current user: public

If you have questions about the server, please let us know.

Query: [C] COG0584 Glycerophosphoryl diester phosphodiesterase, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MTKIFPHRGASGQFPENTMLAFEKGIEAGADGIELDVQLTKDGRIVVIHDERLNRTTSLKGFVKDTAYDEVKTANAAAGHDQAYSDIKVPLLEDVLSWAVKKDFLINIELKNSVIRYEGMEEKVLEAVKRFNVEDRVILSTFNHDSLALCARLAPHIERAVLTSDVLYQADRYIASIPASGYHPKINSPGVTDEVLKKMRNGLIKVRPYTVNRPEDMKRLIEAGADRMFTDFPERLRHCLast
1 -106.000[C] COG0584 Glycerophosphoryl diester phosphodiesterase  ali  100  1MTKIFPHRGASGQFPENTMLAFEKGIEAGADGIELDVQLTKDGRIVVIHDERLNRTTSLKGFVKDTAYDEVKTANAAAGHDQAYSDIKVPLLEDVLSWAVKKDFLINIELKNSVIRYEGMEEKVLEAVKRFNVEDRVILSTFNHDSLALCARLAPHIERAVLTSDVLYQADRYIASIPASGYHPKINSPGVTDEVLKKMRNGLIKVRPYTVNRPEDMKRLIEAGADRMFTDFPERLRHC 239
2 -62.600[R] KOG2421 Predicted starch-binding protein  ali follow..  21  370.GLDVGHRGSGAVIRENTITSLKNAAEHGADMVEFDVQLSKDLVPVVYHDFMIYVSLKSKCSMRELSLEQLKKLKVYHIAEGCLEHQPFPQLCDVLDAL-DVHVGFNIEIKWSQRLEDGYIDCILDVILRKAGNRRIVLSCFDPDICTILRFKQNRYPVMFLTLNSMELAVWHAVAMEFLGVVAHTEDLLRDPSQVNLAKERGLVLFCWGNNSKDTIKLLKELGLHAIIYDKMDVLTTK 665
3 -62.500[C] KOG2258 Glycerophosphoryl diester phosphodiesterase  ali follow..  20  365.FLVISKNGASGDYPGCTDLAYTKAIKDGADVIDCSLQMSSDGIPFCLSSINLGESTNVVQYSFSLAWSEIQTLRPAIENPRERSSGKFVSLSDFLNLAKNSSSLTGVLISVENATYLDAVKAVLDTLTEAGYSTRVMIQSTNSSVLIDFKKQSRYETVYKVEETIRDILDTAIEDIKKFADAVVISKKSVQTKLVERLQKFQLPVYVEVFRNEEINSHVTGAGINGTITEFPLTAARY 667
4 -7.170[T] KOG0169 Phosphoinositide-specific phospholipase C  ali follow..  10  119.....GHN-GNQLNSNSSIEPIVKALRNGVRVIELDL--SSGKEAEVRHGGTL---------TSREDLQKC-----------------LNVVKENAFQVSAYPVVLTLEDHLTPILQKKVAKTFGGSLFQCTDETTECFPSLKNKILISTKPPKEYLQ................................................................................. 252
5 -7.100[S] COG1376 Uncharacterized protein conserved in bacteria  ali follow..  180..............PDNPMGHH--------------IRLAAYGGVYLLHGTN---ADFGIGMRVSSGCIRLRDDDIKTLFSQVTPGTKVNIINTPIKVSAEPNGARLVEVHQPLSEKIDDDPQLLPITLNSAMQSFKDAAQTDAEVMQHVMDVRSGMPVDV.............................................................................. 310
6 -6.590[R] COG2044 Predicted peroxiredoxins  ali follow..  12  1MAKLLYVQTSGIDTPERLYAPFVLAMTAKAMGDDAIIYFVIKGVTVVKKDNAEKIKMGNFPPLSELMKQARES-LLGIDKGEIVDGVKIVGAATLNQLVLEADGVLYF................................................................................................................................... 119
7 -6.390[S] KOG4147 Uncharacterized conserved protein  ali follow..  14  1...........................MAPGEVTITVRLIRS-KPVVYHGVNLDQT------VKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDD----ERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKA....................................................................................... 120
8 -5.710[R] KOG4264 Nucleo-cytoplasmic protein MLN51  ali follow..  13  148..........SGDGQESTEPVENKVGKKGPKHLDDDAYIPRKGL-FFEHD---LRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFEDEQAPSRQELIA-------LYGYDIRSAHNPDDIKPRR.................................................................................................................... 257
9 -5.620[O] COG0826 Collagenase and related proteases  ali follow..  13.............SPAGSLKNMRYAFAYGADAVRYSLRVRNNE--IQPHNSKLKTFIRDLKPVIDMGPDALIMSDPG-----------------LIMMVREEFPHMPIHLSVQANAVN---WATVKFWASQGVERVIVSRELSLEEIEEIREKCPNTEIEVFVHGALSGYINKRDPNQGTCTNACRWEYKVEAAKEDEAGQIVEQFDPNAAQAIEVQNERPDTTIGAGKPI........ 248
10 -5.600[E] KOG1592 Asparaginase  ali follow..  11  44...VLVHAGAGYHSESKAKHVCKRACQKAIEKLQTDA----TAALVELEDSPF--TNAGMG--SNLNLLGEIECDASIMDGKSLNFGAVGALSGI---------------KNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVDTDFMQLKKRRQSSEKENDSGTVGAVVVDHEGNVAAAVSSG--GLALKHPGRV... 263

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.