current user: public

If you have questions about the server, please let us know.

Query: [P] COG0306 Phosphate/sulphate permeases, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst MVTPIMGNSNSILGIYRQKIQNRHLVSTLFRAYFPIVTELIILLIVIVTALAFDFTNGFHDTGNAMATSIATGALKPKVAVALSASLNLVGAFLSVEVATTVAKGVVDLDQFDLSNAWDSHQLLLVVFAGLIGAIVWNLLTWLLGIPSSSSHALFGGLIGAAIASLGFGGVVWEGVLSKMIIPALAAPVVAGLVAAIGTFAVYSITKAVGDNEKNRYFRWGQIGSASLVSLAHGTNDAQKTMGVIFLSLVATGHLGTDADIPFWVKATCALAIAIGTYLGGWRVIRTLGKGLVEIDSPQGMAAETSSAAIILTSSHFGMALSTTHVATGSIMGTGIGRKGAKVRWSVAGRMAMAWVITLPASAIVGVFCWWVAHGIGLISSDLLGVLVAFAILVILSGYIYARSRRVPVDPSNVNADWNEESNSVEPATPSAPAASEITEAPAAPAAQAVQDLNNENEVTKLast
1 -152.000[P] COG0306 Phosphate/sulphate permeases  ali  100  1MVTPIMGNSNSILGIYRQKIQNRHLVSTLFRAYFPIVTELIILLIVIVTALAFDFTNGFHDTGNAMATSIATGALKPKVAVALSASLNLVGAFLSVEVATTVAKGVVDLDQFDLSNAWDSHQLLLVVFAGLIGAIVWNLLTWLLGIPSSSSHALFGGLIGAAIASLGFGGVVWEGVLSKMIIPALAAPVVAGLVAAIGTFAVYSITKAVGDNEKNRYFRWGQIGSASLVSLAHGTNDAQKTMGVIFLSLVATGHLGTDADIPFWVKATCALAIAIGTYLGGWRVIRTLGKGLVEIDSPQGMAAETSSAAIILTSSHFGMALSTTHVATGSIMGTGIGRKGAKVRWSVAGRMAMAWVITLPASAIVGVFCWWVAHGIGLISSDLLGVLVAFAILVILSGYIYARSRRVPVDPSNVNADWNEESNSVEPATPSAPAASEITEAPAAPAAQAVQDLNNENEVTK 461
2 -6.160[S] KOG3817 Uncharacterized conserved protein  ali follow..  12  146..............................................................................................................................................................................................................................................................................AQFAVGILIL---SARRLAKNSVFYYLVGIVIGICASLLVVIYLAAKLFPRRTM---MYGVLIGGWTIGFYVIKQ-VLGYLVITGLISFLIC-IVMWVLQAIGAVMAYFSSWHTSAVIFIMVLVFVAHYFMYRRRFPLKRRMLTQEEYEQQTAVETSKSLADL--RKYVNSPECKQWAVMGKLRDPLRFAS 365
3 -6.050[R] KOG4538 Predicted coiled-coil protein  ali follow..  42..................................................................................................................................................................................................................................................................................................................................................................................................................KQKFSKIKKTVNRLSFEKKTALRDELRYIKERSKEIKDKRKED-SEVVQVIKNPAKLKR 120
4 -5.940[P] KOG4505 Na+/H+ antiporter  ali follow..  10  6...................................VEISKPHLAYAIIGGFTSLFM-------------LCSLIIKEKLFLGEATMATATGLIFG-----PYVAKLFVPTSWGNTDYITEELARVLLVVEVFAAGAELPRAYMLRWRSMFVMLLPVMIFGWLVSTGFMYALI--------LSFLESLAIAACITATDPVLASSIVGKGKFARRVPGHLRNMLLAES-------GCNDG--AIPFLYLAIYLIIEKPARHAGRDWVCIIILYECTFGCVLG---IIGVIARKMIKFSERRGLMDRESFLVFYFVLALFCG-IGVDDLLVSFCAGAAFSWDSWFSKKTEESHVVIDLLLNLSFFVYVGAIM............................................................................................ 312
5 -5.880[J] KOG3321 Mitochondrial ribosomal protein S10  ali follow..  45............................................................................................................................................................................................................................................................................................IQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTV--------AKSKENFERHTHKRLI------------AWDTNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQTSAVGQ---------LELLDSPDFKKHLEK 202
6 -5.870[R] KOG3375 Phosphoprotein/predicted coiled-coil protein  ali follow..  10  33..................................................................................................................................................................................................................................................................................................................................................................................................................KAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQ 91
7 -5.750[S] COG5134 Uncharacterized conserved protein  ali follow..  14  20.......................................................................................................................................................................................................................................................................................................................RNVIRFEMPFPVWCNNCENIIQQG-------TRFNAVKKEIGSYYTTKIWSFSLKC----LCSNPIDVHTDP------------NTEYIVASGGRRKIEPQDINER-AENDEKVPSDAIEALETQLTQQKSEKHNSSVINFIYEKNE... 147
8 -5.700[S] KOG3410 Conserved alpha-helical protein  ali follow..  18  37..................................................................................................................................................................................................................................................................................................................................................................................................................MTIRRDSRNTSGGGPHKTEAELRFEARRQANMAERMLKQAALSHREKVEKLNEFNDIPK 102
9 -5.660[S] KOG3097 Predicted membrane protein  ali follow..  12  48....IISIAFMVQFTAFQGTANLQSSINAKDGLGTVSLSAIYAALVV---------------SCIFLPTLIIRKLTVKWTLVCSMLCYAP-TLVPAGILVGMGAAPM-------ASKATYLTQVGQVYAKITEQAVDAIIVRFFGF-AWQSAELWGNLISSLVLSSGAHGGG-EDEIFEISMIYLSCIVAAVCIIAFFLDPLKRYGEKRKGSNSAAELSGLQLLSATFRQMK------KPNLQLLIPITVFIGACALGVNKIGFVMICFGVVNALCSILFG-SVMKYIGRTPIIV----GAVVHFTLITVEAMSGLWGVGDAVWQTQINGLYGLLFRRNKEAARLWESAGFVIAYAYATTLCTQMKLYILLAV--------------LTLGCIGYVIVEILYRKKQRKLKKQEKLEAAEKEKEAAAAAAAAALAAAEAGADGVEETDDELDDLEEDIVVTR 537
10 -5.580[Z] KOG3809 Microtubule-binding protein MIP-T3  ali follow..  20  576.....................................................................................................................................................................................................................................................................................................................................................................................KDIVSKEIEKLRTSIQTLPLGKIMDYI-----QEDVDAMQNEQMWHSENRQHAEALQQEQRITDCAVEPLAELEQLIKDLKNEEKIQK 680

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.