEKFERV--LATEISKTSVGAAQWNIEANGIGNIKIARLSAEEFTEAYTGKAFSTIFV---DP-PRAGIDE---------ETLKLVSQFDNIIYISCNPETLRA--LDTLVETHVVERAALFDQFPFTHHIESGVLLKKKI.................... 361
38 -11.700[V] COG3510 Cephalosporin hydroxylase  ali follow..  11  71..............................YQEILSELQPLVIEFGTRYGGSAVYFANIGQPFKVLTVDNSHK-----ALDPRARREPDVLFVESSSTDPAIAEQIQRLPGKIFAILD----SDHSMNHVLAE--MKLLRPLLSAGDYL-VVED............................................................... 191
39 -11.300[J] COG2263 Predicted RNA methylase  ali follow..  16  44...................................GDLDESVQDLGCGTGILAIGAKLL-GARKVVGYDTDPKALEVARKNAERLGV-EVEFVCSDIKKVSGHV------KTTLMNP-PFGARVKGRDR-------PFLSSALRTSEVIYSIHNRGSFIKPAVITHSYVAKFPLKRTFDFHQKEREIIEVEIYRIAVH................... 196
40 -11.300[R] KOG2904 Predicted methyltransferase  ali follow..  17  198...................................WFKKDIWADLGTGSGAIAIGIAKVGSRGRVIATDLSPVAIAVAGHNVQRYSLEGIEVREGS---WFEPLKDLEGKLVGLVSNPPYAEVGRHEPKLA-FHLCHGASRMLQPGGFFVFETNGEKQSKMIVDYMMTSD............................................... 351
41 -11.300[Q] KOG1663 O-methyltransferase  ali follow..  15  95.........................................TMEIGVYTGYSLLATALALPEDGILAMDVNRENYELGLPIIEKAGVAHIDFREGPALPVLDEIVADEKNHYDFIFVDA-DKDNY-------INYHKRLIDLVKIGGVI--GYDNTLWNGSVVA..................................................... 211
42 -11.200[R] COG4076 Predicted RNA methylase  ali follow..  16  12...................LLGDHERLAAFREAISSRARGLTYDLGAGSG--ILSFFASEYADRVIAIERDPKIAACAGENLSGLD--NVSVVNEDALHY-------EFSAADTIICEMLDTALIDEEQV---PVLRRALKFLRNDGTV.................................................................... 127
43 -11.200[D] KOG2360 Proliferation-associated nucleolar protein (NOL1)  ali follow..  10  208..................RFILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCISVEQDHVRYNTLCEITKDAGCDIVKPILGDALNLTPERF-PDVEYILVDPSMTVCDEPKEDKRLLQIKILSHAMGAFPNVKRIAYCTENEQVVQRCLQL.................................................... 374
44 -11.100[R] COG4122 Predicted O-methyltransferase  ali follow..  18  64.........................................TLEVGVFTGYSSLIVALALPAEGLVACDINEEFTAIAQRYWQKAGVDHIDLYLAPAETLDKLLVAGEAETFDFAFIDA-DKSNY-------DNYYERSLQLIRSGGVI--AIDNVLWSGKVAD..................................................... 179
45 -10.900[E] COG0421 Spermidine synthase  ali follow..  16  92.........................................VLVIGGGDGGVLREVVKHECVEEAILCDIDEDVIKVSKQYLPEMS-PKVKVHIGDGFKFLQ--YQNTFDVIITDSSDPDGPAE----ALFQKPYFQLLSDALRGGGVITTQAECMWIHLGVISNVLTA................................................ 218
46 -10.900[S] COG1255 Uncharacterized protein conserved in archaea  ali follow..  15  17.........................................VIEVGIGFYTRIAKRLKEL-GFDVLAIDINKDAVVNAKNS-------GLNAEVDDIFNP-NISLYMGAKAIYSIRPTP------------MMNYILKISKAVKVPAYIVPLTGDPVPQGMKLITYRGIPIY............................................. 127
47 -10.700[A] KOG3045 Predicted RNA methylase involved in rRNA processing  ali follow..  12  211....................................PKTAIIGDFGCGEGKLAQSVPNK-----VYSMDLVA---------------ARSDIIACNITDT---LQARTLDVAVLMGTDL-------------NEFFLEANRVLKLHGTVYIAEIQSRFQD......................................................... 303
