current user: public

If you have questions about the server, please let us know.

Query: [P] COG0619 ABC-type cobalt transport system, permease component CbiQ and related transporters, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MIGARSIAEPTIKDTIIHRMDPRAKILILISTVFVAVTLDNPETMLLLFLIILSGFALARMPAIKLKTLAILLTLLIWGTIYSQALFYSQLPRTVIFTIISPDVPVLGWLTSGGLFVYAEGLHHGAIQGLRSASILSLGLLMCWTTDSRDMLNGLVGLKVPYSAAFMVVTAVRFLPIIITEVLTVVTVQRLRGFNPKRFGSGIVKTSLNILTPTLSNCVRRTGTLAVSIQSRAFRANPDRTYLKKLKFSEFDKAVVAVCIFAAISIVLIKLLYNMYTGGIYYSAGLRPVYALARGYLLast
1 -99.300[P] COG0619 ABC-type cobalt transport system, permease component CbiQ and related transporters  ali  100  1MIGARSIAEPTIKDTIIHRMDPRAKILILISTVFVAVTLDNPETMLLLFLIILSGFALARMPAIKLKTLAILLTLLIWGTIYSQALFYSQLPRTVIFTIISPDVPVLGWLTSGGLFVYAEGLHHGAIQGLRSASILSLGLLMCWTTDSRDMLNGLVGLKVPYSAAFMVVTAVRFLPIIITEVLTVVTVQRLRGFNPKRFGSGIVKTSLNILTPTLSNCVRRTGTLAVSIQSRAFRANPDRTYLKKLKFSEFDKAVVAVCIFAAISIVLIKLLYNMYTGGIYYSAGLRPVYALARGYL 297
2 -7.300[J] KOG2147 Nucleolar protein involved in 40S ribosome biogenesis  ali follow..  10  503ISAIRLVSGLFPVADSWHPVVPALFLATEALCSAKCANLNALAKQIQLANAIVEYVSESKRYVPELVAFARSALLLAVYNWISQKEFDLSSFNRYIDELYLKMTRKYTGPALQPISLTTIFNNSPSDPSLKLHVLRALLSLIQHLRVISNQNETYSIVFKPFLRILESIQAKNLPAEVQEELETLCASMKAEIGAKCRLVHLSLVKTEKSMLKMLEPRFEWDPHHGPKDEKKKLTKNLRNERRGAIKELRKDTAFLA........................................ 800
3 -6.940[BK] KOG3001 Dosage compensation regulatory complex/histone acetyltransferase complex, subunit MSL-3/MRG15/EAF3, and related CHROMO domain-containing proteins  ali follow..  10  575................................................................................................................................TYKWSFQLNELDNMNSTERISFLQEKLQEIR-------------KYYMSLKSEVATIDRRRKRLKKKDREVSHAGASMSSASSDTGMSPSSSSPPQNVLAVECR................................................................. 665
4 -6.760[BD] KOG4563 Cell cycle-regulated histone H1-binding protein  ali follow..  13  521..............................................................................MLDLAKIIFKRQETKEAQLYAA------QAHLKLGEVSVESENYVQAVEEFQSCLNLQEQ----YLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQ-VKEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRS.................................................................. 662
5 -6.680[R] KOG3536 Adaptor protein CED-6, contains PTB domain  ali follow..  109.....................................................................................................................EAEDSLLQQMFIVRFL-----SMAVKTDSTTEVIYEAMRQVLAARAIHSHLMVTSQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVI---IFESNSEGEKICYAI-NLGKEIIEVQKDPEALA.................................................. 251
6 -6.190[S] COG4769 Predicted membrane protein  ali follow..  13  213..................RVLRYVRMGTGLLLLLILLCVPRLSVQASVCGIALLLYAATGGRIR-----WMTLAGLWVGTLACYLR----------------PPVGRVWATVLGVPLTSGALSAGARQACMASGMVYLSKWILRVP-----------PHLPGKFGQTVVHALSLMHRLSSFKCAAHDGTLHKKST...................................................................................................... 357
7 -6.190[J] COG1631 Ribosomal protein L44E  ali follow..  1.............................................................................................................................................................MKIPKRFRTYCPFCKTHNEVVVERVKKGQASSMTHI---ARQKKRQEGIGNSGKFSKVPGGDKPTKRIWLRYRCTVCKKAHQRPCFRAKKFEFKE............................................. 92
8 -6.130[P] KOG3684 Ca2+-activated K+ channel proteins (intermediate/small conductance classes)  ali follow..  274.................RAPFEKRKRLSDYALIFGMF--------GIVVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREAQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDII-----LSIPMFLRLYLIARVMLLHSKLFTDASSRSIKINFNTRFVMKTLMTIIAAWTVRACERYHDISITFLSIGYGDMVPHTYCGK----------GVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMM... 560
9 -6.110[D] KOG3004 Meiotic chromosome segregation protein  ali follow..  35................................................................................................................................................PTIADPTAITARKRRPQVKLTAEKLLSDKGLPYVLKNAHKRIRI-SSKKNSYDSNIIQFYQLWAHELFP-FKDFMKICQTVGKTDPVL................................................................. 125
10 -6.110[M] KOG4629 Predicted mechanosensitive ion channel  ali follow..  629........TLNDTKTAVNRLHRIVDVLVSIVILIIWLLILGIATTKFLLVISSQLLLVVFV----FGNSCKTIFEAVIFVFVMHPF----------------DVGDRCEIDGVQMIVEEMNILTTVFLRFDNQKIVYPNSLL-GTKPIANYYRS-PDMQDAIEFFVHIATPPEKTTALRQRILSYVDNKKDHWHPSPMIVFRDMCGLNSVKIAMWPTHKMNHQNMGERYVRRGQLLEEIGRLCRELDIE................................................ 847

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.