current user: public

If you have questions about the server, please let us know.

Query: [O] COG0326 Molecular chaperone, HSP90 family, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630
# Score Template Links and tools%idFirst MKEKIMSQNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSNPALYEGDGDLRVRVSFDADKGTITISDNGIGMTREQVIDHLGTIAKSGTKEFLTALGQDQAKNSQLIGQFGVGFYSAFIVADKVTVKTRAAGEEADKAVLWESAGEGEYSVADIEKKSRGTDVILHLREDEKEFLNEWRLREIIGKYSDHIGLPVEMLTKEYDDEGKECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTSLLYVPAKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFIPNYLRFMRGLIDSNDLPLNVSREILQDNKITAALRKALTKRSLQMLEKLAKDDAEKYLQFWKEFGLVLKEGPAEDFANKETVAKLLRFASTHNDGSEQTVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIERVKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPEHHLVKKVADIADETEFADWVELLLEQAMLAERGSLENPAAFIKRINKLLGLast
1 -174.000[O] COG0326 Molecular chaperone, HSP90 family  ali  100  1MKEKIMSQNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAADKLRFKALSNPALYEGDGDLRVRVSFDADKGTITISDNGIGMTREQVIDHLGTIAKSGTKEFLTALGQDQAKNSQLIGQFGVGFYSAFIVADKVTVKTRAAGEEADKAVLWESAGEGEYSVADIEKKSRGTDVILHLREDEKEFLNEWRLREIIGKYSDHIGLPVEMLTKEYDDEGKECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTSLLYVPAKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFIPNYLRFMRGLIDSNDLPLNVSREILQDNKITAALRKALTKRSLQMLEKLAKDDAEKYLQFWKEFGLVLKEGPAEDFANKETVAKLLRFASTHNDGSEQTVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIERVKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPEHHLVKKVADIADETEFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG 631
2 -169.000[O] KOG0020 Endoplasmic reticulum glucose-regulated protein (GRP94/endoplasmin), HSP90 family  ali follow..  36  64.QLKEIREKAKKFTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLALSNSKELETNPELHIRIKADKENKALHIMDSGIGMTHQDLINNLGTIAKSGTADFLAKMQDPSKSMNDMIGQFGVGFYSAFLVADRVVVTTKHNDD-KQYIWESDANSFSITEDPRGDTLKRGSVISLYLKEEAQDFLEEDTVRELIRKYSQFINFPIRMWSSKTVEEEVPVEEDWTLINDSKPIWTRKPAEVTEDEYTSFYKSLTKDSSEPLTQTHFIAEGEVTFKSLLYVPKVQPSESFNGTKSDNIKLYVRRVFITDEFNDMMPNYLSFIRGVVDSDDLPLNVSRETLQQHKLIKVIKKKLVRKVLDMLK---KIDKEAYEKFWKEFSTNIKLGVMEDPSNRSRLAKLLRFQTSNGK---GVTSLAEYKERMKAKQEHIYYIAGANRAEVEKSPFVERLLSKGYEVLYLVEAVDEYCISALPEFDGKKFQNVAKEGFQLNESEKSKKNFESLKSTFEPLVKWLNDVALKDQISKAQVSERLSNSPCALVAGVFGWTGNMERLAMSNAHQYLNQKKTLEINPRHPLMRELLRREADDTAKDMAVMMFRTATLRSGYMLQETSQFADSIEQMMR 741
