current user: public

If you have questions about the server, please let us know.

Query: [J] COG0238 Ribosomal protein S18, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNEDLast
1 -53.500[J] COG0238 Ribosomal protein S18  ali  100  1MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED 79
2 -40.600[J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18  ali follow..  25  54..AHLMLKSACQTKFCPECTLGLD-IKHTDVLILSQYVRSDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLMPNLAPE 129
3 -6.520[TD] KOG4713 Cyclin-dependent kinase 2-associated protein  ali follow..  28  141...........................YSD---LLNVLGEMRTNVPTTMAGLRAPKER-MQRDIAHARLK......... 179
4 -5.910[H] COG1977 Molybdopterin converting factor, small subunit  ali follow..  20  50......................IEALEANCPGIKARLCDEEGKPRRF-VNEEDIRFLEGTDTALSAGDEVSIVPAVA.. 107
5 -5.440[C] COG1029 Formylmethanofuran dehydrogenase subunit B  ali follow..  17  207..........................DLLLITALRSIVNGHEDVVPETVAGVPKAEVLELAETLKNAKFVCIF...... 253
6 -4.820[K] COG3355 Predicted transcriptional regulator  ali follow..  14  25.........................LSKSDVEVLH-ILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLI...... 71
7 -4.750[R] KOG3043 Predicted hydrolase related to dienelactone hydrolase  ali follow..  16  23..........................RREEIFGLDTYAAEKVIVILTDVYGNKFNNVLLTADKFASAGYMVFVP..... 76
8 -4.740[S] COG2411 Uncharacterized conserved protein  ali follow..  135..............................LETFLSYGSIRKAARKLGGARKRGEIRKVLRKCYNELVKRGLI...... 177
9 -4.720[K] COG1497 Predicted transcriptional regulator  ali follow..  12  9..........................ELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLV...... 55
10 -4.670[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  23.................................VINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENII...... 62

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.