current user: public

If you have questions about the server, please let us know.

Query: [L] COG0582 Integrase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MSMAITDAWLRATNGKPYSGKTEISHRFGLGVRVSPKGKITWVYRANINGKMQRIKLGEYPAMKLRDAIQARESRAELVELGFDPRKSTRSANDDSIITLNDLIDYWAENHARDNIKQCDALLKMFHTDITPTLGNYPAKQLELIDFMPVFLKAKRRVSAKHSANLMTRFKQVLSYAVRHGLLKYNVLTELKKADVGVPTTPKRSRQDEQGVKALWKAIDDISIHESNKNFLRLMLIFANRSNELRLAKKADFDLEKRVWTVPEENNKVRKKQGGAIRRAIPPLAEKIIMEQFAIWPNHTMMFPPVNTEQDRPMSANVPVDFGSKLADRIEELGFPRTTNHDMRRTARNIWESMGVPYHVAETMLGHKVHTGVQSHYLGKMRLSLLast
1 -145.000[L] COG0582 Integrase  ali  100  1MSMAITDAWLRATNGKPYSGKTEISHRFGLGVRVSPKGKITWVYRANINGKMQRIKLGEYPAMKLRDAIQARESRAELVELGFDPRKSTRSANDDSIITLNDLIDYWAENHARDNIKQCDALLKMFHTDITPTLGNYPAKQLELIDFMPVFLKAKRRVSAKHSANLMTRFKQVLSYAVRHGLLKYNVLTELKKADVGVPTTPKRSRQDEQGVKALWKAIDDISIHESNKNFLRLMLIFANRSNELRLAKKADFDLEKRVWTVPEENNKVRKKQGGAIRRAIPPLAEKIIMEQFAIWPNHTMMFPPVNTEQDRPMSANVPVDFGSKLADRIEELGFPRTTNHDMRRTARNIWESMGVPYHVAETMLGHKVHTGVQSHYLGKMRLSL 385
2 -26.900[S] COG4342 Uncharacterized protein conserved in archaea  ali follow..  11  1..................................................................................MNPGSSPCEGSKK-----------GVERCKMTLVAILRQYSADYAQEFYDYLNERKIGNKTAKEYVSAVNR-----PYKETDKSQKAYRIFAKFLESRGVISSEEMEKILRVIKVKRSNADLYIPTEEGIRKTLKLAKEYS--ENVYFVYRIALESGARLNEILKVLKKP---KDVCDSADDSNGRIRSNGSADGGISLCYYPLSWIRGSK----GSFYVFHFSPLRK---------VTIGEGAIAGFERRRDGAVAIKYVRKFVASKMAELGIPLDVIDFIQGRKPTRVLTQHYISLFGIA. 270
3 -24.200[L] COG4973 Site-specific recombinase XerC  ali follow..  13  2...............................................................................................TDVALSQDVSRFLR-YLGVERQLSPITLLNYQRQLDAIIGLKSWQQCDAAIVRSFAVRSRRKGGPASLALRLSALRSFFDWLVSQGELKANPAKGVSA---PKAPRHLPKNIDVDDVNRLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVGLDIKHLDLDTGEVWVMGKGSKER-------RLPIGRNAVTWIEHWLDFASDEEALF----SKLGKRISARNVQKRFAEWGIKQG----SHVHPHKLRHSFATHMLESSGDLRGVQELLGHAN--STTQIYTHLDFQHL 285
4 -22.900[L] COG4974 Site-specific recombinase XerD  ali follow..  16  3....................................................................................................EGLIDRLLE-TLWLDRRLSQNTLNGYRRDLEKIARSQSGRMLKDADEADLAAAVYVDGQRSSQARALSACKRLYIWMEREGIRTDNPTRLLKPPKIDKN----PTLITEQQISRLLAAPDDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRGCITALGKGDKQR-------MVPMGQESAYWVERYYT-GRNCDALFVSQK---KTGISRQLAWMIVKEYA---SQAGIGHISPHSLRHAFATHLVRHGLDLRVVQDMLGHAD--NTTQIYTHVANVWL 280
5 -13.900[S] COG4688 Uncharacterized protein conserved in bacteria  ali follow..  11..................................................NNPKSNLEQF----INFSKNQLTTFGNDVRFSTERIKSTAYKYEPLAAPFIEFAKAYISLNPIRNLARHTESLRIVEMALYNIKGKADILQLDYLVIHEVENIVSKKKGTESVNKLGYQIQKLFDFCRENQITPQRPRDLTILLDEKGKEYRSSKMPTDEEMMLVAKLFHDAPETEYYTAVMALLMVAPSRCSELMSLSVNCLEWENDQLGIRWIPAKNGKVGLKWVPSCMQDIVVEAVKRLTNIGTLARGVAKFAEENPNIYSETRPKTSLWEKHCIGTSKGEFIRLPSHNARHWLSTKAERGGMDELTLANWAGRA-RVADNKAYDHRT.... 495