3 -161.000[O] KOG0019 Molecular chaperone (HSP90 family)  ali follow..  38  68.KETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLGDGGDLEIRIKPDPDNGTITITDTGIGMTKEELIDCLGTIAQSGTSKFLKALKENKDADNGLIGQFGVGFYSAFLVAEKVVVSTKSPKSDKQYVW-ESVADSSSYLIREETDPDRGTQITLYLREDKYEFAESTRIKNLVKNYSQFVGFPIYTWQEKSRTIEVEEDEDWELANETKPLWMRNSKEVEKGEYNEFYKKAFNEFLDPLAHTHFTTEGEVEFRSILYIPGMGPLNNEDNPKTKNIRLYVKRVFISDDFGELFPRYLSFVKGVVDSDDLPLNVSREILQESRIVRIMRKRLIRKTFDMIQEISEENKEDYKKFWENFGRFLKLGCIEDTGNHKRITPLLRFFSSKNE--EELTSLDDYIENMGENQKAIYYLATDSLKSAKSAPFLEKLIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDLEL---GDEDEVKDREAKQEFNLLCDWIKQQLGDKVAKVQVSNRLSSSPCVLVSGKFGWSANMERLMKAQALGFMRGRRILEINPDHPIIKDLNAAPESTEATRVVDLLYDTAIISSGFTPDSPAELGNKIYEMMA 734
4 -14.400[D] KOG1845 MORC family ATPases  ali follow..  12  85.......DEAAPVPLYCSNDAAVRVHPQFLHANATS-LAELLDNSLDE--------------SNGATYVHVDSTINKRDGILIVEDNGGGMNPSTFRECL-SLGYS-----------RKRNMANRVGQYGNGFKTSTMLGADAIVFSRSRGINGNNPTQ-YETRKCEAIVPTVDYELVDNKWKEIVYNSTNEWLDN---LETILRWSPYLSQQDLLDDTDPHDIQLRGVNRDEKNIDMAKTYPNSRHFLTYRHSLRSYASILYLKRPDNFRIILRLDDMMKIEEKTYKPMRSPEWPDQEEMVQGFNVYHKNRLIKWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTVVLAKLESRLVTHQ---------------KNYWSSR----EIGYAPRRKQKNTPRPFNNINVVKGSSSSTPVPVRVFRPNVEPSGRNQIPQVETRERSFDINPEIKNRSYYGLGISSFKETGSVNLEAELQKVKQESAKLVSELQRQKQLLELQESKAKIQNLEKAQREKEVLELQLKESKARIQNLENRQEGVSTIFQQERARRDVTEDGLRKKLREASDVIDGLRKQVD.................................................. 698
5 -12.400[L] COG1389 DNA topoisomerase VI, subunit B  ali follow..  12  1..............MSGKHREI---VAEFFEKNKHILVKEAVDNALDACEE------------GILPDIFVRISKVDDHFKIVVEDNGPGIPREQIPKVFGKLLYGSRFHEIRQSR----------GQQGIGISAAVLYAQLATVISKTPDEDRAKKVVLYINTKKN-EGEEEWYLPSGTKIELEVAGNYVR-ERKQSVYEYLRETSVINPHAKITFVEPDGTINEFKRVTDDIPQPPKSI-MSMLKSTRATTLRRFLKEEFVRVGEKIA-----------LRKAGFSGDETPQEMGRDDAAKLLNAFRQTDFLPPPTDCLSP------------------IGEAMIA-----KSLMAEFQPEFVYAVTRKPKV--------YSGHPFLVEVGLAYGGEIKSEKVTLLRYANKIPLLYQQ----GCALTKAVESVNWKSYGMVQNRGELPSAPAV-PYTSESKESVAAIPEIIDETRLALQEVGRRLKEYLERKSRQQKKKKKEEKKVCEILEKEPLEIDRIVARIMGYLHVERIVEERDGVKVVTIRVSNFTRSKKSIKLYEMCSGNVEADGAKVSGSGYSTVTWSLEVKPDEE.................................... 567
6 -11.100[L] KOG1979 DNA mismatch repair protein - MLH1 family  ali follow..  16  6...............RAKIRPLDQLVINKIAAGEIIAIKELIENSLDA----------------GSTSIDVLLK-DGGLKLLQITDNGSGIQYDDLPYLCQRFSTSKIDNF------NDLQHLQTFGFRGEALASISHVA-KVTVVTKLSSDIHAWKAFYVDGSPGMSPAPQPCAGKQGTVITAALKNGSEEF---RRIMILVQKYAHNDQVSFNCKKVGDTVASLSLSSRLSKADKIRHIYGPRASHLRDFSLG---------------------EGQSSIVGFSANGFISNADF--QDKKSNLILFINNRLVESVEAKYLHK-FVYLSLNMSPEQLDVNVH-HFLYDQEIATSICDKLGEILER......................................................................................................................................................................................................................................................................... 347
