current user: public

If you have questions about the server, please let us know.

Query: [C] COG0437 Fe-S-cluster-containing hydrogenase components 1, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEVLast
1 -92.700[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali  100  1MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEV 205
2 -62.100[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  23  1..MNRFVIADSTLCIGCHTCEAACSETHRQHGLQSMPRLRVMLNEK--------------ESAPQLCHHCEDAPCAVVCPVNAITR-VDGAVQLNESLCVSCKLCGIACPFGAIEFSGIRAIAVKCDLCSFD---EQGPACVRMCPTKALHLVDNTDI-ARVSKRKRELTFNTDFGDLTLFQQAQSGEAK............... 203
3 -59.400[C] COG1140 Nitrate reductase beta subunit  ali follow..  30  4.RSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKP-QKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLEVFLDPN................... 304
4 -43.500[C] COG1036 Archaeal flavoproteins  ali follow..  19  94FVTPATSNTVSKIAYGIADSLVTNAVAQAVKGKVPVYVVPV-------DIEGSIISEMPYNIDRKQCRHCETCPPRENCPHGAITEKNGVTDQIELLKCKGCGICKELCPYNAIKGGPVEVLVRDVDMRNVEIVKGLQGITVLESPEAILEL..................................................... 238
5 -25.500[C] COG2440 Ferredoxin-like protein  ali follow..  18  23......................................................PGRPHIKVRPHERPSANLLALTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASG............................................................................................ 81
6 -24.700[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  17  46.............QSQCGQCGYPCAPGGEAVMLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGCTK--CIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDKWDLN---------TIPVRIIPVEHHA...................................................... 192
7 -20.800[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  23  7.......KAKEEARVISPKSVDEYPE-------------APITLGTTLVNFTGDWRTFMPVIDESKCVKCY--ICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREE..................................................................................... 104
8 -20.100[C] COG1146 Ferredoxin  ali follow..  17  21..........................................................................DLSKVPWWGVDRKEEWYPTIDYDKCVTCGICFVTCGRRVFDFDKKEGKVNCMVAC---------QTCMNLCPTGAISFPDASYIKKLVAQ......................................... 108
9 -18.600[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  31  113.............................................................................................SGEERCIACKLCEAICPAQAITIEAEERAMTKCIYC----------FCQEACPVDAIVEGPNFEFSTETHEEL....................................... 188
10 -18.400[C] COG0348 Polyferredoxin  ali follow..  20  197..........................................................................CGHLCPIGAAYGGLFRIKVEHRQQCDNCMDCYNVCPEPQVLRDPLHAKKSECISCGR---------CIDVCPEKVFIFTTRFNHSVNHSG......................................... 290
11 -18.300[C] COG1145 Ferredoxin  ali follow..  18  171.......LVKERDYIAVGYC--PCRVEHGLGRRISADEAIEIQSNREGLVHLTERSKHVATICNCCSDCCVFFKAVHEAKHPNTIAHSSYLATVDTSRCIACGICMLRCPMKAIKAKINREPAEKCLGC----------VCVPTCPMEAIELVERDELLELPDGMTYVQELLADKGRDPSGLF...................... 368
12 -18.000[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  22  19..............................................................LVMIFGHAFRKRDTLQYPEEPVYLPPRGRIVLGEERCVACNLCAVACPVGCISLQKAETEFSRCIFC----------LCEEACPTTAIQLTPDFEMGEFKRQ......................................... 130
13 -17.300[C] COG1141 Ferredoxin  ali follow..  23  47...........................................................................................VYVDEITCIGCKHCAHVAR-NTFYIEPDYGRSRVIRQDGD--AEEVIQEAIDTCPVDCIHWVDYTE................................................ 109
14 -15.000[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  34  201...............................................................EEKCTKCDE--CVKICPSNAIED-----YQINREKCVKCLGCSEACDYGAVKTFWVF..................................................................................... 250
15 -14.100[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  17  25YLNAEGIQHP-HIC-SCDTCMCACSTTDGMEIKTNSELAKDAQLEAM---------DRILENHLLYCTVCDNNN----CKVHNTTDFTHPFYRYDPDQCILCGRCVEACQ-RVIWDDDRPANLSSCVSC----------LCATVCPCNALM...................................................... 207
16 -14.000[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  11  24ACLSLGLDIPY--C-ACRQCAVSCMTSDGTFISIDDEEAKQFRESVV---------EWLMTNHPHDCPVCEEGG----CHLQDMTQDLGPFISHEMNRCIACYRCVRYYK-DNVYFGRPEDGTLESEFSGN---------LVEICPTGVFTDKTHSERYNRKWDMQFAPSICQQCSIGCNISPGERYGE................ 247
17 -13.900[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  25  272............................................................EWISENCTMCNE--CAFVCPHAAIRDGLRYRIQVSPMDCTGCNLCAETCPAKDKALVMKP..................................................................................... 353
18 -13.600[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  17  40.................................................................ACYQCGT--CTGSCPSGRRTSYRTRLIMRKLQMCTTCYTCYERCPRGVKIVDAVKAARNLA------AKKGYMAKAHRMVAMFVIKTGHAVPINDEIREVRKNIGLDE................................ 153