6 -6.270[J] KOG4708 Mitochondrial ribosomal protein MRP17  ali follow..  11  37ITRSLSKADLVKALTRAGN---TLLDHGAVIEKVESLGHRDLPYKRLAKQTNEPVYASNFFLFKAHMSREARQKTKSILTHDLD............................................................................................................................................................................................................................................................................................................. 117
7 -5.470[E] COG4812 Ethanolamine utilization cobalamin adenosyltransferase  ali follow..  10  1MKDFITEAWLRANHTLSEGAEIHLPADS----RLTPSARELLESR----------------HLRIKFIDEQGRLFVDDEQQQPQPVHGLTSSDEHPQACCELCRQPVAKKPDTLTHLSAEKMVAKSDPRL--FRAV--LDSTIAL--AVWLQIELAEPWQPWLADIRSRLGNIMRADALGEPLGCQAIVGLSDEDLHRLS---------HQPLRYLDHDHLVPEASHGRDAALLLLRTKVRETETVAAQ-----------VFITRSFEVLRPDILQALNRLSSTVYVMM................................................................................................ 245
8 -5.130[S] COG3055 Uncharacterized protein conserved in bacteria  ali follow..  11  64................PFKSGTGAIDNDTVYIGLGSAGTAWYKLDTQAKDKK---ALAAFPGGPRDQATSAFIDGNLYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVHNGKAYVTGGVNQFEDLNEAGKDSTAIDKINAHYFDKKAEDYFFNKFLLSFDPSTQVNKGDKTWLINGEAKPGLRTDAVFELDFTGNNLKWNKLAPVSSPDGVAGGFSLIFAGGAGFKGSRENYQNGHLWHNGKWDLSQGRA...................................................................................................................... 363
9 -4.850[T] KOG4226 Adaptor protein NCK/Dock, contains SH2 and SH3 domains  ali follow..  1....MSEDYVVVKYDYLAQEEQELTIKKNERLKLLDDSKNWWKVM-NDSNSV-----GFVPSNYVRKESIVDKAKGTIKGLARGRNRSSDPEPEERLNGIARLAFSLNNNCAVTPSSNKIPMMSSKTKAVVKFTYEPRLEDLTKGDFVYVVEKSTDGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEELSFK--RLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVVVNDSSSSKASHQDFAPQYSGNGEIPMEQQPWYFGRISRERAEDLLLHFLVRDSESNPGDLSISMRGIERNKHFKVQNVDKIGNRTFVD--MNALINHYTTSPIFSSPTEKLFLT. 393
10 -4.470[R] COG0824 Predicted thioesterase  ali follow..  53MAFPIVHASVDFL------RPLFCGAQVIISLVPQKIGAEKFEINYEIYLADVLVAKAVTRHVCIDANTRSKQELSMEIIQWLDGYRKDTEEVERRKAR.............................................................................................................................................................................................................................................................................................. 145

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.