48 -10.600[J] KOG2198 tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily  ali follow..  15  289....................................KPGERVLDACASPGGKSLLMLQTLHLDHLVCNDIQESRLNKLRKVMQRWAGKRLILSQSDARNLDQ---YEQFDKILVDVPKPTRIKERLRIPELQAGILANCLRLLRPGGSLVYSTQNDGVVHMALQKVFTE................................................ 448
49 -10.500[S] KOG2912 Predicted DNA methylase  ali follow..  73...................................DKKRIIGLDIGTGASCIYPLLGCRMYSYDFVGTEIDKFSFETAKSNILQNNMESIKIVLRSKDCLLPDTEGMEEFTFVMCNP-PFEDFINFKQNPPSGVCTGVYHEMVTEGGEVGFAN---KILTESKKRKGIQWYTCMFGKKSVPAVVDKLREQNISNYGIYELALGKTKRWIIC...... 251
50 -10.200[M] COG0357 Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division  ali follow..  16  69.........................................FIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPS---EPPFDGV--------------SRAFASNDMVSWCHHLPGEQGRF.................................................................... 161
51 -9.970[E] KOG2352 Predicted spermine/spermidine synthase  ali follow..  14  460.........................................MAVLGLGGGLLTAYLVRHFKKAHVTAVELDPEVLKIANSHFSPHSDARIDVVIQDAIHLQETAKKPEEEKYDVIFVDVSGSQNAAPSAFLTPEALGNMKNSVKEQGMINLVTRDSEFGKSIKKNIAE................................................. 594
52 -9.850[J] COG0144 tRNA and rRNA cytosine-C5-methylases  ali follow..  19  253....................................QPGEVIIDACAAPGGKTTHIAELMKDEGVWAGDRTASRLRKLKENAQRLNLHSIEICIGDSRNLPQFY--DVADRVLLDAPHAWRQTPESVQELLQKELLAHTSKFVKVGGVLVYATENEEVITEFVAG.................................................... 400
53 -9.850[E] KOG1562 Spermidine synthase  ali follow..  14  112.........................................VLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMS-PKLDLFCGDGFEFLK--HKNEFDVIITDSSDP-----GPAESLFGQSYYELLRDALKEDGILSSQGECPWLDMKLISTVIHS................................................ 238
54 -9.750[M] COG2230 Cyclopropane fatty acid synthase and related methyltransferases  ali follow..  14  188....................................KEGDKVLDIGCGWGGMGLYLARHL-KANVTGVTLSEEQHAIANQRARDEGLADAKFELTDYRNINDKF--DRLVSVGMF---------EHVGVGHFAEYFQHVARLMKPDGVFLLHA................................................................ 293
55 -9.730[A] KOG1122 tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2)  ali follow..  18  365..................HYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVIANDANAERLKSVVGNLHRLGVTNTIISHYDGRQFPKVV--GGFDRVLLDAPDPAVKTNKDQKELLLSA-IDSVNATSKTGGYLVYCTENEWVVDYALKK.................................................... 534
56 -9.250[J] KOG2187 tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes  ali follow..  399....................................LKQYLDVTQMEEAKPLSNANDDLNKQI--PSTEEMTNSEHVADQNLPPSNTQVEELQDNEQKDSSSLEPEKTTKP--VAIVDP-PRS-------LHPAVIKALRTHPRLKRLVYISCNPETLVANAIELCTPSF............................................... 526
57 -9.220[R] COG2520 Predicted methyltransferase  ali follow..  16  125....................................LPGESVLIPFAGVGPFVLPSAGK--GAAVCAIEINPDACACLKENVRLNRLEGVTVIQGDAEYILSHPDSNGFDRAIVPTPY------------DMDHFLGEVSGNVRKEGKIHF.................................................................. 236
58 -9.180[R] KOG2730 Methylase  ali follow..  15  347...KYYYQRYRLFSRLDQGIIMDREGWFSVTPEAIAENVSVVVDAFTGVGGNAIQFALR---AHVIAIDMDPVRLKCARENARVYGVENIDFICADFFDVAATWQADKKLKVDAVFLSPWGGPSYLKAKEFDPNGIDIFDVSLKICPNIAYFTKVSQLVELA....................................................... 526

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.