19 -13.300[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  17  1MPPKIAEVIDYDVCAACGA-------------------------------------------------------CEAVCPIGAVTVKKAAGIRGGYQVCEGCLTCSRVCPVVDGFIQDELTNVRKFFGARSKDNGSQDGGVASGILKSLFKQGKIDKWEPEVVLLTSAEDVERTRGTKSDPVLAALREAFEKYDRIAVIGVPCQA 173
20 -13.100[C] COG1600 Uncharacterized Fe-S protein  ali follow..  32  194..............................................................VEEGCGKCVA--CMTICPTGAIVEP-----TVDARRCIGCDDCQLICPWN............................................................................................. 261
21 -13.000[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  14  164.......LDGLYECILCACCSTSC-----------------------PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRL------RCHTIMNCAQACPKGLNPAKAIAEIKKM................................................................................ 253
22 -12.700[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  16  52ACEKVGMQIP-RFC-NCRMCLVACAMMKGWNILTNSEKSKKAREGVM---------EFLLANHPLDCPICDQGG----CDLQDQSKNIGPLVKTIMTRCIQCTRCIRFAS-NDMQVGTYIEKMFMSELSGN---------IIDICPVGALT...................................................... 232
23 -12.500[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  15  180.......LDGLYECILCACCSTSC-----------------------PSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL------RCHTIMNCTRTCPKGLN........................................................................................... 258
24 -12.200[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  24  310................................................................LRCIRC--GACLNTCPAYRQIGGHYEEFKDLPSACSLCTACNQVCPVKIP........................................................................................... 377
25 -11.800[Y] KOG2439 Nuclear architecture related protein  ali follow..  10  16.................................................................PALACVK--PTQVSGGKKDEPDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKN---WGKLSQQQDKFLVVSVSPQCRLSLAQVEKIIAHKKQKENTGADRKPLLSAPGFLIYTEKTKPQLVPMLLNVKSPQQI 204
26 -11.500[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  21  273.............CDFCLGDSKINKKTGQPEE--------------------------------VSCSDCGHPSCLQFTPVMMAAVKTYR-------QCIECKCC-NIC-------SENDDQLLFCDDC----DRGYHMYCLTSCH........................................................... 372
27 -10.600[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  20  408.................................................................ECTDCGW--CQRVCPNSLPVMDSKLEEMAIEELCYTCGRCEQECERNIPIVSMVTKAGER................................................................................ 475
28 -10.500[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  23  576........................................................................AARAAIPMVKGEVEIEPIVAVTDSDVCGGCEVCIELCPFGAISIEEGHANVNLCKGC----------TCVAACPSGAMDQQHFRTEQAQIEAALNEQA................................... 668
29 -10.400[S] COG3592 Uncharacterized conserved protein  ali follow..  14  13...................................................................................KYRGADVDIYFNTNICAHSGNCVKGNA---ELFNLDRKPWIM----PDNVPKEEAKRVIHTCPSGALQYIE................................................... 76
30 -10.300[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  10  6........................................................RPPMSFFADLPKDNKK--CIKIGSPLA----------LSLSDCLACSGCVSADEAGALSED------------LSFVLDLSPQTSFVLSPQSKINIFNLRSKIYEETYREYMATNHLIVSACPGVVTYIERTAPYLIGYLSRVKSPQQM 164
31 -10.000[C] COG0247 Fe-S oxidoreductase  ali follow..  11  267...RQSQLLDLYACVECGRCTNMCPATGTGKMLSPMDLILRLRDHLTEKGAAV-----------TSRSPWVP--AAAFRHTRGNQLAAASAGSGSQEACTTCRNCEDQCPVMNEHVDKIIDLRRYLV-----LTEGKMDSDAQRAMTSIERQGN................................................... 421
32 -9.850[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  18  128.........GINSCTAFLTCTTAVVDSPSITKALGDALAPYFKEESLPA---------KLRIFVSGCAMCAGGFLVQVCPTGAHTEGDKVKLVLLGEKCINCARCKENCDAFD............................................................................................ 266
33 -9.820[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  21  548............................................................................QPCAILWSRARRREVTYKVTEDCTLCMECVNACPALIFDGEKVSIDQSLCVGC----------VCAKICPNRAIKPAKSN................................................. 623
34 -9.690[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  15  365......................................................ETEMGLSEPEQSCIRC--GLCVDACPAGSRGEEHEKARNHNLFDCIECGACAYVCPSNIPLVQYYR--QEKAEIRALDQESARAAEAKARFEAKQARLAREKLARELRHKQAAVKLTDADQQTVDAAVSRLTRQ................. 503
35 -9.380[R] COG5141 PHD zinc finger-containing protein  ali follow..  20  207.........NSNAIVFCDNCNTSCYGIPFVP------------EGQW------------------FCKKCEVICCA-FCPDGAFCTTLDG------------RWCHTICAIAIPEISFHDTSRLDCCICKLRWG-----TCVQTCARRAGFFYKIYSHSASYDSVD....................................... 354

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.