current user: public

If you have questions about the server, please let us know.

Query: [J] COG1093 Translation initiation factor 2, alpha subunit (eIF-2alpha), from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MNIKLLPEVGDLVVVKITEVKNFGANGILEEYPGVEGYIHISEVATGWVKHIRSYLREGQRVVCKVINVNQERKNVDLSLKRVNQHQSREKIAEWKNEQKADKLFEIVCSKLNKDLEACKKEFGVRLVELYGTLFAAFESAAAAEGEWLPDINGDWKDTFVEVAKENITIPEVSVAGYFEAYSLASDGVEKIKEVLTIPPEIGKAELEYVGAPRYRIVVRDKDYKKAEETLKKIVQSVTDKAKKLQVELEFSRQLast
1 -93.700[J] COG1093 Translation initiation factor 2, alpha subunit (eIF-2alpha)  ali  100  1MNIKLLPEVGDLVVVKITEVKNFGANGILEEYPGVEGYIHISEVATGWVKHIRSYLREGQRVVCKVINVNQERKNVDLSLKRVNQHQSREKIAEWKNEQKADKLFEIVCSKLNKDLEACKKEFGVRLVELYGTLFAAFESAAAAEGEWLPDINGDWKDTFVEVAKENITIPEVSVAGYFEAYSLASDGVEKIKEVLTIPPEIGKAELEYVGAPRYRIVVRDKDYKKAEETLKKIVQSVTDKAKKLQVELEFSRQ 254
2 -73.100[J] KOG2916 Translation initiation factor 2, alpha subunit (eIF-2alpha)  ali follow..  18  8FYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNNMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQME 274
3 -35.300[J] COG1098 Predicted RNA binding protein (contains ribosomal protein S1 domain)  ali follow..  33  4.......EVGSKLQGKITGITNFGAFVELP--GGSTGLVHISEVADNYVKDINDHLKVGDQVEVKVINVEKD-GKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLK................................................................................................................................................ 103
4 -33.400[J] COG0539 Ribosomal protein S1  ali follow..  14  269.AIAKRYPEGHKLSGRVTNLTDYGCFVEIEE--GVEGLVHVSEMDTNKNIHPSKVVNVGDEVEVMVLDIDEERRRISLGLKQCKANPWQSFAEAQAKGDKVTGKIKSITDFGIFIGLEGGIDGLVHLSDISVPGEEAVREFKKGDEISAVVLAVDAERERISLGIKQMENDPFNYVSDNKKGALVNGTVTAVDAATIELEDGVEGYIRASEVSRDRIEDASLILNVGDKVEAKFTGVDRKNRV........... 514
5 -22.500[S] COG2996 Uncharacterized protein conserved in bacteria  ali follow..  17  149.......MQNQDLRAIVYRNKESGTFVYLPD-NNMLGFIHPNERF--------SVPRVGQELQVRVIGFRKEDRSLNLSAKPRAYEMLDADSQMILAYLQSMGGKMAFNDKSNPDE----IKATFGISKGQFKK-------ALGGLMKAKKIKQSPEGTEL............................................................................................. 282
6 -18.400[K] COG2183 Transcriptional accessory protein  ali follow..  22  649.......KSGMILEGTVTNVTNFGAFVDIGV--HQDGLVHISSLSDKFVEDPHQVVKTGNIVKVKVLEVDVPRKRIALTMRLDESAVKNDSKSDRTLST........................................................................................................................................................... 738
7 -16.600[J] COG1185 Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)  ali follow..  28  639......VEPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVD-KQGRIRLSIKAVEEEVAS..................................................................................................................................................................... 718
8 -16.000[J] COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain)  ali follow..  24  71......PKKGDIVYARVIDVKQQAVLLRMEIATSKLAGIHISQVKDGFVEDLRNEFKIGDIVRARVIADEKSPIQLTTKDPDL........................................................................................................................................................................... 156
9 -16.000[K] COG1095 DNA-directed RNA polymerase, subunit E`  ali follow..  21  89......PEMQEIVDGEVVSVQKFGAFIKF---SSFEGLLHISQIMDDRIKETKRDLKVGDRVRVRIVAMNLASSSISDSKIGFTMKQVGLGKLDWLAKEASQ........................................................................................................................................................ 192
10 -12.600[J] KOG3409 Exosomal 3`-5` exoribonuclease complex, subunit ski4 (Csl4)  ali follow..  16  69......PATGDVVTARVLVTTPKFAKCAIFCVRNYRGLLRKEDVTEKDRVDIYKSFRPGDVILARVINQLEQSFLLTTAENEL........................................................................................................................................................................... 153
11 -11.600[K] KOG3298 DNA-directed RNA polymerase subunit E`  ali follow..  13  82......PFRGEVVDAIVTTVNKMGFFANI---GPLNVFVSSHLVPPDMKSGEDQVIEKGSNVRLKIVGTRTDATEIFAI............................................................................................................................................................................... 161
12 -10.700[K] COG0557 Exoribonuclease R  ali follow..  25  650.......HVGEEFTGVISSVTGFGLFVRLDDL-FIDGLVHISTLDNDYYENSGMIYRIGDKVKIRVEAVSLEQRQVDFSLVSSERKPLREGKTAKDKLKKNAR....................................................................................................................................................... 755
13 -9.980[A] KOG3013 Exosomal 3`-5` exoribonuclease complex, subunit Rrp4  ali follow..  21  103LRSKYVPEIGDLIIGKIAEVQPKRWKVDIGAKQ--NAVLMLSSINETDELQMRSFFQEGDLLVAEVQQYFSD-GSVSIHTRS............................................................................................................................................................................ 191
14 -9.760[J] COG1097 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain)  ali follow..  20  50LAGAYIPSANDVVIGIVIVVTPSNWIFDI---APYDGLLHVSEYPRVESREMPEILNVGDSVILRVKDVDSS-MKVELALRD............................................................................................................................................................................ 129
15 -9.490[K] COG4776 Exoribonuclease II  ali follow..  10  553.FLNDKAGTNTRFAAEIIDVSRGGMRVRLVD-NGAIAFIPAPFLHAVR-IKGETVYKVTDVIDVTIAEVRMETRSIIARP.............................................................................................................................................................................. 642

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.