7 -10.800[L] COG0323 DNA mismatch repair enzyme (predicted ATPase)  ali follow..  15  1...............MSHIIELPEMLANQIAAGEVIVVKELVENAIDA----------------GSSQIIIEIE-EAGLKKVQITDNGHGIAHDEVELALRRHATS------KIKNQADLFRIRTLGFRGEALPSIASVS-VLTLLTAVDGASHGTKLVARG---GEVEEVIPATSPVGTKVCVYMKSQQAEL---SHIIDIVNRLG--LAHP---------------EISFSLISDGKEMTRTAGTGQLRQAIAGIY---GLVSAKKMIEIENSDLD-FEISGFVSLPELT------RANRNYISLFINGRYIKNFLVGRFPLAVIHIH--IDPYLADVNVHPTKQE-----KELMTLVSEAIANSLKE..................................................................................................................................................................................................................................................................... 328
8 -9.910[L] KOG1978 DNA mismatch repair protein - MLH2/PMS1/Pms2 family  ali follow..  13  3...............QNKIERISKEVAERLTTAQVV-IRQLIDNSIDA----------------GSTIIDIRVK-NNGFESIEVQDNGSGIEARNFDALCKPHSTSKLTQF---------SDFDKLATLGFG-LNALCTVSSVSIFTRASDTEIGTRLTYDHSG--NIICRQSAARELGTTIIVNERSQKREF---VKLLSTVQSFA--IKILCTNNINGKKTNLICTPGGTTSIDVVANLFGIARKIENSKIGSGLIPIQQNQPDVEIMTIHSVPMEEMHFFDLFKIRGSSCEHGCGRGTSDRQFVYINN--VCSVINDVYKQFIIVLFIDVPPEKIDVNVTKTVMKERHLLAVVRASMMKTYLK......................................................................................................................................................................................................................................................................... 364
9 -9.250[T] KOG0787 Dehydrogenase kinase  ali follow..  20  291..................................NHAVFEILKNS------LRATVEFHGVDSDFFPPIKVIVAKGQEDITIKISDEGGGISRRNIPLVWSYMFTTASPTLTDDPHDIVSANST-MAGFGFGLPLARLYTRDLELISM---------------------------EGYGTDVYIHLNCESAEPLQ.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 425
10 -8.280[L] COG0187 Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali follow..  12  2.......SETTNDNYGASSIKVLK--LDAVRKRPGMYI-EVVDNAID------------EALAGHCSDIIVTIHDD---NSVSVQDDGGGIEGVSAAEVIMTVLHAGGKFDDNSYKVSG-------GLHGVGVSVVNALSDKLQLTIRR--QGHVHEQFYHLGEPQSPLTVIGETEATGTTVRF--WPSSDIFFDYKILAKRLRELS-FLNSGVSIRLIDKRDGSEDHFHYEGGIQAFVEYLNKNKNPIHPKPFYFTAEKDGIGVEVALQWNDGVNENVYCFNNIPQRDGGTHLAGFRGALTRSLNSYMENEGMLKK-DDAREGLVAIISVKVPDPKFS-SQTKDKLVSSEVKSAVESAMNEKMQEYLLEEAARKAREMTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKVGRDRKTQAILPLKGKILNVEKARFDKMLSSQEVGTLITRYHHIIIMTDAVDGSHIRTL....................................................................................................................................................... 512

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35