current user: public

If you have questions about the server, please let us know.

Query: [C] COG0281 Malic enzyme, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MTEQLRQAALDFHEFPIPGKIEVTPTKSLATQRDLALAYSPGVAEPCLEIEKDPAASYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGINVFDIEVNEHDPDKLVDIIASLEPTFGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISAAAIINSLRIVGKKIEDVRLVASGAGAASIACLNLLLSLGMKRENITVCDSKGVVYKGRDDKMDQTKKEYAIEDNGWRKLADAIPNADIFLGCSAAGALTQDMVKSMAAHPIILALANPNPEITPPEAKAVRPDAIVCTGRSDYPNQVNNVLCFPFIFRGALDVGATTINEEMKRAAVYAIADLALEEQNEVVTSAYGGEGATFGADYVIPRPFDPRLIVRIAPAVAKAAMESGVATRPIQNWDAYVEKLTQFVYKTSLFMRPILast
1 -122.000[C] COG0281 Malic enzyme  ali  100  1MTEQLRQAALDFHEFPIPGKIEVTPTKSLATQRDLALAYSPGVAEPCLEIEKDPAASYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGINVFDIEVNEHDPDKLVDIIASLEPTFGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISAAAIINSLRIVGKKIEDVRLVASGAGAASIACLNLLLSLGMKRENITVCDSKGVVYKGRDDKMDQTKKEYAIEDNGWRKLADAIPNADIFLGCSAAGALTQDMVKSMAAHPIILALANPNPEITPPEAKAVRPDAIVCTGRSDYPNQVNNVLCFPFIFRGALDVGATTINEEMKRAAVYAIADLALEEQNEVVTSAYGGEGATFGADYVIPRPFDPRLIVRIAPAVAKAAMESGVATRPIQNWDAYVEKLTQFVYKTSLFMRPI 434
2 -80.400[C] KOG1257 NADP+-dependent malic enzyme  ali follow..  18  86MGIQERNEKLFYRILQDDMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPQKRDRTQQYDDLIDEFMKAITDRYRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTSIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMNERPVIFALSNPTAQAECTAEEAYTLTEKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEEL--------------AQGRLYPPLANIQVSINIAIKVTEYLYANKMAFRYPEPEDYVKERTWRSEYDSLL..... 566
3 -8.980[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  11  199......................................................................................................................................TEETTTGVHRLYHFAEEGVLPFPAMNDNKYGTRHSLIDGIN---RATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGA---RVKVTEAD-----------PINALQALMDGYSVVTVDEAIEDADVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD------DVTRTTIKPQVDEFTFSTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELFQNEGQYENEVYRLPKVLDEKVAGQLTELTKEQAEYIGVDVAGPFKPEHYR................. 477
4 -8.560[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  54......ETAVLMSLITLGTEVQWSSCNIFSTQDHAAAAIAKAGISASTG-IPVLPLPRLACLEGRNRRGVPVTGDLT--------------------------------LIHSEYSQLLLSFRGISKETTIGVHLYKMMVNGILKVPAIDVNDSATKSKFDNLYGCGIK---------QATDVMIAGKVAVVAGYGDKGKSCAQALRGFRA---SVIITKTDPI-----------KALQAAMEGYEVTTMDEACEGDVFVTTTGCVDIILGQHFEQTKDDTIVCNTGYFDVEMDVKWLNKNTVEKVNVKLQVDPYRLKNGRGII-------LLAEGRLVNLACAMGHPSFVRSNSFTSQVMAQIKLWTHPDKYPVGVHFLPKKLDESVA-----EAHLGKLNMKLTKLTEKQAQYLGMSCYCP-FKPDH..... 410
5 -8.430[E] COG0169 Shikimate 5-dehydrogenase  ali follow..  51......................................................................................................................................AKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPASITV--------TNRTFAKAEQLAELVAAYGEVKAQAFEQLKQSYDVIINSTSASLDGELPPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAIDGLGMLVGQAAESF--------MLWRGLRPGTKQILRELRKNLEGAL............................................................................... 278
6 -7.870[R] COG2085 Predicted dinucleotide-binding enzymes  ali follow..  12  4.........................................................................................................................................................................................TKPSIAILGAGRVGSSLARSAVAAGYE-----------KVAGSGAVDKIALTAEILMPGAVPSTADQAVKDADIV-FLAVPLHKFRSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEIIAEFFAGSTMVKSFNHIGYHEIEQDAGT-GRAIAYAAGAQVAQLIKS............................................................................. 168
7 -7.430[S] KOG4601 Uncharacterized conserved protein  ali follow..  16  36.................................................................................................................................................................DNLAKLSAHCLQLRTPLTTCEKINSDSTLYLSWKYDEEEKVSRLMGFAKVGRKKLFLYDSQMQTYEGEILCLLDFYVHFSCQRQ------------------GVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKY--------GLIKPVWQNTNFVVFEELF.......................................................................................................... 177
8 -7.380[R] COG5322 Predicted dehydrogenase  ali follow..  11  142.....................................................................................................................................................................TAYAAYRNVLESMDRLGVEPADTEVAVVGYGSIALVIAKLLAGHGC---RLCLVHRGS--EAQGRQGLAYLPEPMHAQVRLSNDIEHCYEHVQFYVAATSTGGLID--PYRLRPGSVVVDAALPRD--------------------KPYRKDRNDILIIDG-GLVSASSALRFGAESMGLAPKKFLNGCLAETLILGLEGRAEAFSIG-------------ELPEDKVLEIGRIAELHGFS............................ 344
9 -7.160[E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase  ali follow..  16  188...................................................................................................................................................................RSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPT------------------TPEATRILTERGILLVPDVLASA----------GVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAARTAEAARYRGWA............................ 414
10 -6.780[H] COG0476 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2  ali follow..  10  122.....................................................................................................................................................PALQRQALAFGEALN------------------QDLSMLRVGVIGCGGTGSAIAMLLPKMGIRN--IALFDKDIVEDTNLNRLHGARQPDADAMSPKVEVVAKSLVGLGVQVRTYQAWIGEADCRDPLKACDVIFCTDDHTGRLMLNRFAYYYATPVFDMGLAIEVSQGETTVLVPAPGHACLLCREIINPVIARDEALKRSNPDEYERRKAEAYVIGEGNPS--------PAV--VLFTTEVAIMAMQELVH................................ 357

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.